h8(pf!*dFirmware image with one or more FDT blobs&\U-Boot mkimage 2023.01+dfsg-2+deb12u1Mimagesfirmware-1|2dU-Boot 2023.01+dfsg-2+deb12u1 for wandboard board HfirmwareCarm@u-boot4none/)hash-1zzeCcrc32fdt-1x|dimx6q-wandboard-revd1Hflat_dtCarm4nonehash-1z<*crc32fdt-2xXdimx6qp-wandboard-revd1Hflat_dtCarm4nonehash-1zc]crc32fdt-3@dimx6dl-wandboard-revd1Hflat_dtCarm4nonehash-1z&9Ycrc32configurationsconf-1conf-1dimx6q-wandboard-revd1 firmware-1 firmware-1fdt-1conf-2dimx6qp-wandboard-revd1 firmware-1 firmware-1fdt-2conf-3dimx6dl-wandboard-revd1 firmware-1 firmware-1fdt-3 fdtloadablesfirmwaredefaultalgodataentryloadcompressionosarchtype#address-cellscreatordescriptiontimestampvaluedata-offsetdata-sizep` @ﾭ (OР iHMP  H4P  OР iHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P c1)  ,/   000@00 00000P!:0@" РvpGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDHF !Fh a a8 DBpG;?HKdKaKa-MF F+M,OEE+K`M<0\ \%KB43B#KB;B*y*KZ hDCJ 0!? ?#9FHD55"[Er BR  NB~F9FHD칄pp  7%F#h#`0F90OoBдB  4kHBHA.2`B`A+*h2"D"`K` I"K`-E"MF+h iFFDB,3B#`##`%h F#FAFX$#hB$##`P(F-h5BO :FAF(FB( ,#`-,-A FFFH)*h(Fd!FB)F8F++  F3K,0hZB2` (F"8F FHHFFaFFVF H(+"\ȱCh;`###hhB"`- 1K,(Fo FHH IM h.hB($3i( ` 1K,hD79D![R3aD-h F*i:ha-M`O1F`Dc  Y D)D!DO1z`F "XF*F F ` V P2"D"R*a :sha H K!hiP 0pGHpGHpG.F B3 pG0j L;:۲T#0 ЋFL"WB{:D3LD?C@۲T#0B V[h@ŲT%P%T  ŲT%P%T  4 CC%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdH# Das U-BootRUNTSERVdP~}M~%OŃ} 僃#??OopG@ռ@ȼ[#???Oo8F F0?"3@SB#@BؿO)F F8@>?D#???OopF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGFT 6 . ޿/ПBM P-xР)AР)AGLРT P<>,,0 SGG </$2 _/_ РP/< /0Od@P TP  Q:< 80QR:/\dd0k(80g(2 p(н@ ,-F( |(F |*F %(F"|I( H*FB %! |q2 A| |]2 Av=(FAF(F |+F8FA (*F3FIHBoθ-6X6(FF-F !JB(TF3F !JB(|HFh1F F (FoF0(|e(a Fpo-h9hKy_pG0-A3H&3NF7FȀ`%0Bٹi FAUP7ȱ5F0B ;i+98FG(5мi%H!FBk,i#H!FBe%0B.P hC7h09!h0D"Fй{i 8FGP#fisj)F2jHBD(FIA F5P7Fi HB2!F HB-o( Ą#ĄEĄZĄ_ĄĄ?+ 0?ZC@0?OopG" IU@"O!OL,K!"!!B!0`(8#Jj_9Կ_OsJ1_ 1`?_h_~q) #CCCC@SC_`??_C_?1C10g(ѿ#_b J1#1pG _Ow3/I `_K`_,J`_S`_# d_Kd_d_d_ e_d_Sd_d_d_e40e(ѿ_Ow2K`_Z`_"d_Zd_d_d_e0k(0b( p('0d(0e(L_#J_Or0b( ѿ_##0k(L0d(0e(0k( p(@ (Jh_#_`pG KZl"BZdpGBZlBB_d[l_0CS_JSdpG#S KZl_LlXh_pG p FFo `+OeOed up+p5.P+j_"p bp pp+i_C"qcqpD0b(>0d(80e(20k(,@0B$0@0B0@0B+i_ "pcp+h_p p"۲0c(0j(0i(0h( IKJkxBCKcF-MF'\ [[-O| 5U ET< "I F" F I@FDFU F4D67D5{ЄЄ pG*-AFFO0IXh@qAloh@< h(9F@ap4@, h(9F@T4. `hch{#FFFIh@?(`h ЄT8 MF(i#+aKJ `Z`fPF`,a8 Ky۲_  pG0+O0 O Xh_pG0-K_B`*5`_O ]h_Ba*O#̲۲% Fc* F۲- c;h"e*j*%3@00Li_dHk"+Ȳ#k Ff"c;i"j*-3f"j",O F  p%KF F@Q_0g(3д52@SB0K/tCLp!_"|R_.p! J]@@B%C_X(@B@Q@@ p##o Q(K\h_E0b(@Ԁ$4_K\`CP!_տ_"T!+0e(@K4_J#R#0_JT10d(#0e(0k( KBzIJi_}K"R ;B#_Ka0d( (𢀿_KpK"0e(@lJh_C_`0`(@]JiC@a0b(WJSjC@Sb0i(@=_O;UJ&_"$_ %_Or&_'_'_(_"&_'_'_((t j0d(?%c0e(?\0k(?U0`(?N0g(? $@4D0k()"Ji_#SCc_aX00k(bW(0a(?a!0f(?Z0e(?S0k(QJ 0h(^@  {#  pG(۽@  pG(۽@ 0g(@A . pG0b(F0d(@0e(:0k(40g(.Ki_Y BAS+O#* * C*O#)п_O1 J_1__1K)@  8M,x䲿_D_@0+p@D_@0+p@D_,p_O"Zq80Jo_C3_g_O#KqSk_#s#Cs_ScKx۲_п_# Jpx۲__p_p_p_p_ppG@ Kh\i!1D$Khi0g(c+H00`(0b(0i(0h(0d(0e(0k(?1Dt$6nKhiChKXC1@D^$6n(7 FM-0d(0e(+hC!k[I3KC$%00?#@@hF#?0+hC i[$6np%KFhi\jV0d(. pL0e(F0k(@0g(..D% 1.$5D5! aD..T%!$8%KhBi]j0`(k:cJ3SCH0?1D80b(0i(0h(0d(0g(0e(0k(H$6nKhoC@SgpG#@S$Kh0 C0pG#$)8Fo8"KI1@h oC g #0g(0b(MO@q+h3ẖ C`q0d(k0e(e0k(+hO@ql3"$KhZitdi@_1)H aDCi@K0XCi@(((Ck@!!F ! z@$6n Kh[iZD G! ! daD$KhiAq)T))aDCiK@0XC! 8$6n-AZO;h^i0b(dJ3`+QH,Ѳ;hCi[,0d(0e(0k(0`(0g(6A1;hC*k[3XCiD2aD0AP((( ;hCk(K@0!!F Z0`(! @:hBp1p 1 C+!+ ''oP0F.`FDK@DXC@9FD'H$6npVMVN+hVLChUHqCI1 A +hQHCkI1qC1 A+hJHCi[3sC1 A+hDHC0@D@K31 @=H@;L;H @8H @5H @32H @/H @,H @ >(H @ 5%H @ ,!H @ #H @H @wH @ p$6nC  ( < @x}`YMbP d x         , *0JoC0gB0_#Q_I9opG_()#3CQ_C_ 0pG@ Jo#0gpG@ Fp( !kosw|~p@2p@p@^p@Իp@޻p@ļ2M+hk0Di(s.!F+HDzp0h(0`(0b(0d(0g(0e(0k(+hHCi[3XCp@rp@p@ p@   H@ $6nuRLcoCcg`0i( 0C@s0coCcgO0h(@ Lco#cg@0i( 0#@s0co#cg/0h(@ JIhQ  C`pG KFhKS 0HB""@(  쏄gЄF!h@,,, Kb JIhQ$ C`KcKc 쏄FB4  JKS h #`pG 쏄! H I* g I+ c!* ;@!+ 5FhjF2 @Fah@ %!HUI< 3< < 8 GLF$ d F# "O1&H"O1 FD "O1 F"O1 FKOrxOs)F@"O1C F#"O1 F"O1 FCs"O1 Fchi FG !H' XHU(! H@$" Km!p B2m!B ]c_n_ pG4H0i(;0I1L1H #x+I/I0H !/H#x[!-H,I n! FBp?P'I] b!] :Bp?D!] d ?=#x H0h(0c(I0j(IIIHC HP}ÄÄÄÄxhÄÄÄÄÄÄÄÄÄ6J0!c "3KQ0c(,0K"! .K"! *JSk_C_Sc20c('DP"H"It t  0j(0i(0h(K"! LK0j(0i(0h(P! H`@ lHBÄ0<F0c(I F?o0j(0i( I 0h(0a(I0f(„Ä+Ä-EFF4MFF*F#9F0F0,HG&0KB0BؓB$K:F;1F#PFHB0BғB!FH@| BB0DBB!FH#9F0F#J(H@QE˄˄j˄˄˄XF# F-MdF0 3C0բMOr!(FH%F#F9F>#0c/+"!@]-^# 3-U# 3 O OFF2((r~Hh@-7 3+)FxH@*hwKBvHgOnM0+lrH]O{(FnH(F kHK(FhH@gH@i)eH@-Ы+ ++@0h0+ZK!(F`@")FXF? #K\{dRHhd#)F8F G( d;e xed@F((1AH000000 0@D000000++m/J! (k0i+HZiml'HQiml$HHiml H?imlH6liml(H'el'V> ?+?@Wukl+QЫi00+ 0 D0|rIc RF(LH$H$񼀔5F(@ǀoÀ  FH@b+mC~Jiml^({H{H{J)zK AԒ0++#RF F(@Fo 0p Os0{9FFZF@F0 @ @F F& !oUH@TH@ SF hO8NH@?1'?!?0 h ѻE B BclC"0+4>Ho/=HkR>A#8F8FF(r0q 2h%-?ea#FRF@ GF(AF"H@T#FRF GF(#FRFOpGF(#FObQFF ?d?.m9FQ .RpGoFO,@3C8 AH@7  A H H@##0l8 F5`-AFFܽDU F>7(h>B'o ZlB@H!F?G  #o FFF#[lH$0P!@A-F #:F)F@ H!F?G H$F(0F>P P0oF"Zl 0 I(F?v#h5F kF"3!kF"F* co-E FFFD[l "0+%O -+&FW(>Y0EED0FY #:F)FF?@H!F?G3FQF JGjF!PF+H$K(FF ;VP-MFLHFF$zFpFO 0F>Bغ"BH?#FZF(FMF=) b,f*!@F?eO GF2H?oWcl+=0):(F(FFHf)F"J63H$Fб`>#D+F0FJIM( 63IFH?  F H?N F H- Pݸ.p FFF$j0H$ p1F(F0G\pGFFFF+F1F:F FG0+дpO0 KS pGhhx *pG3`hFBhH?+}I-AF xF/+ FF}{ñ#0(F>F>D*FH?o# }Or!i>)F> H?BF I? FehG( ;`:;csFF FF$h!?I( 3F)F FpooF@h h i`iii j`j F@-Eh FF9FFHF;3 *\ԚBѪp `P! HB"h#U#c`Sz\ 2Ҳp1,-A F!hF a`F ) )#)#Fkx )"3b`+` .# "*# "!F# "!F&OW6) h>0c`6Ԗs" FiFFh( !h2FH?op+`?YF"iFFh, )h:F H?o "!(F?w0`(F' FXFH$H"F!?C(o o\)FH?o@FHA/0 F0 0 I00?t o6ƅ6-M% FmK")FF @")F"! F:#b#kckBxH$,F`i@Or'sH (F>O"F(Fj mh#ahjH?BiӱPFgJ^(ahdHbH$!F`J?( #PF\JhC(ahYHjXH$rFWH$nFVH$jFUH$f3F*FSI!?j PI>!7(#d0jei0-VOr32(F>F!>D>5Dai#;H)F>F!>F>OrF!F*F2H?!Or32Q,K-F!Or2>L!2>T2>POr2fH &H?H$#i+@>F i>D5(FPH?xQGGPGG H5H (@!jDlDHFI/.F j >F >1(F >F@F> F11D8F > FFD >^DD0F F0H?(JFF+K 1F#j&J?m]F#YFJPFF(F.Y#i+?SahH?%$R(H#+?ZS KTD;HeIII3;VGI҅G0I=InIF#(" U-M FF(FFF($ ZF)hH?, F:F)F0F)FH?CF:F9F0F(M;;-MFF+@>!H?o8F'/a>:FF  +++)F "3"+FRD(F2FH? F?D F(jD"!O!( 2FH? Foi<ac"d`" ( +ǀR#T[V[V-U[V[V[VwUwUUU?V[V[V[VV#V1V[VOV[VUV"  + +khc`h>h`8o J02FUH?6  3QIh>F(>!0' a(1F>#3pFBI`i> !0F>1FBFa>i/^i+YFi+N#j+G cj+@$#4#c(#c."V +QR#]VWWSW_TmTWWWWWVCTVWWWVXXXbYrF$hhl`/|>q3"+FRD&"FH 'eYF}H FF>RF F>N8D"F I H?Ho# }I?2F(F:::pF%Fh|`hyUhB Fp@o<8^0F6hsF FF"!caa#2F1F#F(F( F$ Fp-M FhPM#*h(Ux 1 DGr(hF.%hEJ 3 DK+F"i hF(rУF=H##F"[_E,+-SF7H>M 0FF0F-P (LdiEIT<#<$hh&H><S#I@F>gBFAF0F(0F Mcah1W8 =I(F+FW8 =?FEF?hFQF0F (0ah H>W5 gfff}K;;;`<-AFFFF!"0g``#su(F='(F=\ apo H=S a(# "iT/!(F=+(C3o;ViQpFFF H> p#a!F(F F cFF@"hF=t @"iFchXBXAFh@O3 <:iXBXA< S/pG0FFFB"@T!0<5;`FB0D0`U?73#D 8`h+ pGB 0 FFh FFIH9lFIH9ȡFIH޿9D-M zF1`زF F,FEIH>L #D3`IH>C BEoFH>8- )FH>2o%O3QF8FIRFAF8F ;&(u>y>>>>FIH9 -AF  "7I8H>5I7H> wF`}FF;F2F)F-H>(I,H>h0"i$I(H>bi!I&H>*) FIF H>%O|B)F F*F9F@F>+%9FH>5 +!ihH R@9A>5??????@@#@;@8FF#h+O0`h()F= h8 4FIHtlFIHݿwȡFIHӿ&tDFIHɿ9 FIHooF2>K` H# @!>OP !8H#t "!>84@@P8 aB8PH-#^0"!>,D  F8! !H#L@Ͽ"!>*!B=rpGs N FFF1hX1h+F F%F F>9Fp#iF3]KhB4@ @ 'Vl8 pG-EO (vFFMh(FhI=Z#l( #m#bK"lcl+Д"0+!h\H>i! h%lWI F 0, LQF(F XQF(F F(F> ((a-x:!(F=#(r!0> (Ak :H> 9K*h@B7HoY(F*3H(F\1H(F2.H.H++ kE+Ѹѫ+@FvF%H>-@h*:`D3`x## F ( fe eH^o ҅DŽfq*DŽ'V>?+?bDŽ}DŽ-EF)H FFF#!>BF}+5`"F)FPF;`< FS#3`;`-OR!FPFkXO3"F)F0hq?0h!?HȄȄȄ<-MlF l(F}(P(Fl}&(K)JO #(F&J3F4 (  ###)F FH ((F (F +(F(O+ OE6;hSE{h G 7H> ƄƄsF0VF(F1F(F8*+F FGpFFH> F@!J<9`Yph h0FF(Fhhllp`@` sF@Fй@ }F@"1FaYiZa3`` `0i0xChD``(Fpo pFJFF!Ch>=Fp F1FhF k+` F po ʄ-AFFFFF=B`b(2Ыh)F ja`(0Fhh#b#+ah0Fi#bx#b8F I=_#b(и#b!F j;o CʄʄKʄ7 F!Fv@)F FJa0Rʄ0FKChJ F2!>u FF 0=FP)F F(o RʄʄsF F~F F(opI`h=)(ahB0F3(+`Qʄ-MF!F>yF@FBF AF+H>Io0Ft(>%(FF8BF9F"H>5oh,<,3B{УlBj! F9F(F(XFXF( K2! J0 > (0ʄ$ʄRʄʄ-AhFk F;hF[hF0F2F)F F;hAGo%F hB -M hFF F0DH> F#;hC;` ~F(h!F(eУFF [E[E3H"F(;=c(o(FYF  E(   1F= "I=F&,o0F(E'E$04YF =F"AF(FK;DF#a=ba(hEF(0oo 2F!FH>-Zʄrʄ6Ubʄ8F Fh0#he` +-ihH8@>ChhHYhH8@>8ʄʄʄ840F FC!)Fh8@o F8@F@h88" F!FO3%`b8Fj% k@ FF%ci4l3"kѥbh``#h%a i3aiiB;! Foj`j3BbR#0`1F F(l`a&#h[特bh"`h!i3B`#h`%a*j4Pcbbh""jR#p8Fx(9F FJs FFFB)F Fy Fop F(Ѣj#kS"0`40 F1F FA(l&#h[`a1F F]F FF pFF!@"F#&a%bbpF@jdja k^`k@YiF3#S``#`C`hh FS``#`` F@?jF+jU(o oF F jHZhIj= FFFH= F ˄/˄@h'((H H@h'(H FFi#pGhk[hGFpGhkhGo%pGhkiGo%pGhkhF`Go%pGphFk FhSF!(FL)F Fhp@Go%p-MF&FHiV 4F(o8F!0F`F(>$ OKFO BE[EO bQF xABhтH$ 4  ,CjZМBb#400lbo pFKF*F!J= kG<, c#1FF FAPc#b(F6po F;VD;FkFB!yF"##F0k#F((F F#BB #Ubucoo o-AFFF@FFAF8F F#a*hBAAF8F`"#1F F##]+`o aCa 8Fh`h iB 88AKh(F 7F F(` F07( iB08-E0  ñ1F {-KLOK\CdB{h+ 5D7XJI( "QF@F< O3RF9F#4(мvbj pGp FF"! Wjfk# J TjFop1F(nsF FF!"Fh=OB"`F*FpK` w F عci i$fiF0FzFu/F:h1F F KU`W?+*F/Fo"O1 FsF{-A FFF"!0Fj4# J1F(FtF o AF(F(osFF FF!"h=fF"Fyp-E$FKFhF  BFIPF="!F(h!XhF :hB;` ooc(H F"$(E"!=F%F8c/!<`4"FbjUJjJ!+FJ=c<(c o 0F7#b0F(9F2nlcO6~;VD;F}K` Sl0KkJ2!=$!i(o]W[K` ɅFui F+X/I<<,F<'(K(I F< F'I( 0Fkk*k F? HooogqyՅF…FHj Fg@Hba)i)-MFF F3F F3FUE! F8J3H F3(F( )F F3Fعs9FBFF0F;( 'H$:F%H=v5 )F# FJ:pFp)F F:ZH)FJ F:UO (2 OCFRFYF0F;( HZF;FH=;)F F3pĄĄĄĄĄ-MhFFF+{h0F300>HP ;HP!r@WF=BF :F1FXF;.E1HOR9FXF+;F0+H;F(?R?2!F"D&H=:F!F0F3(7"H k l dAEtXFB( F9FDOR;(F?R;?21FHs`2D=4F@p HFȄ ɄɄ3ɄɄɄ_Ʉ-MO FFFF) F(Ucl+^Д"0+Z!hsH=r ! h +MmH!F=d F2q(ɀiHQFh=Уl:m+2XQF@FXQF@FF@F=@F(%(uQH ll# FMI #mLFK(A0 BH= F?H F=H* F!:H:H+8H 7H@@F24H,'ih?BGE .H!F=4`ch+`BB'HAF8F h #`o/#FJ3, h #`o 0FjFFFFhjF9F F`h0 D9F F D4`+`+F2F9F F@FJ2 `@ @B"07FFJ2(` "`0FO03-EFF FF1F-HF!FGH<:os;ADK@1F(F&F!F?H<#@4H<1F (F!FF5H< +/и/(1F(F(!F+H<1F (Fl!FF$H<K@ձH<?~1F(FF!FH< HIMH33-A!IF2Z 2IFH:H( o BFF8F;=0+=:nF@F-IP@F{o "(F'I:F($MAFU;:XPFshGF( FfF  CF!J;X*I&(`I(FF H;Pm̄Ī̄T̄Ȳ̄̄̄HpGHpGHpGopG(opF F "!E"FIlIl"IlIlpIl |8IluFo0Fp Ili Il:a(̄̄̄̈́̈́"̈́-̈́[iK`#C` w-A}FF!Fi;` WCF$?miR*o }2:-)F^F(Z@FiCihDo-#F"0Fi(oOr!F8F:@FoihhD+-#F"0Fi_(bx *O0@@* :a2#xBch 1ooopİFFmF`- C)F 0FJ;w FDpoԅ8FF F:Fر FI F! I" I H:i K I(F F8@o 8ԅԅ ՅԅՅԅ-AİhFMh%N%O FD#h0Fh:/F(69F(F/S(@FIFYhFlF(F(F(hFUw̄FFFG*pFFT!;}FF H; "Fq(FFH$; FpO4-E8FFFF 3Xh;Oxa:)*#)( "I`hv`hJ+  B H;O0@!1F(Ft8 #KBF@sSF FH!F@\FF"H; F(($HH "hKBH   FH FbH FHH  H O1 FzH F F( H>|?>'V>?(?9?M?d?*FF Kh@&$!W$;4(&B0FsF F &`KHhV;kF"1F Fp̄7ML#d FIFaCH0m۶*̿XhH:l;V"iF 9;H kH h 3]%D-MFF FFF]FP6ܸqbI`h:|F(@Fh;YFFh;YFF i; FCF9F2hUH;#FBF(F1hQJQKFBFFOH;{` "KIBF`h:OF(?Ѡh;FF(F4`CH;_"BI`h:90(F "9I`h:,X(F1h(9F6H;A "4I`h:O0(F5(9F.H;-+I"`h:F(Ѡh;FF(F=("F9F#H;"I`h:F(Fh;~YFFh;yYFF i;tFCF9F2hH;#FBF(F1hJKFBFFHhaf㿄k)鿄!D, B!HtpFFwF . jhx-*H;O4 F p%`q)FmOzu H;$=-AF+ FFO0" Iph(ChbB-hKB)FF3A`G %FH|l *9 78Nh8O,<,3Bclbh 3F;F2I2H:cl FaFi#-HY*j#+HS!hk@*(H(I:j,<l 9S97F H:.@HuHSenvT;V*-AFFW I"Xh @hCF:F1F(FFA`GO0*8F"XhF:"FFh:FF(F*F!FH:; 8O0„H:& ]„-AFFW I"Xh@hCF:F1F(FFA`GO0<**O0!Kh#xB+cxM+TH: !Xh:_F}}|B"#~`~BB|BbC#!}HCCa}Ca:#aHC!:!C# HCCCa: ,@xFB+ FFCxM+(H: px hGpB 3XBXA3F*F!FV8  sF&hFFf - --.Kh(Fp1F`h:F1F`h:IFh9/h1Fh: Ih9%0GpGp!h:O0q8ML(h-d h-a#J+``J#``8#sF F3Op.FH:(F ^0H: . Fp'iF0F){F'd$A H:)H:-'1 )Kh`Kh `pG-EF 0F*BFFJhDB"!F(F-8O1(FFFpKP`BF9F0F* K`<*F F* F-K`N-AFOr!-9TOT5;lB&nCyl"@F1D9F(zl2DQ||C#||CCSc FHXEH8DH:IDL Fh!:F @H:)ЧBHzQ4X$ c g/]y"Hf"(F9*x?* 2`23R*)FH32x )Щ[**3MKx]*0x *24X$ B\Dx])?[9iK2 CF$8E@F8*D4S/BD7hhxg+@̀#/2/њ0s+))i0h /0n+s+H/F!F0h/!FF0h/0Fn+/!hi9FO5{BݓB 5n* ]E !F"0h/F@F!F0h/jښ0s+@FiO;KH9i ZF!F0h/F FI(P*Nݚ0v+>/ "!i9F F)Fȹ-"h9I.&. F877D F820>DB!F'- +OBYF9F96%Ha+F$I9s+rF/FHp+#l+@ЀO/6/4hQF0h/)0h,Z)F"F/[F"FQF H9O ,;VTR|>$-(!FH9(FqH9")F0h/EF pxK)FIH 94,ݙH+J#F1F0\C1F(F7*(=3xs+ c+ i+!O4t+O"(FFF)F@H8!F8F F FOOO7IF83H8rVF)F,H8b_!F)H8['и@_Fذd !F$$H8?'_FH826$BH6$6m2HQq>*-AFFW I"Xh @hCF:F1F(FFA`GO0Kh+H o` =FFF . 8F<FH8  Fhh8/FF H8)F8FF(FH8,F >Tp0H8 ]7F F@+F"!F0@f0hFFFFP.%F"hh8FH %O.ۮB ")F )F8F8T45- @ O6 * T0lH82$O1Xh!8FF H8$!F2 F@FH8  K` FBhlH8clաlH8H8 F LhChhRh F8hh`Yh*2 h,<,3B  Fj!Xh81FF2 uF(!FH8 *sFF(!Xh8F0FIH8$. Fh8F'FH F+H8y FpO4*sFF,!Xh8iFF0FIH8Y$ .Fh8FF( FpF(H8;O4#\.*D@x08pG3+O0pG-M*FO78FAKh`!8h !Fxh8r!Fh8mFh(F@FcF@s?1FF(8+IE,)Hٲ8(H %D, K``, H!H H83,&KB#F)F%F(%D)FH8#F)FF(FIH8'},ȣģ+R:RORARHRtц3R U R-MFS+FFM S!ph8!Fh8!Fh8Fh#(F@F!0i8F8FF8k)FPF:F I!H86'8F2FF!FD E ЫhC`#LF(B 7!F Ipi7(ѫhRF#`!FCFsF(о+R3-MFHKh*FKFhFKhFKO5(F QFhh8IQFh8DFh(F/QFh87F3F8c !FWF(.I.H8%FWF/('1F;FFF1F%H8+F  BO !H 3>D_E V K`K`K`KH8t3 ^*H  H8`ԣУ̣l5bɅY*-AFO0Xh!8!Fh8Fh(F!h8!F i8F@FPk;F"F1F(FIH8 )F(-AF+FO5(F!ph8f!Fh8aFh(F(FWF@{9F{F!h8H!0i8?!Fc+ #N4F0B 7.1FFIH8% +R*-EFO5(FXh!8!Fh8 Fh`(F(FFs1F#Fع!h8&bFD!FH8sFF'D;+ܺ 2FIH8eFIH8_%#!F [F  @F" H4FAFH8E!j-A*FFJXh!8!Fh8Fh(F:@FF8k )FF8IH8 !h8(( .F i!8yFN4+F9FF1F@F8 F7dOztO0+Rx F**O08K,,,xh8=,O3@  x*+!08+$+Cx{+0FF;}+# p+FpG pG-MFFFF7F4Lh BF(F!h7o(T h7EOeh>PFF8FF F7P-G @ 8 (Կ  (̿  C1FPFz1FF8Fu-! #XBXA  B  BBB  4\E)FH81 d̿*FFh (F(3 H (hahho@ #O0"K`KhK`pGKhK`KhK`KhK`pGKhK`KhK`KhK`pG @ PO0pmF FFOa wαp I m h FH7O5$pDDvJ+FFH I0F N I?(F!?!F"F H7k!FH(F mp]Ȁ/K;V4K9K\Kh#JhY`ppG#I/*D?pGD8 K Mh,L (8(x < 0--MO|}l 6GFO6 z@%TF=r   (fc(r(p  Qh9JB /(c(ܠD!F6\Fȱ!F/H"D7(FP8(#0+d!@F; ). : F!F6B3#D(&FB8F|Bp7#F:F1FH7!F0F!FH (!B F: (O0 |}p iJJ\8HFF x1PBPAK-``h"!7FH7Y F8d$F  Ozp6;F)F"F(F5l K5DPp`O0 DHt8*L!Xh7 `!hH7% 8* 3: FF!H ]O0F+F8!h7s!Fhh7n/F!h7gH7H6e&%DB%DB1FH7 6F6Ih@6ED 6@ O0Fﾭo*pFC!h @@!ph7'!Fh7"( -#h-#h-##x-#FF*S:-#FF*S:- D#FB+#FF*3:O0p -E*FFTh Rۣ+)JOphR#p&O7!0h70!h7&*F B $,h hBUED7#F9FH7,$:F1FH7& F,, x x"D6O4$$80-M FF@P !h {vYFph7b0Kh'`hx<06r(1FchYx-=Рh 7 6-h 9-! i7->ѻ7"I6'p}H7CO;XF!`i7<0i+F-VF&$6@pOBO B ;!F :H;0!F :A!FF( ;FCF!Fs\K\I ,(F!FXH[F64r+Zѝ6pO K`>K8 :K`:K`~Os*F>0!F >m*F!F9H6O 59EҺEаE3H64䲺EѰE*F!F.H6>,H65Fw+!O 6@'NE8Pҡ*F!FG0*F!F0F6uO 59 >0B4m+kO 6@ONE8PD|d\XTP`L;cg`YG`f#*F@0!FH6#!F0F6)FH6O 590B4䲯@0#>  @C*F!F@0(8F"pI5(@Ā80 +؝90 + hH6O #F6p EbM3F9F@"F9F(F6#O 64 ⲓB +VH6{߲TN3xB BAFC3LLHh"F6#3BDH6FK6B #uhCHUk@CF6j1*Q@)@06J7M_*F! "3H6i+H6f30J*)!F(Fk,ID+KF*H6ODт!F(F + !I"J+F!F(FqI"I5 (-hv<`Y엄lHk[vsnx;sFFF"6FB0`O0p x-* HJx:"!6rF #`x*-M*FFF@n[hxKh Kh KhKhKh Kh K,HKFhhHx5(1kh[xx+-Ѩh kh 3ChCj w.[j+gr.щH( #7w.=/&U'!6GF#r.7/PU'.!@F5{F(;Р ZFAF5 `  # `'4f H~0F5^HOO4OND;DJ  :F*h$+C4K!h F&F}2F!FC 2F(D1F,J,H5/)K`i0+?!F(H5%8F!hh5!F!hh5!Fh5(F!H5 '! FF!hh5x!Fh5s(F!h5l! F1F J H5(F!Fz H5O7 . 㿄G  L! hpC !h 0{+ H[  *F5Xh!5!Fh5OF!8h_Fh#F2F9hH5(F(H5 (Fl"F1F -F K JFBF H5|` O0i  㿄 *-AF?Xh!5!Fh5!Fh5hF! Fp#F2FH5D(Fa(H5< (F;F"F1F F K JFBF H5'` O0  㿄 pFK!hFF(Ch+H5$ Fp.!hh5sF FxF(H5j*-AF5Xh!5R!Fh5M!Fh5HXF!F*F#FH50F)F;F"F 5F K JFBF H5` O0 & 㿄U  L#h+a( ##`! hM0 H(  *pFF"+IXh4TF0O0p F64 Fl(ܹ!F"H5a !Xh5F[)F.h"I4- (F "Ih4"(F"Ih4((Fp@?" I4 ((F 8 @BmCЄ__ЄJ-AFFF" FWI bChB -сh KB h;F)F0FFA`GO0 %𵇰6pF' PNhO,<,3B l0F7U KlB;FbhH5j,<ƅ@ ;VG *FO0Xh- K`( 7=(ahH5 H5   -EO F@PKFOHFF QF5JK`- -y-O5(FiF`h5ehF(F4cDB]F)FH F3OBOAH4 P!F03d C@3h POAOSg0( R)F2H4 Q(F16geef*-AFFO60F!hFFh0(EXIh3S,,,!FhhF FAKIh37H# hhaFEIh3(,h3H(AF(iF8&htx,++(8F3+F F3'0D0,F ,H4!&9F3!F@F3AFhhF$H4@F\8FY H/+ $+,%; +)#(((((^+ |+Dhh,Z9!F8F8xF!F8F8&H4-E*FFFPF E9IXh3lF&=4--4HpF8 -.HF-Ih3N,Ih3IF*Ih3CXh(H4gi!H9F%ch!h@F4(AFH%#QFJ"H4^9F(H4SL2FJFB  [~^cSog FF F"!hF4}:hFhxhQ`"#1F(F##` pG pG*-M@O O7FTFV#ر3+  BU 3lJ( hE$@  *%*/5>M\l|hh3d d @(,  X(W,9i t(Y, F?H4 ",!h:H4 "/U|"sT#6U!chF;+0J1JR# 1/H[4|@F3v( HSFBF)F'H4l)F&H4h,  й e(' H4RPF3K(0F3F(Cl F F(  A()F F\#;p ҅҅҅҅&҅26UF "!hFiF F8FiFt {ClhF  (Cl Gаq ?$?Os"F(!FH4P̅-MFSH41QI@QJ F 1NIOCMHNK F41SJH4(FGH4,FO1CEBHM4𝸔?H4 !?+?>sAτA"1A)\A_-AF')FXhx-*%JFhD3`>. (Ff+O?+#F9:FAFT1m(%O5m8 *-AFFW I "Xh@hCF:F1F(FFA`GO0#0 FFJ 0,H3F F 0 ! H1aiH3,Fmf!*-AFF[hx-*[xa+!<5, '&DB?+f+_H1J.h`0kBF(F,I0f 0 'Z'2 70BD F F!FH ;F &P+:F)PE&pџBKW# 08F(+ K)FhH3O0,mbx|0*F}00 }0hh FȱOq FJ3q"!FH3(kh!x J#A"iF C p#"iF O0h*FF")O0pGKhpG K0#0Or x3iF ]iF  -MFh#FFF 'F^F ;-`h x-)4!3*F!>4/OP"9FV:H0:7K8Hh3 s)b) c)O0t)+S '+OF#)dF+EO PFMݼ!3^4FI3Ho ;AtP"!H0`۸9]* 8`1 H;F"FHmx\P8 pGOrF!9t@7U$H2aKOzsXC2pG pG LFu0>J>I` =HQ` Q12IY1ZF)FY1 YDO[DZp(F1+FBbhSh`? к Ѹ6O q /#CF# J`6R&0 F F (.d+bF*.Fzȧ1=!F1Op0F0!XY_F!0[YB0F50XY(;#tJ`**׀@΀OXh/@+%F!/F!0S'0B00F;07 0S'0 F  F( *kTHpXXx0+(;#  D# [/(F1 #+T(DBp!(F(Ff?Kh{o93 #oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H0 F }F1FH0o")Fp$1:]:8BhF* F#1#f1 +g0&+%+%IH0yo@!%fg+*"HOzp/@+# f8###х-EFFF%<@x#hn"A!d# F#A (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F("#xcx#Ie\B3ZB\\+#xB F#p#(o,+8FOEYC(M)` o89=+Ozp/3o3 TopG7hn&A!OsG"#AAF(۴#I Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H0ho"p1FH0``uͅͅFFʲ!q#pp#&QwBH0=o$ED&1+ 3nhC$Os## "DApbх-A} ?FFFF$?˳³#p(z#FF(/#x+,O38c9#FBF0F( #?4ZB"F*p }Bcx+#x;4F?#oo"-MFFF(Ozp/*1F F0?@ !?sF;FF1F FGڴ !H0(F>F0F5Fo `ix)ЙH0<*x *FHO;)FpcFa^F1B!9xzx*T0**? )ІH0V9BۃH1x[E3Дa.~H(F%Oz1B&O @s F19Fp# K%1#&1;xDr#C&!2&!) )`HADB^Hs]H#sC%ݒXHl %p D9F D"sD\HxB"T Jp)HHuBFHwpк?DHp# p F D9F2F)F Fe60B5l#hn FA!d##!AA "FH)+H0of gBp/( "1F@FH "1F8F1F "(F! #BF FV! #:F FN)?Ǯ #*F FDBυυυυυЅ/ЅRЅxЅЅЅЅ х*х#-Ah`FFFF0 H0& F1F(FF(Ѹ(Fd#ih/`#"(FAA H/Bp/n.(FA/!(FYF(хх pGFFF,Y(FoCh+h;p$9 iv(H/#;p3p(FXiF̅d#0hn#D$##"DA0d#pA, *%)%hn#D$-DA"#Aspd#0hn#D$##"DA\0pGisv8 pFnhC&d#"#FA#AF9, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FFb۸@(F"1FojT9F(F(('O Ozz (?"1F(F@< /lBF1F(F(۸@ 7/O O41FH/#"1F(FTco"oг ""1F, "1F(F8 F@"=΅-MF:}, / F&?(L`"1F(F('7x1F / '(F:F(:F1F w2yx!C#q #r" "! yy3+r@szcsx 9y"zC'1+"!(F#<0`@// /+hn"A!d##AA(F#A ((F(&@, F(O3c&gz 9B򪀤Hq0"F/B8F .)d/d0&`azp a 9B&O 9BT0+@#0KhBT 9 ; g#? J BД .{iB1F(F ^({ .;iB#ihS``#2z+"srzbszsA`/`@h#1+?X@##dS@4S@s,9i8F#c1+l.+hnA!d## "(F #AA_(S :}i66"1F@FI61F F_! k(IH/Uo `D`{h `z``a6`O  C F.Y:iB"ihJ`` F`#ayh ;I"1F(F Е1+"1F(FAF(F"1F(F}+AF(FAF(F["1F(Fg?."1F(F^"1F(F!i2*a1F H/#0 \oYͅ䧆ͅ΅S@9i "a pGFhhnA!Os#"zAA"!#(#h9%H. hazhA!nCA@AA H. hzhA!nCA@AH. O0IpF "!(F@C h0hnA!Os #%#z*FAA!#-H. hazhA!n NC1C hzhA!nC1Cy(F p`-Mx hFQHh Fn\BO$ kzD4 CD@DD#&BzD4 CD@D0+b !F(hF4O CECFFOs !FSF(h F(h 9+LЙ?!F*h9 E&+h9*;&(h"hnA!Os0+zAA!#(hI hnA!AA+hI0F  E 3ЛF  Dѵ(ʅ#sa# F%0$0F j hHOzuisBp.=ѣi3H/Uao #{+ 3x++ 8 @Bp#++O0 5҅-MOF FGFO а G&?)F Fk{F+@)F F+ L0+M0+ (Tл +h9(FjGoPk{+< "!0F#3p0)F[sp#0F3q0@0k{F)F0Fe+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x/O0H.F:FFo(ۙ҅T҅pLF "! F`$##p0)F[cp#0#q@0 #0 F+kG`p-MFFFF*es F\F l!^/Lz `4POcUE(C+ #!Zi"HjC "`*"p"pp qO Rbp0YF0 H%rGȱ XF" z;ѧ ! 8F  DD-MFFFF*e FqF !/Lz `4POcUE(C+ #!Zi"HjC "`M("p"pp qO Rbp0YF0 H%rGȱ XF" ;ѧ ! 8F  DDOshn#D$"#DAE-Mx FeI ư W *F'?H&?4 hzhC#n` CC@CVK3`0s`Y0`O3s0)FsssOs  #2F h-( FXO0FchA0.p hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz(ʅ짆USBCUSBSst % N0 H/s pFAh0F/i F5 Ӆ-Ӆ"K`pG视(H/PLH!h/K h(̿  @B_Ӆ视Ӆ-AFFFJ&!1+Cі"1;+>8"AF F'r%`"1#s#1+cs%P+&?J?K!QbF#"c !B ܐ"(Fczzc{ zk!{ +-1H.0J0K0H. +!*ё*a6Lbrr+!*ё*!r.!% 3 1zѱ%0+#%0#h(FhnA!CAAA!bK$9(FE( ?O# I#1UNӅuQOӅsN-MFFOO °~L *? hSrz0 "! F ##p0[cp$#0#q1F F3kGF`lH.TO70FB0+єL0:+єM0L BaH.=k{+х 8FB\H. /YK@Ԛ0"+# ks"E  "Z#O $0U0^0 "!XF0"[cpO  01FXF3k"pGF(sh GC'?s`"8FpO v# "!PFm%""p Rbp" 1FPF2kGx;!H.shO4b#s`Os#;h{h2?!!?#""?A!!/!!?4##'a G Ӆ҅ ҅-MF , [!FF(F#(f0h'hn _A!Os#$?3zAA#"A/BؿFOȿ;FZF !.#Os0"I, t#F0#FCrr1F(F(030F  F(HF(7GE$ I>F(6(F΅视΅΅ H<!.M( H.o EvrI ojjpFH FFxm+"F.M0`,!`-(Cxm+Gs+`pGp"0F.8(`j!z 5F",i"&!"!F4$HDб!F.FFxhFW0F)F:F=CF Foj-AFF(FW O%hBoT H,F-h(< 4`AF-(нB+h,FU Fo-MFF}(}){Ѓj+{h+VOFh #i FG'FW ?hBѣi+Cbh0H(+%jB,H.biJS +F-hS GU ]F-(=kh 0H.o }#h[h 3`iGF(%j+hBU FhYF-w(=ooLMY-MFFF(CЃF[ @EF F80F- ` Fo Z PF$h(ѺJ|1F-3(УEF#hТFT Fg`kjjb``j3b o-AF, FFF?F#`Ba aG`aab](F-^`8 Fq$ F` #bcbFرFU ?hBѠhZ FW S N8FK3F6hoFbFh)hB:B*1`+h!T*hH2D.+h3+`:B4`)hd,Hb1D0D-`+h!FT*h H2D.+h3+`< @ vЄ-AFhFFF<8 +*N#hBNE @F;h;;`0F4#h;#`+x h + 0D'#h#3#`50 `(xFH#h;#`"Dž-M0F FFkI hO0FJ`J`J`JH`J3+@+p"# `8F#(F3-9FO $F,O  ( (? #N+U+x+@ F2hK` FOs !+E.-FFd#3 C '(-PEq o,ns3MT[(O(b(kD 41+=o!0[+Ѝ"%0(~(ѝ"01;+  "02+Ѝ# 0+ٍ$~(s% OsAF <$C!(kD ( C+RaoxeP 5PPPPPPPPPPPW+@0)K+D"FF)D- !FFH.0  #F<+ 3pцlц8_hццvЄ#$ 0 <,чCB(]4},? <Bp< k1ZFF)D-vYFFH.   RABNJH . ;B?B;jaH.w <x,)?&JH. i;+(1хKh*Q`1IH hh`hB` K|KS!@,)q!F(F- (F-fF(?*FFlJh+lI hBiH3h`BĿ#`hBeJR#@^L  3ZJZH.= ;+K\E#8F+U-(XD@)F8FX(? OsAF!+?2hDK)FS"-3h>J3+#h3`Bȿ`sEۼ C! $"(8?+-;=3#F#o\++Ы}S+Oq-RF F }@pGKS CkGӆpFMU$kG(U$p@lGӆ @0 xpGF B0 ˿ PpGKS kGpGӆ B0 EpGF J0KXhkG pGӆjFGpF8F F)(#(KC$P, 8 IQ`0 J` I` Ia IQa0 JaO0ӆ iIj}i'i]iG(KS kGO0pGӆ @0 pG(7pG Kh  0+(@( K`|ӆxӆsйmF&,F-(pa; +> X" FI,e( p" F I,Y(" F I,R(" FI,K@ 3Є6Є9Є>ЄKh`FpG|ӆKhpGxӆ"K`pGxӆFFhB 8F Fs )FF F8@O3F8FIFFF,` FI,0 FI,  0- 59F !FH- 5X;XBX "KF [hpGLH!hHHahH}Hzhq@Hs1H-1 H- H@1-ӆkk6k>k\kdkIpFVHE# " FI+,! F+F F,CF!x Yx %(F!F@H+X(lBlH!F@8+H(ӆk8F(P! wF$ F8P")FL FhKHldH3dd `  `oӆ!K HddpGӆ$P"!hFI+KhF K KKKP"! I+K K! K$#  (M|G|C|?|;|j3|5|7| !!KpF FHFH%+0Fp@!*F1F#!cU FwF F(Fp*-AF'AF48H, )F(7BO0FH `!H8 \΄ H,~*@ R H,q"!hGFH,f1΄^΄-E FFF'8F.!+;x@F+DF#'FO FBѺ*F@F!h+8 h++B'F  4'FJKIJZCÿm۶Fih H, !hH,`i H  ΄΄΄-M 8+F Fmы3# Э NF#!BR,.OUFF+hU/hhz``+(  zhhE,+`EѸ%!NB#;c >k0F7FJ# 3>Z%(ѻ[F !0F ,5"F)FX+5@xC  ;kEPFX+,~&&O 稼7F FF , (O KOs H@0(OKhhOsֆ;V-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F+8@F+F$5? U,F$ F5BU +PERF@FU+(ѧBJF$ Fo/Є-MhFIh +F @0F+%1FȿH̿F+C(FKxF , ,t5A+FK< , , - "@C,-NS x$+IFи C#vK! OsQ(7(Y@U +_ @F+W"FD/DBt$t0DYByO *lD``WKWIXH #AC*FTH8-?e  `(и  (N,IXF+F QZF#2E3BF۠ lи @U +$, "~PFU7 2UDDe H+FH+N%F\ ,X HH, K0FH+'{M+ H>H;X 5=DXF0Ԇֆ6Um۶5`Y8F F+p( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*ء7BJ;B4#*4# 4#4zCO0Pt '&%O  ؆_6U -MFFFO zL)44+.+BO +404,*004B o0O34PF4F(@)є+4 +$ 4Bj#DB*4 $C4444+Nє)4+4+ݳB3FFF8F4v[44/D+DD4$4\- (D<+4# ()о$4\- (;48$ DB8$[4;۲B8 E \$A+. 94+#)4>(4+  C )434F #)4-p+4?jP;o(4+  C 434 ؆pG FL4;+        7#)4G(ڽ@H*s ؆0&KS HpG pJKFzL#DBahB40FciGch3r Fp4B$ؔF$ F!V(-M{F+THMOh7)E)BKRNHM+&)G1)JHEZ4t)b)C)I)|)+Ѐ)ZEzAz;H+v:Hc{9H!{)ZWYYYSYU3HEZ+Z.H+TAh,H,H,H,H'i/:ei-7 &m }C  2R%"K1F(F;/OO[; {F&H+!ciRFAF[FgH+HHHH+ HVU+{6`Yd@GV[pFX#N#rKM.DB FkiGkh#rp5ؔpFF(!zp@!H+h HU#hI+01+++$&+,H7+C+H |+ b+t+H+HH22FahH++i{ Fp@GHHHHHHpR\v\\`\\\\\ʅ\\\Ʌ#pP0FFFePh["F1F(FG(opo\o%8% F `iK`Cid`,I*I *PP(F8EuG\-M FF.! FF* F F*L#,U FF F+~Fx{"F9FH+o(FK0FF PF+cFx#RF9FHF1F8FF(#0oYFq(@#{+#hC+ F-M F!F`Fx"FWHFH+Fo @FPF"(F*((FI*p(:!(F*F(F*"FFcT4:FYFc ZFrH+}FF̱#x FnI*G F+Fx*C<*FfH+ao 8hz+i+OZF`H+Ro 8hz+%$2F!F8hF`l-f*fѥBx"1F&%F4,-ex"0F,FR8hz,ТGc2F!FF(B!FBH+hi+,ZF>H+ o\ [*+BiO ?!!?##?A!!/!!?4""a1F8h.$*,6 "0F"I*@1F H+wH+9hFJi? ?##?@ / ?4""aFQ҅lqEu„-EFFFFбh۱$ hB2F!F8FhG o FQF@F*=(4O4o%O3ҿ-MFFF FY#!(F*?F((F*"cTFFBF8F( RFYF0F FYF H+*0Fw BF)FSF8F[*F9FH+YY7F,hFb,C,, KJ7,Fkha3 I+0 KJt,FJJJJ^^^^t ^-AF FFhF<08FhBbBAh8*F0F0!DAGo% -MFF FFhF<0@FhBbBAh8*F;F0FF!DM`Go% -MFF FFhF<0@FhBbBAh8*F;F0FF!DM`Go% FhM( F[@j -AFbF(FS(-$O`!F0F :F !kh+*lAFF(FT>x"@K 'g4, *YY-MFFFFF3h<0{0FM((0FGhWDki:F#F0FCF"FQFGBF ki:FF4F FWFo%-AF FFFd#h<0k:;F2F)F FFA`Go%81FU+-ѐ1+)#FrI  34, " I6)j 8"IR)a( O0O0DžDžCi#s#@3 ?%?+F"!F(FO0F(F(cn+1+fff-MFFFj0?#?@ ?#? TH**O07F[F"@Fy`(yh FKH*!U(Ѫ*FEH1;c rF |(x@>(y(;лjB813(1Os`j+@FCC D#`ꉫ1FCCc` .I,)t+y,ISBSA*x[*Cd:k3FP*+yu0 A(y8(65eEy-(2bEXF(v%%`0Ic`Osd`,)0PPRCCSD)FFFY-ZYZEu~ZF"#F*]-MFCi?3#?@3F F:` PH*W7F W$?#F"(*FGH*C F(!BH1bx{DF!y)c-=($#y+c4\Eј0*+Ѹ 0PFAA;hDj:h3F- FEѩ)c"BBCC*D{`)|-о*`Fc"BB(C C{`HKTF j1F{hH*-6)H*+єY-ZYZ;VbbbFH*"#F F2\F@i F ci-MFCiFoFFгvM"+F! F(+x+'2FahoH*iO:"mIh)A@/3FbhiHi*XO 0[0E +F"YF F(+xk"\I]H)F/3FbhXIYH+/2FahVH  H0G"K+I0 FKKJ0KkYFDKz(/3FYFbhGHRFYFSF1 2D*+/2Fah>HU++/2Fah9H9I,)1F  F@"! 0 +{Bш+/?hbh,Hb1 2op(D+/?U1Fbh#HN0+"#O4s0 aiћ0 PF0Oc#Os܆ZZZZ܆-[[W[[[Eu\[#jF!]𵡰#!F0ahH*Z! H*U% N )F#0F5*H#)F F0]]]# Ip" F M0#\.#2$*;#$0Hp,Di!FF@.D?4$?@4 ?&?#F"!(Fv(?.JU#!Brty+S@@(2B 8FO0F`"!hFr"iF F)x8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@F5b{#{!FC#{(FCC{Cb"F @FpSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PART-MF HF(|,zFi@1F-f?6&?@6 ? +? "[F!(Fs(F_#FQF(Fk(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF F*iin"8F8 d"9FPF)jh#"QFkfhQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+nff>QF0F- @ IF(ii0F-I0HFA!J0KAAAaSF2F(FBPFQ P0UC#R CCS CcT B"VBBWBbZCQF5Y X0C#Z CC[ CcBu  IGNOREMEs#F"F F( "i# FV:CXBXAp-EDiFF!F[ F-C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@F!O0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`si`kJF ! *eI,)1"I F)900@ @[H@"dP)@F hEuH-MDi!FF[ -%D?4$?@4 O&?1F@F `6(EH*MEH*JDH*GDH*D3mhB7F F[5(Д!0 B""0BB#0Bbz`%0$(K+&0-KK'0Kk)0A!*0AA+0Aj,0C#.CC/Ch F[F)FzhH*100 5B"203BB40BbC#6HCC7Cc*!F H*H* ]']4]@]Q]m]]]#-EFF `FFh,=,3B, oo(FhFB ChCE(Fȿ$j,=pF F$(h(,o FphB(hqF((F8FtF}+z F 8#JR3@BHh3 +HpM„FF$N(FV4) @KS4`s%(F4 ,t.O>&(h,<,3B F(ChFB ѠiB F(jtp$F%F)F0FA P;z;4 8F$5, 'F({+ FoF$ O!F(F P3{+!F8F)0F4f„7 FF0)FH) F0T„7F FH) F)FFЃ H)o F0((F+{+oe„r„hkhGo%pGFpGo8F F )F F8@׾8Fheh F!F(F8@Ⱦ-AFF FFh,<,3Bo FAhBChB@(FjF h@(] ]F0!F@-EFFFF#hF<0#Ci:F3F0F FCF2F9FGBF ki:FF Fo%-AFF FF#h<0k+;F2F)F FFA`Go%-AF FF#hkhS2F)F FhAGo%osFF@3F*F!Fp@posFF@3F*F!Fp@po F!#`o7 F((FD%`0sF FPoh,<,3B0Fp F5hBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% h,<,3B FhFB BhE8Ft`\Fjڣ F?!!?##?A!!/!!?Ea4%%a`argD``-AFJFF!ChT)T(FرF F1F ;FiF0(F F o ʄ8FbF(F F8F *FPhT,i,>,3B(F FPhBj4F,! F< Fv(F-A!MfF4FB6h#pE qEwErEDEӤE ahq``!!`)hL`,`, J Sh3S`!iPi Jh3`cc-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0Fap FM F(2Fi #aeaJhL``h2`cc-MFFO OXѨiklCkdi(FxF(0ѫi+3i+3(FF(3!(Fjh"I"H)Fklվ+j[h[hT+(FI h[j+(FGF(kl(F#kdn(FGF(iC+j[h[hT+(F I"F Foe`npF&U4O<<<B0Fp FkD<<BPF#hB FF8ahH(2Fk4F<GhFj;q! FP#j[h[kC Fd! FGi{hRkj[hkC FR! F3cl F#Scd@ FF(oCl$ F" eF(F2F(FiF/h;l oB3B' ZL(FF({i+is;l _KF0(F"kl #kd )F( Ooto(FGF(jh IH(hj+(FG(jhIH(ooot4-EFFF'ozT4P(!F@ pVp IFF((F IF`%N FV&U(Fp5- VVlpF FF FF8F;F *F!F8FFo+3`o  F+ &FX# FQoFhhhkiGchD@  pGFFF Fjl+hk,BhBhR$ 2`hR$ zi{!F(FG(o<oo  7F F. ojhB BhDB *``h`07Fh FOhhS"0#hYhhJ H+F*F'o0o ;V̈́F. FHFh,<,3B(FclմB FCh`Dj,-E  *FFFJ#lFFl#BԿ## FRF;F0FHq Fhh߽-AFFF$O B q0F4 FF -MFFF$O O B "F@F SF@a(Fh!s-MFFFFF@FhF<0+XЫh/@FF@F%FhphFkh Fp@GhpFi Fx;hFki `)F FG( Ffh #` F^,D`o T@h-A FFFFG(FD F&ox!0F F&(F4 F&0F. F&0F(Fox8F(F F&!(F F&0F?' F&x0F F&r(F F&l!0Fj F&e7!(FbE'0hFk[i#I#(F (F(Fo F 0(FI%Fx# "Fm IF(F(F"(Fg 0@GRK`np" FF Il$h``O2IlC(`o Fp=ĄFlF+ F@׿ -MhFh O F %OJ * 鲛@䲿_պD_0#@]۲_I"FH&BoTB F%Rd(#@]۲_I"FH&om確>8hDhC[_"%@U_"U@!(ox8h"C[Ah@S\۲__STOQj(ڽ@IH&ؽҺ=pFDEhh s1FD*`(J&ٰpo%!˲2#` FB۲C[x_"@QU_" @PU_"XUp#1#opG-MF@F 4IF@FF(_!$4(F! F(F8F F4@.C`O .ҿ &6!(F!(F.2 %!(F  2 %VE %jF!(F! F(FF F +F XF%R(SF2FIH&'o@FI8F'KBX6`n-MhCBh[FF*'"FOA hnhBhx_#2xҲ_REъҲ_2p_"@OQ(Ff;"@]۲_C _U(FB Q&C8_U$ F%3z۲_#_#2 3r%(F (Fy;FBFIH&Uп_khd %(F(7/jhIH&xoq=>-M FFO2)xFhJ 4C#O35."U ,B"3 x۲_C_pU FCAɲ F3 F0XFU |U<Uh"CIch  .77F_ @__ OT \_O 3E  FO >5@! FW CE ѯ F_Opxɲ_xɲ_A_pExɲ_A F] h7WE۵FF8 F"Fm( F 8-AFF Flplq` FCCC ZC"62D&2#"(#*#,#.#0#2#OsBԿagcgBgmck^ "4 " F .#O 40d0" F 8F(w#O F|i0F(j Fqz FF(`chgI+C7#P0d0Fb F1F`F(H3#3# `1F# F'?FF(/;hcyhCE :+:JHOJKFUc`HjbhDCSbEK!dB)DJjj@AO#xx@KBH@H%(?M#`e>I>I>I>I@sCs2 :K/KO Gܠ'?#l0#@# # F t nF(ihjCb"W<7O WPV<, C B>V+OO #&F#k 3#k`/8oEjCsbj-@3 +4HH$0(#Jl"BCgxOC@3HC3O @F#zomshݹԚ9#i`'O3#c!d #%)H$LP8cjsh#i`3+0+ " "I#k B2jhhhoYC?1!?DtiaiB "#i` B"2aB"raa- "jCcbj[p8 9A9ppG-EFF(F=F(FF(FDh3dll 0p`xkhUF)h hkH$-o@FhJiI. ,0Cs,0#:F,00CC0k+0C0XK40@0XBhB`BhB"`BhB@`HchLJDCc`"`rlchCc`HK`rhGKB"a#aOsca#`03l((+0l#Cl##CCCsC0!F(FF( Q$b4hjCsb#Fjs<0dfk+>'K0##f0QFCS00FJVck#0cc #bj#p#C`#bQPF#d(aH$tomM+hjhhH$k>oJI(F#zom/ Kv8RR;8 x 88 x _"h`_O2hZ`Bh* K I* F C_h0pGKK$$dF a 8F%h+DXh5VѠhP i8@K8 ACs CCCjC3_ #d#Fch_տ_O c` (F#(H#O08,8j_OAs CCCb`C3_ #d#Fch_ տ_Oc` l_ (F#(H#O08{, F@ 8FF(FxF_ #h_#h_#h _#h$QyyC#yCCyCc_!h0SzzcC3_"h088FF F<F(j#ybyCyCyC"zCbzC 8 8hF0_C_Ouh0#h[h_ #=#h[j_#_"hSb#`ca8sFF(FpF(F0` `l]`H#"(FI0p("IlzcH##c" Ilz d H###d po,,,-,-+Fj F`j`j FF@SjBF)F3H#O0?&?)D8F!?S_2#2P_2_`2[_SC C_!S%i@9F(F+k__Or#hZaA3;oci[ ca"hRi_A6>9F(F32[_ .Fڽ@ H#% J K D H# JD[ R;:[C#_cd],?KLk_k;U-EFwFh0Fp%@"!@FOR#i@F]#i@ZeaFhOb+D!@F}@FaOBh+DZh#5O Bh!h a F{chcjj_tJ#h _"#hD!_%#h Q_#h$Q0d(2|0e(,v0k(&p (i +b0(\0( s@wBqѿ_Ob#hP!_Ob#h!"i_#h!h_#h0F!F_"hOE #F`h_E_R3ѣh_O A_!hq#h[j_Cs_"hSb#hD1_Cs_"hD1#h[j_C_"hSbjj`hHYh# _C[Yi#hZj_#h" 0_z#sB _!hJb_"h0_Or#hHa"Hd)Cs ,-MFF6OaWF@ 0`@ZI[H#o (F#h__#hO PFmPFYFNH#% #h0_C_"h0_#h0_PFH#h0_#_"hPF0a(?@U0_#c o"%h* !h;hB4@ _Or#hah3ZB??XSB`570_+_57P_!?=?1)D8F!? *F9F0hh?+OGO G_w_"33 --pFFF(H#$ FpKIbKbcK2F?F0# F0 H# F"(F4,M*,.,G,-MFF0F,@!FF} a(o (FOq@ p`Or!='Oa@ cF:FlIlH#h+DXh=Ѡh iOb!OBO h@F+Dha+DZh#77/@/O Bh!#k {#h[j_C_"h Sb"oA7F#h[j_0 Fl h!bCF(y`b )adY/)3#;Hc`#*/Ozw0!(FkxC"YF(F l(xC"(F"2B,H# % FW "x+##c`#F IlnFIl(%b2F)Fcl`jjba~%*#8*FIbFo8F8Foo O_--~-l-Ą pGK4ZhCccY` `pGdH  d-AFP FFFF`M2F"H#$ FIP"!O3"a#a#H%`abbhcccgdHFBhKS0S,y@ 4;c`ibbh"c[i; FG I H#J. KB6E&@^^d d_^ZZ-AFj#FFFG(o(`#BF9F0FjG(+hC+` -M FLNFĖ.F! ^O3,Fo`KX& ,B F6.!-uЫ*F+t#*Բ 333X3;%糲2F۹#2в333X3Z 3W#(@&#硲#Fi!#ز111X198FfF `C[E S#F8F_PF!#@$( # 8CkF F#GC ")F F8@PChiGFpGʻ0FhF0j% FFk0`GO00pG-AF"O1i Ckk+> ;hFYh"H#2!O  H#+#a Q.H#"omaa0Hoa !0F&j8F# "O1(FFLP0"tFF"O1(Fa9bɅ*: ::pF"O1ckF+Xj "00baa"O1 Ft"FO1 Fm "ba"@oaOzroba#a p@"O1 F" #Bca#aOzscad#F F@}7Fh@k5F FkG0O0"O1F #cCS F@"O1ڿpCkF+#cdCizd+ OSOsi Fp@*Cs"O1Osjj"@O1b(o ~cHC HC@qHC2HCsHCcqHCcHC@uHC B;"O1 F(B%"O1 F(9! "O1 Fu(/j @s0HCsHCsB% "O1 FS(5 Fp@[%*FO1 FK(P_(Fp8"O1F;(: OxdO|dAHDHDHDHD"O1(F(ۃHD HDHDCHDj(F#@bj#@b 8plF pOC"FO1("FO1(F@F#> HO0"O1(FOzp"^sF FFhSBjh!h[hkH1"`fbp^-A !O1@FFFF0BF9F(F"FH"_^pFF F "O1|"O1(FuDC(Fp@ "O1j-A?F FFFh )j;FAG7iA&CN.*FF FAR"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1opFF" FO1F("O1 F( E Fp@"O1pFOS"O1Os"! Fch ib-AiF.hl. 0F(!"0FwI`+hC+`0FsI?"pI"FoI@FB(FRoiKBhKB+hC+`0FeI(/cJBbJBaJBih[ h^H"]JB \J\I C뀫CbhQhVJB#chZhRKBjF0FQIP*8Cs뀫Ccj!# + "OrOs# F(cj F ;+"#OCFOBF(ۥhch͹ch FibA F' v h# h/H)J*Io gZh)KB+H! F(XH !C F(H)h F+""##LCB!(2轄 %`@w=@x}S@YsRRrMtMyH`H]HZ dd`d-EFl`( AFOl,9F F+AF FFC F2F#F(F I( F( FFoĪ_ _hkBlBBBdKk#opGFpGFl F(# F2I(F"Fx*> !,J"Rl8F(1%&OB V%jFS Zh#FFfF`<8F#hbhh"\5JIHjRhRhT*h!Fk[kG!T 8hkkSo%!T (!FGR*_5_RRhkhGo%pG8FhFk[h;G)FF F" 8o%hklF`Go%pG-MFFqEhl [F*2"ٲ 222X2;h OO9FlJ?sh h}H"o8F"O wJwIAFPF&Ish$ hpHmJmIOBQF FF(ƀ9FlbJ3FfFpT#hbhhaH"1F FZJ[Ih AF&^;FB1F FhV# Q O ѠO12DRh\ ЈF F3(ЈF3?J$#hbhh@H;J3 0BF#F(F H 3iRF[FH F <}"'pFF1F F0kF(F F$pO1Os FJ#I(pb0Fpв@@COѲ0C@0AAPc!x0z C@F8 FYB#F F3J Fa DBF "p8:- \0[\- *pGo%pGo%pGhkhGo%pGh__Or`H o,/8F F#h_8(F fpFJ)F F`.3H op0e(<,. 0k(0g( !(h+h_Or `_+FFFCwe%0e(L/W O F(O(K9DI !.%J~ :>AO> O\O\BB O% w s ;A|C"a#h# CCC&`60k(00g(ѥ?6ɚ;KC8F%0`(0(0d( 0e('0k(!0g(,`80e(0k(0g(, =%D$,$=%D$8F F0e(- 4 0k(0g( F8-ANFFF# FFȹ8FAFF8FdtS$0_1F+`A𵅰FFF0(  (IH O0r0(l0(O##2F)F(F2F)F_!(F)cn+l_9F#`@Og9OF FF# FF_#*F!F_ ! F&bB 9F F@$,-ANFFF# FF58FAFF8F&F_1Fdt@$PAqhkhGo%pGhk[hGo%pG8i FFtCjh\C:i*AB 8#[o%-A FFFFVFQh+ @BjTCiD3n%nB!Kh+=-%FLR%kBҲBj1)DO`o o%Յ8FFi##f#cfeC  e8iFFFDji|C  FyAhahSh"h+OR[B@`#`70FjhF0`#h(F BihH 6o0#`  F0@hF x @"h  !Fh+ "QC KXZXChIhA!AFpG)oA,8 Fr-%%!!2P1F)Fb Fb8hFkC FV0 FB h+ИG(iiD?1!?8F F;h+ уiiDB(F8@!Ͽ#Ki!Fi?F j F@ڿpFF(FhFaCj3h@H3Cbbcj!SC(Fa(F!khJ 8J!0F 2Fh!i(F)1F~Zpo x ]Cl!b@mBؿ1mBؿ2CnKCCenZCo#epG8FFi f8 " F `8FnFnfl{ ! J ##`Ked#cK Fcc8@I}=FoFkhk$hF`Go%pGhkdhF`Go%pGhkhGo%pGF8Fi4anbm#o DF#ebe#mB{"!(Fmj(F9cmbnce!agi@8 FF $egEe8F FoF+ 0FoF/8-[-7-An@m#N#o m!nH0#D#g "g {gK'D[]P#K-g@-٥A +R#CCCCCCGC_DGCDDf-Zm-ѰiFo7'D4B FD)))ѕ1A(F1b #an`m##oF m!nH0#A- rF-"&q FC-DD-B-DiF0 ; ;+Wi!i#ce#o#eJiF+>an`m#rjF0F3%) )j109#Cɲw(9)?^20#Cɲ2 itP2(FT1b(FNbC --_+\R#GCEEoEEED-Ig#0F3hkh+?0FGnm)F#Un%eBԮ0Fh0F3hFkic+m*n)o#B+e !i10FG&0#cgm;SCjn+ekmH#ke,0Fu+FBmmF0F 0F,+F0Fbm!m(#mnD#eegBDl FMi@!8FL F(F<(8Dl Fi@!ּFFF.Fi*{n9nC;-;B *FBF F@0)$xp0)%Ѣxax%0xBa CB)ѢxpbxBp%0p*%cxxCSC`pcxCpxp#p0||D$}DDE}Dd `}}A!~AAD~Aa`AB"`0-MFhP FИ0B+ј0M+AFH o@F!0hL,h@) С/؛H@ԚH*#HO0B *!( )*)<'7GuE@p@ pu (GuE@p@ pDE$t(DB(F P$ E% EE $Ee*DEDO3iD*`*@   <   0C# CC! Cc+@Ѐ O h 0 C# CC Cc;.x.xox//&5/9;F[jD-c(D0\-l(D0e"DB# `xDx8Zj5SDcC3iDB E ٛE,>F  FF+F &vD0=D5 C D8SFGՅiՅB!E+FxF*њx"oxx3B E,7F  FFk  'wDD5[D  D8O +[FE! M DEsj=DD  D F F3Bsj=D23hkhGo%pG 8 FF!0)F`h8@0F!0`h@sF)FF JL 'Fh#F(FIF Fplj KC` ~8F2h ciSC B800?3#?0hQPM HtoPP81P! _ S-MF 8F6FF(0KO!pKKhF(o 0FO!r1F-s2s1KJxe+"KF"f`2"rKhP"!"F "!{K p"|KC"@h`h`ha`aal,p0t4x 8|$(<,0PB,ba`aP%%bOLPECP % b%!cc!dd!edae cE,#azbc`c`d D D[D DRD DSCkCFI1@EH#~FfDHO3O #fcfh F[$caPE3Rh`h ci SC B"!Q 00Y0)J+FV F(!K 7GKhh h 0#0 RhhKD!q@" F !8FB@s_ Qʚ;PGRGB6#H0lKm2#j;+iJR# 0#T0"! x՝D0CD0YKPHD DBD QBDADBEAEBEAEPXDFH\ADBDA@D*EAEBD B D n#z "Ozq|  ACx t  p [FRFhH$HX+i#I+ F"2Y}bc"aamh2#j;+JR# h0$ 3sF!&F Hkh+⮨hFY444Ȉʚ;wGRGB6Gp$ MU;;bhh4,#JR#B#3+p`K`K pK`pG#i@}h@ C `pG"i@} h@# `pGChOr+ OsOs C0pGChOr+ osos @0pGhFi%$E F#LV3B2+s"##2#~a!C# #E F"lphFPF  )3B#2?0hFi F+5"U3B22  )3B#2bhK* FOrQ``h (Os`c" #a0hFFdFhich+ KOsYh##a)2"#ahFd8DhJ,OrMh-hB#` 8 MU$@_L$hBCod 0 Qu jGpG8}:RukGpGpGipGhpGFCjG ijG pGCk`GFpGOr2K2L`Or1K2N`2K#`83c`1K3`0f(0a(H+KBw2h*Ma*K*J`+hC+`+h .?$H1h h1h`h0h"KOt`Z`oC00+%d!%e(Fe%f%ORKZaO00hs(F Kdl m=  l G`R-AHKFx F*"pFKh='10@BAHKOso@rhcDBFOOSW(   B ?.q W!@ B]1JB$0JB0JB! F!+H"W( O q?.G(<" " !H"Kp S p'qC p<" C"?+ "! FA"! FJFB bF(F^:K(7"8JBr@2BbNF(FJ2K"``0K h*N+O22h;h+;h2h)ID"0 "*,+M kh$J_"F[FQF"F[FQF "F[FQF zkhCDDCC#l`0*+oo Lm_ HmDma萄KBKBs@3BpG K"` K Jhh ID"ȽKo _ LmHm萄-A -FFFf#*E")FF#"! F@+F"! F:# FFF4#!F F.#!F F(#!F F"#!F F#!F FF&F2K ,UAAATTIIT6Pa")F#"! F+F"")F#"! F+F"Fv+ #d"!#d"! F&&M`"j`"K #cCu5.`"cSC M^QD M`%"F I H3"FI.`H-ee\eeRE )F5#F#!F F#!F F# FFF#!F Fz#!F Ft#!F Fn#!F Fh#!F F@`+D#FFW#!F FQ#!F FK#!F FE#!F F?#!F F9#!F F3#!F F-#!F F'# !F F!# !F F# !F$KB$KB#KB>#JhC`Or0C0pGKYyKi KJYxm #(CJ aKJmC` KS!>ei JCpGs_ o ae\ee8EKB9DKBADKB'CJh@q@#@s#`Or0C0:K[y#+$8M$7M1O`<8O`}<1穱+Ji2d#`)8%Jm\2B@<#@"#@Oq828BOpK*imII## `I0\|#s0\KS"8@@"#ss_ o aee\e!p:L;M1F+@1"##"! #"! 1"1!# !#F "#"! 1"+@ 1!# #"! !#F"z 1" 1!# o# "! i#"! c1"+@1!# X# "! Rp@#"! Je-Ml0 p0F x0F|0 0* *+^H# \N D Dt  D D "۲ "RKh -60hphpLKS%AFFV%F8F1F!dFH18FqCB8FBp+:KqS%Bp!6Kh2KS%/OAFW%FFW%A0 W%1F!(-&NOvBCcemFC@seC1KBC}CB KBws93;B'2V%Y(KV%hKBS3#BoF dRGB6Y444LVD6'3h 3 3 ׀$O7OOZO #F!(F:DGN#F!(FG@OKSF!(F:D.O+ O :D CF!(F  #"F# !(FGCFCF!(F G O CF!(F # !(F#F"F# YF(FSF  3m#`CCCCC3e p1CSC#;[C2`se"d1 #HCRHCd1 [K C% '''O:O #F!(FJ z ![!(F#F f ! (FJ [F S p1## D(F!"F=# !D(F"F#F*4btdtbdbdb4eP1@P1@ETAXA@K_DO`rhA1@0D4aZaaabZb""H#DB\BC ^C3#6bbcZccceKBKB,tcB KB#KBKBopGHh#`KYh!AAbZ`hB`Or0 C0pG HhCh"_ o w ?c+w,aF4J-MB F 2JB t PbB-JBQ",O:`,Jhҹ,Jh*+J-@QhA CS`hC`Or 0C0*$Jh*H*_[FRFAF ^[FFRFAF WF[FRFAF P"#CCC:`* Jh*h#o_ o w DmLmHma_"K__ p IF`$N(FV Fp4, ͅLp" IgF`$N(FV{ Fp4, ͅ8FFl(O2 IB#rC#O2Il{C#`sC# 8HʅYʅFUO,<,Bclj'FW4P<BClk0F<Fz_zVE%BMѧ՝zzE%BDf{_{ֈE%B;%{_{E%B2ՖzyB,Ѧz]yB&e{yB y+o'P{KyBՐ{yB ѥ{yB`|xXBXA  0 hkjGo%pGFJ[ xppG0F0 hkh]$`6F F!FGpo%-M0yF:hF8jKt pF(0F%Fh7L܀,>,B"єh,<,B5;h+?Kv FHB'H$Kx< Fqh F0FFH>5j,>H#50cl F Cy Fnjh,<,3Bcl FCy FYj0U΅৆΅^΅s΅pFF(FZiFi(F,Y20 i F#`p@Ob F0 a,Yps FFF_(3F*F Fpok6(#` `pGhn_#C_fpGCh[h_Bh1 pGO3 `pGLP0n-AFFFF4h_ bc<@DE=O0 -!$ Fhh_# _h `hOAK0H砆 F,,##-1ѽ@Ϳ -AhF FNh hJ[SCHi@F@0ц'n6@@ Cf+h!hXh?X``(m!?D^(m竪FF#00Ch F;+  o0 ~SChC`p F?!DFF!? F#R"b"B`+bF 5!F431D+1FHO0EO_ha ph_#_"@;OAK(Hom 砆h_C_OB@;FK(HomOzpH 砆pChF^h_hh_(%0_hO@A`h"K0 p@HOB%1_ORhF`hOS0(phZh_B_h0 DZ`砆a@-EFFhc(1$1 ;$1zpO4 h'BAF3i@FhA;$1+ݨhWF FcE H;O4pih0F FFD FF, -MF, FF9FF@FYBڑIH $ F +ѵO F(`#WSC@ F`(q``;D aF@ `a(_!hz!`iu n1@!pc C+s"PB?FiC?1!?FDth?1!?Dl`iDg$1+5F #i`hCE? iS(FqNh(`ih Fh`!QC8B O   `@ ciL!0@F9F  ( M<@ A1AAC*KF0S9)FYF@F ! PP Y` BqCA`I @a P@Xa @P@a @@aP2DC h([s$13$1@FFF-A FFF"!F(FFP ,A3Ozs1F(FF$B HomE1F, 14 (F FO4o-M°F , #?  JF+$+!!  b0 DF@ ;FHmHjO0J `"!PF! FXF ## n O83@C0 0O(+' xPKC"CphCCc,!CC CCB *YWzBzAC30OC'0QFXFJw+F@7@ JJ[ [s ! B"r"BF%KA @FCCAqAHa(=H "K" FJ'`g``s0H F@>F+@"bP Z` I J6( F``/*`BF D+@?zJ+J+d9FF" FPF  F#DFh[h_?_hS`hh_S [A8+Ozxf>9FPF  Fh8@E `9F+dhh_C@_h` "hBsF0(#FHh[h_>_ "hZ`7C _h`OBhF:K0(8H##h[h_տ_ "hZ`(c+ ?D!?'H(F(3(@+4 +3 + [@"# #P+(Р+# !@ n"@ C f9F F OO0 B##}FF,F$O0pG-MF, tF+>h#B@?#0, cxFK+B3"B<л9лoHB@#EہBػoo#9#9O0boix)+ѹNOzp5xiB:F*Fyy5FC#BFF 3(F<1 1GF(лoZHB6@#EB3B@#3Eh_!*xxB"*6*$*@B!~q!  B@.CS_o3`oл#Ozp0/:F"yyC#BFFxxC# **5*fsMOzp oB>FyyB$B4F,8"F)FF2gNOzp'0D00B=Fyy,FC#BF۲+?/YJOzpR#PWJVyyB$B( F`m7F%#!F QBТB"x0*bxX* -x:(\=8 @B0O0-A%K`xF00hOPP+HXP8`8h@1FH@1F((n`m4IX-MF FFhzٹF\L ;++Me@UK)F*v 9FO3!F x-c-j-1FCH^O3!F xRB#x0+cxX+8K1F\7H"FrO0#x1+Y+ E+0+cxF;۲-J"f;۲+!FO # pBлx.*Y ;* F(кh1FH.  1FH@?v0F% KQF(FF H"F!FPF(?b;V !X A   F `pG M KFh$ F0F!h(74B'Lh8 FM I He)F"Hl")F Fg 8e靂mW#J F,"`  F( F(Bhm-A%dhF")F&0O+HP8`#8h`@jF1FHq@@jF1Fi(hFc(hFi(Ch`m8W-AF$HFFF9!F J  jFH(%OAF( "!F 2P1F0# )` O@!HX(F0M`MFȹ F Kz FpF"FFC HHHH<EDDD-M]FxFFH&H$ F ] G'?8F^FF0FSF@*FIH0F~xF P 0QF ,=UDFQF $;FF2F@FB H$kKFxC nI;V!Ʌ<-M]SF^F(MF8F(C8F0tF P 0QF =UDFQF  G$?F#F:F@FBOb! FF4$@ KFxC !0F+(F ]Noo<!O0pGO0pG pGO0pGpGo pGFHhBFQDOB FFmO0pGO0pGO0pGO0pGO0pGO0pGKhpG@#-EFJKg %LPP#h B#zAFhGxK"h` K`5-DO05-DDm@-AFJ(FxO<=`MAFh8hG`F K*h` K` FI,4,DO4Dm@L h]CjG##`@KFhPi FGF F@KFh@Ci FGF F@8KFh F/)Fi FGF F8@-EF KFh FF ggRFCF)Fi FGF F@-MFKFh F!F SF(FG #BBE)FHO4z F@77KFh$j(FGFc- FKmB`0Kh`KhC`@xF Khk FGF9, KdB`@xFpKhCk FG@@-EF`Kh@B!FQ;+HX6(FF((F2F9FHI F +PFB7@F#:&7Fx7777KFh.k FGF F@KFhk FGF F@p KFhF 1Fl(FG2F)FHO4 Fp@\7*7FhXhF$ F0iFh(HO4\-MF+FO4 F@*!hhhHF rH$h  hFBx+Ѹи'FF!cH`!FF`HF^H&OV!FhiF!FiF"F'F:F PKhn iXFGF(> 1EA(ڳ a/Br;F l  l1FF QB 8H3SYF6H,z RF1FiXF#G:F+۸hh6иh5*i 3F3 #!HϱH 9F   Ozs JHH1FH HI FJ Wv@3Hb`Y\;V8F+F* !h`h`- hHQ8 8O0 FF F@K -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF z*F1FF@F#tTFPFk.F#H?ͱH)FOzs J H H%FO4b`YpF+F"hhh7F Kh.Ahh FpHO4$@I*F hXhHh8 O0 *FhXh8h hH O0*F hXhP!ih8 O0 H;&$ MO> H1 H. +hC,,!:!8Fjh4D5m  `YHpGJhrBЈBpG47%L#!hq( HO !hq 0)F+F*F!hq 4%iF@ ] F`h jO0 KFh(h0"7 O04 "!FhM F@-M&# h!FK[lihi  D @BBOAcC.+sO0BBr;B22*= @ @+5O HFOs ""O3, E3SFBF(#`Z`g 1F1F YF   ZZE;U5F*1"  BB '*8FZ*BFDA*D;D  3 C #F5F1FSFBF(?<FE#D 3 SFBF (?%"!BFvO40F Hhh HhP EE0O040-E FFFF.(QF HO0X2F F+F#phFFF+ChBуhB F{)F@ EF `@*F!0F Fk pf`` 炊jpGFhXpG`X1pGF@*@pGF@)OhjFpGF@)O@hSjFpGF@)OhjFpG8F FDCB08-MFFFFF@li ?#?@3  ( & CC'K@h Fб+F;`cCvE>hAH#HH7F < ?&?"!F3FEZFQF3F"!Fhl"SF!FK"!F3F/ZFQF0F<bbbFL($hi 4@ ,  @\IJB#CT C#:D xB C p@BXCBDZ#@۲O04FL($hi 4@ , @\B#TC#:D xBC p@BXCBDZ#@۲4KhjF(O ;D# x CO0 ppGD#@BXBB:@۲4KhjF(O;D# xBC ppGD#@BXBB:@۲4sFAjFKnЃj"h1OpU" ")FF * : FFp-MKh RhF)F@ *F!FYh@ )F*F!O.À+𿀣+Ā#k3#cQF kFoEiB𨀣j!Fw8F1(@𨀻o 5%c3E?O3#c  iBj!FU(F((FFjhS'EhjR'  * #jS'RF#hOxF(бo3 ! B RF*ѧ"FDChzC"c3@*ѪC!;@* `jhX!;A5*D`X! i3Fh(AF0F%(k0F63O0iFg{8FFjZFS%h # jYX*F k F%k/0B i3Fh(AF0F(P@*C;@* #`jhX:C5)D`X0F k4n-MKhjhF)F@ ,*F!Fh@ )F"*F!F/.cj[n@0+uk0cjFU!F(FFУh2F + k1FhS( kBFS(kF(0CE i;F h%(ʀ8Fih5(@À@*C;ꁡ@) bji;a8F-0F*k( 3BEO3c3iE𐀣j@+ U J!F(Fo Уh( 2Fzk1FhS+kS+;KAF# FЁhEFx[FO @  @03c@0@*C;끢@* k@*jC;@* kbji!;a i;FhCh`08Fr(?U8F0FO0RO      FO 4n-M F$  BFܹ FP KF&7F'AѴHME0FHFZFQCSDD@#F(Шi p 0 9F.F(AF FQjF0FFQFQFD0F FOCi 0"9F 8 K FFho@ @B4-ML#hFiF 3FBli2j^Յ< #h$O i(6 3@3FO 23 B.O2vF2B XE*! 1Ih"F@F@`FvpBhEF!D@F H@FoE ڶh@F0D2  V+$@F,OlM ZE\ۺ)!F@ F"FQFcaHO0O2^K`^K`tm @B+h."F!(WHP BPFO1O OJ@ `!FW"FQF&+` HH@m@0+h K S+x 1YE ΀%!F@ ,F"FQF2HO2,K`,K`m0@B."F!+hc (H0BPFO1#J@ `!F+`0#F"FF@m@0NG!F@ F"FQF HC49c,Oc(ncccd$JdO2K`K`AF:F[ @ FB3h/"F! H 0BPFO1#J@ `!F3`0#F"FFN@+hS(0@03hS*H3%!F@ UF"FQF$хHO2K`K` 0n0@B."F!+h }H0BPFO1#uJ@ `!F+`0#F"FF@3n@0iN-!F@ F"FQF`HlO2VK`VK` +hHFS 0@B0"F!3h1 RHN 0BPFSO1#CJ@ `!F3`0#F"FF@+hS*0@0>M>!F@ F"FQFtO24K`4K`AF"[ +h@BAF[!F"F!@(3hS(0@0+hS"p0BPFO1#J@ `!F+`0U#F"FF#?Q@ ndd(nd$eJen-MFhF!F@ "F!C{HIO;XF h@ !F F"F!@F. 0 mKhmKRhhi 3";gK"hH0i;F!`Ch2(>8FDF(7ѺFгh@[EZ 4tBت@0 {?FpJH+IHCMGH+hj DHO;8F~ +>HCF;Hh+h 2C"@Yhh8F DZ`hiQ"a*(?r[D4D@F@F@F | 0DBF@DmJ@Fhqq@FbAFFO8FhDm$4&H&e&&&T$-MF.Khh i1F 3"F@ F2F!'B FpO60F"9F@F(.i#F!pCh.(&H7 ٢YFB 8`. F4h^DB4g-Mx/+FУHO78F&E)F@ F*F!\+ F!FFPFPFI&FO FF1F@ j2F)F9[$&FO79F 6F F!FFs@ !FIF"F)F.vIFtHkAF@ 4FBF)F4` $kHY FhI FEF/=р!@ pF"9F,Ѐ!@ F"9F-YK"h Fx""!F(FO#O3[ FFA+0#='D8FBF@ F!HK,j8F9FF F 8I`F7HZ ʱ!" F!FFz(JEF FV((FqhOB\0[HV(?!V(@FAFFPFOV(X0F F(F%FEo %4/%=%-MO BK h iRh 3"E"QF O8@FhF)F@ !F*F!,S#F!hC f( F  '>F#H6+٢YJ(yFB"H FO(ѯD F( FU DB/F/`o 4g$L hH8#J#``O2K`L hH+#J#``O2 K` L hH# J#``O2 K`,(n$ nn8 M L(h8!h)q9#+` h##`8@04-MF0F FF#`hhB!$#O 40F[Fh|XEۻs)FzHlhs( +irЭ `h;h0F[FN(3ی!@ F"YFL3hh#`i+k+@O O+G~O F0h"" F` k#0pCOyDHhhBH FFhD`e O/9HOO6HM4H-UиK`"a=ehFoDj"FS$0F3!F(F<@*C3@* jjh3`;hB)F<F(i!pChp1FH<`3 F4P0P@PjFXFYFFj0F<F  0F0 0pCAF+F (F(!F  (FH(FCli;hi 3 CE(CFhXD@ FO3 B'3  @C' A ]3prH{J(OH#I " F   5J Z(EјF D DhD3CF  @C' A  JCDGF3  @C' A O89K hjFXFYF F8@FjHF  D@F> B >! (F!+FpC 1F(F ( 1F(FL(& F4`0`@`<`(F`(RFJh;`4c'dpCV HO0p#*F8H~"##V$8$p FFj)FF# Fp@$F OWkqhK ЫhO|2h 4*d,@M$.FV;Zh2N$7FW;Zh2$V 4U }d,# J` J`" K`h4nd,h4gd,@hd`-MF&FlO "j3B ;hhX#0F@ F!6;hX#0hh)FhhD;hZ:`X#0Z`o h-MF FNFFIHoJ#FRIhHСB$3d)Mh+hF@ X#hF!7+hX#0hXh1F|+hZX#0*`\` o 6%h-MFFFEIHloL`#hX#0sh@ F##FF#hX#0hXh)F6#h ZX#0"`_`o %d@-EFF'HE&!@ F"! H&&`f`@ QFFRF1F%`9F (F Jh+ K Ih ```T``&&nlp8 M,hD(hX" K(``K`8 h*dhDh% Fplnp KhO0phhBh"B[hX6B2 p-M6hF1F@ n2F!F=@ AFcBF!F2E(F0F".$K!h"!'i+F!xChO hB ؚF3Kh;h "'i3F!hxCkh2FЪ4p( HH2``-MFCjF^nf@𧀇h@ 9FF:F1Ft@ QFFRF1F? FWo "kK!h 2F1F1F.i#FpChkjnY4ո8`Hi+4Osai3ahjjj!nO`CfjjOchj"Fih"F63FHikO cjfi\Cscb3O "BF!h8F6(i;FFC!h0Fyhih,ѓB @FK F8F rF #aEy2X FSO ѓB63a3aXFo ѓBѸ8F3BЧO0%4$$-M#\Jp`\JF`[Jd%`"GFZLh#`ZK`!@ F"!HO0!@ F"!"X<`O3XK` `Z+S`_LQF@ FRF)Fmвh#hF@ W#F)F\#hW#0h+CF)Fh(FObqj#hhW#0AFh#h@FZW#0"`]` e( `8 @B#hQF@ W#NFRF)F#hW#0h(?uObqj_#hZ"`"W#0Z`pldh@`-MʰCjFmXiO! S9h"K ;`hF!F@ F"F!=!*7"*F4ih+F!`C?OsgK@ i AFFBF!D(FWd$^MU+9hRhK2_9h"K ;`FhF9F@ F:F!,\PHJO " FHK S+Rh2OsXF"d  :K8S(0"[hOch"F(F F" ;`?0U,ahi<ыK!h*"*F%7ih#F!xCOsK@ i AF7FBF! Fy "8FLh:F/ F8F4`;9/&JDx B\D 3۲;,0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)D{B F|pF JFh FX Jh1 LJ$h&DB HO0p*Fp-(|xb{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-MF FCh + +LOsBW!F6H 4KB# FYCF FiB'hB(F (BRF9F X(akh+2 +, +*hDYS[xP\ H o +ч FGCF燊 FGGCGF+hS$+h3O0:-MFFFŠi;?2F?1!?F1F ?(?B F 7F BF!XF{`(FO00FAFDB Fx2FFFXF@EѪDBCDF!?2"?F2F ?%?*FXF(F"F)F0FF*KFhFFO4 FYi@ ?1!?jF(F! (O4(F@")F Fy㊻ #@!F"3`8Fn3h4 +O!F HT$dB#$4 HI #$3`"!FH?(#yeee-E F FF(:`h (`b 604 `30C#b+Уj7J Shb00.h+Pb ,0hE%-0B)F)HC(H o8F?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @d b@D #a|}'''-M?FFFF0F?#?F3F ? +?  BF 7F)FXFsZF!0F{`({hFO0 FDBF*FFF0FxPEѸ0DCCDF !?#?F3F ?(?@F"F)F@F>BF!0FQ(F8FhhŊrdiiCDh , kCi!Dy H-o8jdB(,FicC)D 68iF "!(F#+pi# F8@ɿ 8`aK>@ p`E PaS`F`FB#a#b F "IF(F8(O0+\.+oOT)F0Fn0FOq F,!F(fV-EFF%@NO., ,!FPFx# Ԥa+@5B(F_$H-EFFFO O#FEFxZ-B F8 DEх/*\*FFxF/)F\)F)SFB L#<`DF;#x%F +.+kx[.+ѫx;(FI"8(DB5`K;`x +.+)-MChF+FF[ + +gф@FDCF#@FYCjF FiBOh B(F8 2(?ۨZFAFPD(7a#skh+3 +, +-(hD/00OA@/S/"pC 0+h 3C# @FDhDCDF+hC$`+h#`  0(h00C3 0(hZ!R)hZCR۲ 0(hֲ00"C# 0(hZ!R)h 0(h 00C 0-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F%4F;FpFFL!F(F4(F"F1F Fp-MMvAh )!  ÊF D !  AC+ͱ-ch +mKB 3B)F Fch +OS +OsBOso@sSC-$F2F%WO` 2B ahr )&Op@|)`FE0QF F$chF +!+@sB(@VOcSE@QUFF8FOsB(@@Os@E(@86K )M)@ OpE[b2F3FCBAHQF F BF=bh *)*@rB4(ObB@FF )Op@w)8F HOrB(݀OrJB (ԀBF !B A  ` b B s<  c C_ФO:h*ZCi#X@Ev*.@@Fx @π SC :FYC SCB[DfDXN2h㊘BFBF9F0h2h㊘B9D1B1  CBvbh *Os@q* FBOFFRO1@ ; 8`(kXHgO0c BAMN2h =㊘B0h:F@D42hG㊘B cXDD@L6K9Fh3Kh#⊐BfDD3 BI#'KQF FYbhF *Os@q* FB)F Foch + + +opE*FQF FK@uOucvh7&1F FX6BtPgch +3 ^.:㊧iw3DZKhB+XH&QF Fbh *Os@q* FB?QF F%FFQF F=5FIK'iFFOzWFBw i F(2[A2ch +Y+Z +opE*FAFYAF FBBEF/i Fr(!G!aD-ch +)+OsOcBWF.F(bh **OrObBJFJ@uOuKxogCi?3#?@3 N ?x"0`$?H"F! (#O53`(FF"Ip^F(" I6U("IRM(|L(DžDžiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Ff(#hsC;`hci`"hSh + 1`ӊjKCB##aiD h(`#h[h ++OsOcBKiFa [ ;0ix+;ai 3a-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0F#{!0Fl#;q7F;x6":p,1+Aх,!<1+A }iF& F  6. Ui6 .! 1) & &  ?RAFkF2FF@FY(F"F(?@ZFa+#,1<-MF FFz+x.FF5/+\+0F@8o EF;/+\+ci *$I0F ȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FqP<1SEBFQF0Fg(iz!F FbɅ0ЄpF Fv F@(F<l ix p<1B1F(F^(-EF'F!}Q 2CWPB߲OlFEF "! FE#`F3iBFApp!2+Qp3+" F3q"Dss!ZC*< #F 2 * 2 x"wӹ"!"DwQw3"C3B#5%prE@gs#p(F- 5w#*%prgs 4pp2qZq!F "ii= U$FQggvЄON-MAhF!F0Fzi+o0Fx *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(FUFZFPF F(BF(Fjh *JAF(F(F (##aO[;a*Or *@r F(FL#h3H$ FhWFH#hHYh h F H  " & H@+@).<.ӅL.d.pIF@ ?FiFF@"1F FF F@ p@-AFF@ IFhiFF0"AF(FiF(FFh"AF(FF3F$6{(Fx F iiFo @-MIFT@ FF(G(n"AF(ci )iOOOHBz. ,C-tuJBtF FBz3hkj3CRFBx+F?O@!?FiFXO3!F(FeJeH + +OsOcB]CFF!FD0VHcXFh  j BXF1J1U!FD(F ++OsOcBҢFEv+F!F2[H2-KQFlBE[F!Fر'H(~ **OrObBr FCFJ! Aq! [DQFh3(FP + +OsOcBD FKo ,@y..𵇰 ggFF)FH F.(-AFF@ IbF!Jx.@Fq7FP"9F@F,F8(F5` Fo pFp F=(6Or!0F1zaىB1dي:1!X@2! z !#`i`#.`poFs F@npG0F dFh0(F0 I0 F0(-MFڰ!F0"Fd F%F( O 8FF(9F9FXHo $@F FXFZ@ OIF(gF(IK ` F"WF FDH FFHiziѶ??iЪBAb af*Fb3F>(?/H{o FFUD9F F m YF F&xi "!8F0 +Oѻ{ # "8Fr9i9F F F(liH FFao ^o [o Xo ^.@x...0  EE0-EF0"! F8FvHo $E FB@F?(FiFQkI8FXjIF(hHo@ eIF(yF( `K9F` F"jF8F9F[Ho F9F 9FVHizN 8 0")FPF@@ KIhF@(Fo UF!F[żŜ#L@ YC?1!?C8FO35F8F@`8F-)F.H[5%hijhY *(F61D(Fv(#HCoGajhBѣj"jaaz* F FF2 FF(+xs&@> FF( F(O(;Vi(@x.((.0"-MFذ!  F'F( Q8FFP9FF@9FH%o.F@ }IF( uFwK`QF"0FeFFQFrH@F 0F(F FX0FF8fH%Fosi+:9F0F!F0FH(@,8i5h "! Fkh +OѣO0 "ca F [FpD @ WC?!?)Fȹo DI)(CI$(o9F0FF(Ќ:F! "8I(F( "7I  +riʱ# *#kO{"#QF{  'H] sh * 0 * QFC k "#{ (Ho00FF+FFO4&F}.@x.(bɅ0Є("(..-MFFj ?!?@1 Y9`A DB 7F>H `MH0FH Fa 8Y-AFFFFFP(F(9F F8HWBhB hB #$S`F` `L`& FAFHpFFF3F*F FFFp-EF FN3hFBh@q 2[O3B(jCR! FEнFR9FB?hЎF^FEE"F 01}o-AF#FFF #`+` KB*F eX+hBF9F0F#`HsFFF@*F F3FFNFp-MF FF*4(L> F)h(~F0!F" F ,&FFREN+h3D+`IP*O iFTBFҀE (h8/FQ 9`  L-MFFFF*D.# `#FF[/ ZEhѰ+;2HihBѼаB-H! #"F iEh2`! (<+j(bC``0hz3``.) )+#iE"i* "hhqFj)#$hhBhREiB Fi0H -EFF FFA񱞹- FQFF@JKBFF F- ---L -0-@F(8F(DECF:F1F3F-MF@FFF(60FF(𥀏(F2F9Fټ `\` F hL FL8FFi*F FFhhB#S`` ``` Fk(F8-EF(H&ULԱ"AF FU K FF-Ix+L F8"SF!F8FF5,6>FRZh8hLQ ]pGQK FFF@pGF&UU, F56>FRZhF". HhB# FS``!`a` pQ ]pGQK FFF@pG02KhFm F(~+IF0i*k+p%Il#$IFI)abaPbFhKh4K`F KM`#a=)FjGF3k"Fo#FGF80F(FF##I(FF!#i++IF0k{(FkGF) F!I#O>Khn]@-MF#F+7+2PFH(,0+',@!F["FIF@F(tF0O8F F(]@u RD BR!6(Px @F0 GFWW  RD BR _ 0@FGA/ h F(\@rD (F!FBR^KBhX# F`n5F5FUO"F(FTIh+F(FQI(8,AF(F-F.m pXFGF>KB@@r !F CS0F ( XF` GFg *JAF(Fh,&J;FAF(Fh `!J3FAF(FhOJ3FAF(Fh/%FK2F)FhF\@sD6 (F!FFR/P J` O( xh@8-A FF!g#F(F+FIFBܹWBF9F0F3hGF6LKBF9F0FshGF+#*F(FI) Fȃ-MFF@FFF(z%" ;IFD7L+Eձ+x+>'F3S/O &7FO E$/S$ FR*hB !B*h*F@Fw7  !EP*)*F@Ff7  FZE,F[_E;i 1F#*Fh~F!F F?hLȃFFF"F(FFF:F1F(FFH"F#!F(FRn F-AFFFcy## F F'I FT&#i++ !N F^0FKhBѥifj` + FI0F!H#ji`9F "j"(#j:FAFh ifj`##b爄f8LOq"F F J KDh LBb Jb 2bbc[ HX FU(F8|o@nop#"IHvp !0J X02F I F pF2Fd(F!FhbFFQa!!F@i`aH"K`akpKp 8F44 (` 8B  FZ,h!l!H]Kug Tp-AFO FF~h? #sC JIhBXBa Hj7hb+pB@+x+1+R#A9BcB@kBsB@@@@@@@@@@5B5B5B5B@'B@#B(H(:0(s1+?nR#+B+B+B+B+B1B1B1B1B@@@@@@@5B5B5B5B@'B@#B~(8 l j&8g'8@84(2( ܠ0+?!8~( P8 J F BKc`#Ch"hB hbhBsiHG6h2 oo 8F F} M+x F$" IhK,ph<@ F8LL oS@epF FG-B,@!M~)xA F "LM FpJ0F+ + + +Y)Vhz &&B@3 )`3SȄ$K,ph<@L o1@#𵅰%O&K&N'J'I'H(KFF(6#H*F"I!HfF`F!OpJF(H FhM`!FJHFH2"#!(hF(HHoooȄ@$Ce!CFF {F0"F 8F%D#h3 Fr>(('( رid(v(C(Ѥi i%5i#j[h[h+C+5 5i 58-MFFFjF9F@F0_+SO.OLO`,!!p!ap!"q0Fp!arAr!%r#t-atApr"sbssstt"ubuuuO!bpO O*q `r@r %r#t`t-@ppr!sassstt!uauuu0+##(0d0+ +"0F)Y*"0F)0PRF0Fh"1F)0P(9FHpF F1 h#F>((='(Аid(v(zC(ѩi FF(FV6 F"KI^4 Fpi FF(FW##p #!cp%#F&pp "0F"0F)@#%4 lv([XFF lmF(Q/@XFm(X&e%F(F F%=FXF[o8F 9FB(F x.+0F 1FB(F .FCEF)/*@F AFB8F   XF l( F5"#XF#V&#XFI#e n / //;V8F(lh$d(n-(F F8$8Fl FH8)Fhn(-AFFFF"0F0I 0(Yh/!0F FQ/K2BOAD1"m CsR BLn FPO1@FB0XF AFO2W1F8F 8F8F FF(BBLLLH p FFFHA:m;m& hl:Hp+h1F0h#(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpFFH(FhGF=  FFd#x+cx+&'O O #x+cx+ HhGxxE%-=(FF(*F!gBFhGF@F- FFhG}"# F#F# ` 8F F|)F FF F8-pLF F !FO:O J`FaaapdJhFBh pGB pG`pxBxxC#C@pG8F F?TH8JhFBhСBѣh+`F `p%;Hp FF-Hp-,%H, 8FFH8H-AFFF/9h.L, `L `bEр8` F . iCE0B$tFE+hij `p-MFF;C>X@FOEFLO@<SE-=5E 0F"mFh< Xp-EFFF]3+'oH\@<SE^H"AF FXc|"|B"3B2J Hh8F#?(FXppF%iBp#S```E`epF%hBp#S``hh`E`S````MF& ,jB F# FS``&`f`7-MFJ| |C#|CC|CcB$x + [; + & + FgD~L F! F(Հ"!F0ia#` FH'cz%zE%zEEzEe%DE8! F(|9F ha(\Д,0- .C#+ `(NO /aczJ*zJJzJjDE3FS/U`#h5aB`+x[+hO1@75EF0+++ji FB+jiR+ O1F @   O 2Lhmhi g(FdX*L*L ;P+&L FHO`@```by#y C#Esj ubE B* (F8(F(F)LRFYF0h J`;`x``PhS````#  XppF F )FFF0F %0(];(а@ p  FFF F1 H;h# HT_BH0Fh(-h -EFFF _0F p$HhBظdHFZ_UE8FhxhB+iB٧9FhiFIH*ihi?!8Dna@FF(kiD(kiD -h -AFFF FF HT_B@Fh+iBjiC;R#P-(F3hFB0`HF)Fo4` -h-E FFFc F tH+h#kH'FOWE+hE[H D0D%iO;4FB%%pF(FBh F h (-hD-AF',iDEѽ&#S``'`g`#i`iBZhW FTP&O6F F F#S``##`c` F@7 F FzH F  FFF&M(F( KFZhX``#B```aCaaa bCb M)FF( F`4``p HFFy0F (L F&Lc|%|E%|EE|Ee%DB!F0F{Flx +; +R#sonio{onnnnon+8FD0F0F0F0 )F )"# # +H "#"#*-MFttPpEEѽhB-h"QF iXF j9j:H D T9jBӻj DB Ha 9iH H 6hoit`Y?)EM#BkB XDPSB `H-MFF!FFF8JR;SHH $@FBѪD("JCFBH p"0 :FB@ #)BX+kPF\7\00F,0!k0 FnH MR RR DB8F(:jD(000#DrD F>Z? F!?# @,0(`0 PK*F@ BkkPF\\00F,0!k0 F(ЫjD(000=HsW ,W\JBW ! Dx*FWW  DD8(?DB_h/? cF<+h D  *  bZBbR?bZ*DbX*DbPbXR@bPH @r!A FBR]q 7 FFI(iE0H爄-AhF+F HJx xC#xCCxCc`+h;+`Jy yC#+h;+``)h FI9hC2p/*h3B*`BEDAF F`(+hDD+`8F4aBBЈBA pG pGO0pGO;hBHpEqF6FV$EBqқhHKBKAB cFhp-MD0,F FXFCMJ0!h 3`,F1,O2# ##u1bu`qbKhKB!CBB@'J ShIV`#J`$Kh ,""OCCCS$ J#CS @Ez𓀤Eph)@Ez<Bs'FAF<FFEz-ӢBs#S``#(F+`k`vO7aGWC3xh$ DT qqC0! F Ǽ0000O4hDT Ckh0P c O3C SO22(-h(,?O2O<BRB]EQE+ѥhhB'jjjjBBH k e#S``#`C`F8FKhBM,hB jX" I 0 FF $hHH<hps7@u RCOC `BR n0-MFDKFBF~.|(O2@(i(tO>;HhFBh9Hh)E-EU$ AE~ #c# FeE hШh(E-EU$ @B~ <FuFeTEuE * F)F(HHohp sF"F FpT N"F+F I H Hp#2FF)F FK(FI-M@vFHF,## - DTEU-O8H x=J:8@F Bzӷ_"F (*F(CA;K {Bl 6aA K6 FV V22Fy*j j R O1AQ$Ke8FFF  )`@s@1@ FVkF2F9F$ (JKdL@r@c@#@1Hʑd}F"!@ TeTK@E@uEBBE"F I H H"#D#!2F@ʑd}޹FH$th bE("TC`` #+`B")(<E(џ rF4(ĕKh;`Hhp<&``3F F2F hFKFB9h*F(1 9`5F`FF)h8FF(hW.` F-MF x@s"d e$%A Bz9"O f O;K[. ZF(FQF,Bx  "'(F'QFZF BxOOf BR8FAF H7 d$! 0klm EA07@s$!LM8 @(@:D BR!F#F#H J(@*@!F#F F0 ! F(4'%#&Gpp"Ipp8DX##u#cuKuu KO K"FK8FKIK KKKKKKB;ha HX8@DH\؄Hp؃ NFO4hB j"9F h F--#FFFu$hHH! `"H"ZOsK`] pG-MFF FF.MM(F'-)F FP"GKF`GKF`FK9F`FB-* @DE,;FOE3#B_F:hD*j%<@:i<Dh7Ka=W5H6Kb6Kb9F Fh3(2)Di;{1 FG]$hBiBR$dH "Hh OB OxlBOqBr$PDxd+DnjEwdEr" ph D`338(K`O0tp;M,h,nFF(fF(a3O#2J3I3HF(QF-I.Hx-KB/"###%J%I#(HF(8F]FF`F@F QFFF;!8F p H #" IC HF( H ,` Ftph&JdFO1FFF0@O2!F+F!J #O2 p |FF&7%DB (.(xI`_#&;+20Fp))H (d>$FFF KB 8](@83%0#%0@4 F<4@( pFF>=65OC FpF(B$O4 F<4@Ż @ں7+"C  FhF?([(*(7(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-B%hFB8F FH)F FFY F8FFFF8#(F"F;F1FF#h#`>(FFFFF,#"F1F;F(FF$ FLpF FF2F)F FF Fp FFFF L F,8L;F2F)F FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H|F Fp H qDhЭꭄ!-AMFF$FO20F)hX"8Fih ( #h4,  Й-AOFFBFFFKB(h)Fh+FBF9F0F( Fe#+`$ FDF8M,h4+hiDBch[  3+*"h2D# F8@0"! F M!FOB(`r"+ha!#FE@ JF@F!J HF F0UbEfiVaͅM`L#h3 H H#z ! Jch ] h7"(Hxp#-M`OA }F(qFDF'K EJ٫:F 0FC"F :1F)JFB0@(FF0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa p"kF;Fe"#e H(#BBLH  F pHU-M2CFF1H 0H/I/KBB"i)F :fiB#iDB  O18F2FF+hS "9FPF##QF28F9FH f QF8F@"YFPF kh+h3D& UbEfiVa((OA MF(H 6HOB#!F#H"# F(#*s H  Fe iBBH FO( H -MFL FF PN0F *)*"FPF"@F&@㱵OXQF8F nF ,5qah)m۸ѩBOOahi@1A-0Ѹ+ Feh>-A$Kh+=:*<Ѹ9( 0 !" ! ф* 2k.##h*FQF8FF Fm.k (&bN`N^tp8FFCr##Cr## 8HKcKCcKcKd%  70@=H #FFFz@FKh)K#!H"#HK!#JHFH FHvF FFF*F$! F0$":`(h FL-M, L @ FiB;؄iB6ؼ7'#\E2"C h  `24 B73DP@P@@@ @+HH 0#F FJm++i+% %#i FbiFFG F0%LL-MFF FX0++ 0+@ف/΁$((/ŁR'*F@FSFBF( F ''\ F@𞁶 B B 0B  ZDB#^FW3E˛E04DD\F@e B_ BX 0BP' ZDBH% ^F<CS5CL;E74DD\F@! B B 0B ' ZDB%J ^F<O[C#5C,;E74DD'\0@؀` Bр0 DBɀ BĀ B/ UD#BD E#[B' '' /"J  C   2E4D35D/ S "@B"@"@b" \0.7гhѶ0 B_D BX BT(PO ZDCEID C  ^F (xUxxpMpp21  EDD( h5SO0 LQLOJ$K/S'ߍ됃/S'-Mx _(]Fh F3+FGx! F8(H (KF F%It("H !J(a JeaJ$!"bPbb". "eeh'cѺ#OccK@<sO@Chd#bc#OxAccOc##d x9)? ~ -MFFv! FF(%1F(F/hF(\XFNIF(V#F#F|F(KAFPF g@F{{h;;l>K#"fg7K"o8I1F8.3+z+0 "!@F1Kcb1Kb1Kb1K#cck{D0#E0#djid"e@"b` ( F:XF! g+i;7;F1F(Fm(#(1F"o(FnIFg Fr(F0"b`Kh2l*h`jhrZ`H؂8˒uI (xp-AFxFF(SЄh#hBKcy+J"i:Fh 3C0D  BBA2ikL<@&8F FU M(CF:F1FU cF KBFz FU yCF:F1FLLLL -AFxFF(XЂhy+NhBMSy+Li9HhC 3C0B  "BA4ikL<@&8FFU M(CF:F1FU 9FwKBF FU CF:F1FLLLLL  IXi(hy8 ] ؂F "F!FzF, FIY(i(-MLh F(  Fh%+- FiFCh!ah8H !FFP2JahBF0H qO0!F(F0(o(F%FU4O<<<B FU!q( FL]F FWAFF(i;iahH6:FSF(!F0Fx 0oJ0Fk<<7Mh(F(!(F!F(Fh%+o"%!(F* F0M( !(FF(O4$ ]HpGHpGHpGHpGHpGHpGHpGHpGHpGHpG )p FٱoN4h,K FhFDcBX\B KhS$wKhC$P3h33`pX\d` Fh#lh+ M/h K N3` +h7`C"clCcdKh< @cX@L?UHF FFF1'3x+;lh;+ "!F(F#+p^#lppsxpx+qxkq' FLLLH HH8Fu+lhl"Kldh<@+l` F8LLLpFFF8#lh+cl3`#cdK h*`$` FpLLLl-MFFF -t+q.o+lh+m+m0+i7O܀9h R! {J{D$,)"d +"FX #"FDP %L9h"h0hR! B "L2`_ F "d0S!1;h"hR# 32`ZBXSB;`0;03"Kh< $kl#kd L L L LX\d`L-MFFFF(h-D,Bжo?+lhB9ﱻ7к4кB2Ѹ x"YF F"AF0[#s#cs+lh۱+O!F2F8h1F8h Z K`$klCkd FLLLLhl8F+lh+$ "Kldh<@+l` F8LLLL8Ffm+lhc$ K`+l`q F8LLX8FH+lh;+ $  K` w kB +l` LF F8"Kldh<@+l`LLXLF#lh*"`" FFF FLLLHpGHpGpLF#hFOb! ho2F)FOb h Kh@pO` `(Ob!h$pT-M FF(B( NOM0`0Oa 8`$0h8h4`+h3+hY4,(hwKwLhvH ?0 ?8`! (`($O`+hHY+4,! cK`(0h0hbIF(@4h]IF FF(@0hYI$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?S +ϮϮϮϮ}-o 5$-AF0Fx++筱= ''kFAF0F(FFo o #F CF FcF(  K@BS K(FpGHpGHpGHpG䒄`+?+U+i'+لhD$Bh"DB jBh XB   8F (ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(FQO S#ah2F )D6?E`fbh*j )D:`+j#b-M0FF_-@Fh?!j'DBFF 8FF'.Nۡh )D3!D#" F 3FpG@Fg#j;#b(F!jsh QD F!D8Fp"jD"b FAF4VF'FO@r06`0` S`5F-MF FFFع(FH.i"F6#(F FXQ#?O` F-AFFiF(FB 6#F(F)DA"O4 F-AFFFFp:F1F(FF B:F#F1F(F)0 #(F @$@ 3 `CF3FF(&2F)F FpFFFXFH:F1F(FFF F2"#F(F 2F-MF FFF7(;CFRF)F F(6C1)F F FYF8(٥h-]Df'"1F FhOscQ4F:F FBFQF F'OsXF>Ds`opFFFF""FF1F(Fp@pFF1F F( ۣh F!Dp@#(p-MF FFGh(0(Fki+OkjAFZF(F2F!F(FEOSca6cbf` #(FI ((+j ( DDE  B ?/DB Bo'F[FBF9F(FRF9F F8K6#`OScaOSf`ai a F;(h(o ]o JC o (JC p+FFFG2+0(,(&0FG?+O0?70FG?+؄0FG|d?+РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFhx# #h02(!F? =O07 F F`0(=7 F$ F0n(4=(ݰo4?447FFh# #hp0G(!F? =O0(ܠA+ 0pGBXpG3*pGKp(ܠa+ 8pGBpG3Z*pGKppF$B 5`104.pO1:0@pF0FF$ Fp2F)Fl$?&: F5;,\Go#Wsw3 ap1aAp?acpp0$)F Fk+;o F g??{cCpFXAoӣ\Ao?# ap?acApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4L DB;C@۲40  F0M\B0K$5@`@F FF @" F F! +h$ FphF F"!0F;#3p#p$spp+h 3+`phFF F "! F$ ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0FW#Z`8F1F F!,a FC0D7yjFhUF F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`jyjhFF"!F F"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(Euzj)hFF"!F F2##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`jyjjjzj-AF0HFF4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF(FII`v(Fvhh3bx3hD3`(F Iq*jyjjjzjjhFF2"F F!h##p0#pcp'p``#+a#cq#Oq9F(F@9Fq(F;##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`yj-MO6m #*IlF%FF"4$! F.3#0F)F[;GoEF/D$" FI>%#"0FIeq1!a0F )F`u F q=F_ؠfksF p$%F0F(-@$ x.*@$5&-0F$^7 FPn px+4B p4B0#!DB Dx#@ @C0K#DOsB  -AFFFFlF5F2F)F8FG(%`-h$h-&`6h$h.%`-M hFB FFk% T"!PF5ch`#hcFB0VTl%F.EFEhF"F`[+B.%.F#HqFT<AF8F"FK,65FZ& "AF8FF6F1F8FG(.`u`6h-h.ѽ+`]`-hh+.`*h8FFG+h]`-h+h+,`e`I-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N>DD@k@3DNjsc N8>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ K`3C`)Cc`3`#aCapG#Eg-EFia(CiF$3CaCiTsFCa@ TE"FE&RF#9F(F]@ CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@OIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3;3~߯-EhF?`(ChF(3F(C`@ ERF@<"AF(F,CC=,Cc;,<DFE@  aE5҃I!O1T@\ @B2 @B)s%4308< >dEADqD5FDD qEcDY'aE:>F9DADBqD4DDDF oo BDBdyBqF;FF,3F!FFo0F&(o;OG   D՜Yp3<.#F#F>F>.?GKN %9D I LO4%1DI !kDDD-M ! %FF%1)%k!B&$4>h$`OqVh`V$ `N 5P1E5@l6%@l%F!51)ѽ2P>'7/3.5%RP%745D-$B&ѶEtF(4FBO8 F 2 **@𻀺o  0 <EO0 5PUE5 | % @4"O2O  FbF5{=F5B=FBP5P%o,uD /popo ED%O`} /DA <@\=,@\5B] 5B1  E+%*"F%D BB3%@D-Ѻo\h ,hlphPFs"&J&Jd@$J$J%~%`%8P-0OE@'O@O _R 8@B"!F' &EFpH 8BF>@h`@Ȯرiʱ#!aAcOACa`aQaaF`S``bbbcccfedpGopG8F F*<x1*9<+7o8#ajJbbcj Kcb!B0R#jjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo3;FirCjcQk"jGj"cjiG ao-M*FFOE xDOsBD<%DB٥E=D@)*DBOsBDOq(F<D@;D%DVS>< #D DDYD D!D !D [D!D D!D!DD!DLDDDDDDDDaDDSDCDsDcD D D#DD2B FOq*(F FOq$ FW7ASB.?g:F1F)&D>DBP FOq(F FOq FK < DL @ dD+D D#D LDD #D D LDD #D DLDD #D DLDD #D DLDD \ D#DLDD+D,D9;D%D -MF(Fi,ChCh+>#hk + ##` 00k0#"($&0FJ/ !bpt{o1o hZ ##`/#;?@D5-ٓH3B"FF"a ,`#^F]Fa#`##a#jO2ch0! $!K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ɀ;?@D5-+&a`O@#j"`#i"i ,`a%#.F#`-@Ԁ#j^`#i"i ta%#.F#`-@ɀ#j#`#j2 `#i"i ,`[a%#.F#`#icр-@#j&d^a#i%.F##`#iX-@FgE(F!"jzihQii D[DBbDRZFQF#iZFQFia#l  D#d#l+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFiaDf 0p0jccK"h0*B}Pkk+@^"ij 0(Ghc(@Q##`oK/;?@D5/;?@D5*/;?@D5?"i ,`aAGCC^C.C"j*?8a5"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiKaDe##`#i- "BвKh"j*Sb/?Q+?@D5%.F"j*@#b"#jc"FFa4 # /?3;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+? ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?xE(FE(F?QFZFq  D[D#l #d5/?;?@D5 -D!31"fcfeO6+AK|#f##`m/?d+?@D5-Zf7J=2083$ nB!0Jn+cfd#cecmloJxBF#0+/?1;?@D5 0p0@Fcc 00pkk#+"ؚO3@C3@@cD #0 E /?;?@D5F@m@@;?Y:K#d##`lC##`O>m moJxBF#0/?;?@D5/?+?@D5BO2!l@&D!d@+"ؚO3@C3@@cD #0 E /?z;?@D5F@m@Z KyC D)DDDd#D#`l[BO2al@&Dad@jDblB ١KN/?;+?@D5##`+?.clB!l1D0E?j cDsD( B( F`kDB(F!d9˃B#l ##`D F+?"l+:""`h##`h#i+J##`#/?ҫ;?@D5-0D0iDabiYD#ia4#i{3iB WK0##`H3F%.F/?;?@D5-iBGK%.Fj+"ij+c@bbpjBhk IӉA#+cjbP]0 *D  2D i2Dahzv D#i2Fi+Fп%a4#h ;ZBZAch;#k.CD,0++o+k E(FD9DRF  WD2Fhk9D.c+kjSDB#+cjBSDgkD?DTDJC ٽF 8xF+x,HhO08`Czz 3 H #xF3-DDxF0-H0BHQ;j;-IF&K %KF FF<#o"JdFHFH~O4 F 3h ! F+ 1cK ! F)+ HQO43`-;FFFhFFe(#"F+F9F0FFHBo #`O3x KS"pGXJ#{0I@  m+-MFFFFFAF(F"#I(FF(F(Fo.!F(FFB'x/.$D,9Fй1FPF0FQF(F@E C0F!F(F`)-AFFFIF(FF(F@O7F,8FjF!F(Fx/+D<[BF1FR(BF!F(F%F)p FFPIa*FF# Fp@ǹpl :lHGO0l lL(,#F0h F@ O00F#FP0Q"0D"02BF{8 ]-MFFmF(o(F%'DB +T;{ B%YF@F?!oYF@F6O3RF@FCB BѻN%O1 O1XF(( 1`FBT;F?5l+ F FF:FT -MF TFF 4 *zC#DBӻQF@FF&!F8F0`F)FFO3-AFFFFO0AF F(۝00 :F1F F 𵅰 FFFFx ۝,0*F F3FO0F#$$#-M(FFFFJ!F(Fp!FF(FyZF9FF(FTF F F"!3D BO4BEZF9F(F0!FF ,8D$0F2 pG!JHl x, "lx l l l(@l | "lx :(@lҿ|nI)-MFF;*9$JHRD4BtCF a(FG(Fp E)B ٲDWEI*OT F hh hhhhp(h FFF а@((F@ h(F8 (F #F)F0FPFH K-MFFFF%} UE$ W%F@H F } ѳ0FW% X50FW% ($g-A&FFF4FDE0FU$18F&E$4pFFhFph"#UCO2`#hZQhD`p0 FFFF(FF0`G0pGp F h@&1F FB 46)#!l```v(`0 # J`p# xFȹ" K`X+phh5B##`%'x-M FFFF)O F4khB"K`#F +h S 0+ :F@FIh0 F+hSD33`4x-MFFE%QF@)8!MC#hFZ[Ys+@'hE@ #V-XAЙB%O ah0F95FKBchB##h S 0YMѻF@FQh~( h+7/5  (D"9F0G# F#h:FXAFh#@# eJ``#h+Dh#h8F#h+Dh+#h+D30F`B=@FQh3(7 h++WhF;PD"9F0G(#h:F AFh#(#hSDh#h8FSDl`#hSDh+?N#hSD3`k(F#hS 0+U+_ѢhchB?8]FO #h@FC `#h =p`#h8F 6` hPDCh+?h+?h03`Y hPD0h h"PD9F0GH!h*FQD F11@ F#hAF :Fh#9!hQD(*F F191 `:#3x-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(Fx-M`BhF2" Fk`+f(d%O h}a;`shSE")FTK8izi2,XДBW!FOH9 #H# 2hX+,{`k;lh(k+;h#0x.+k{`;iC%  }iD D}h{a  0;/*ZE\*55#O0(J`7FFhh"F!0F}!O= O\;iB # F3p!F hF`(ьChh:sцP/Rh:oFFF1F^E\.уCFxk<x-M`;mF# FF` "K` ?PF "KQF"Fe#+Ul  ;m2FymhW0@0AFOpع(F0+@F(<(F (7Fl+F.F+{`3x +E +C#+D4F;hB{hB#x+5(FpѻhSMTN;mETHAFlY!h(v0F  ) уB ^x .23Ex)Ѥ1p`+F"(Dt&FF0\F=+  OhBO#p;m[AF0Fl4O#p\F0Fh9m (\)Yx)#F3;mӹlk#({i+{ZF1FHt0Fh9m(?m(Fcx+h=*КB#ZF#p[FFhB#p3x+"K`xd=-=<FF$'khB *hX+40G(FFKJKF(F)F0FJFGB);F J0 DBؿ$p)J0D0F Յ;V7D;GF F!ǿ"iF iFH 3]h-MF FF&o 6.< 2#%CC%C BFF9HMܸ&<$ # %CCO2  " @ @@ #%S9F#HBFQF"HO ! ! ,KO  0b   @@ +C C +F  o &DaFHu,!FH8Sbz`b~`-MFF@+FFFF@ F$)F F3ZRF0F.I"B('FO FDjE)I #D0B4}C# F.'#NB/!P3kDH IXF-0@*00FDD  - 00۲ 0 0; x$p31o 3R<,-M=kF@+FFFF@ lF%1F fF3O {`-kFzh УF`h2FQF@F#FD8`hI q;hDD8o 7F , FF FF "  Fk-AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH2<pF?F!?@ F(3*F! FpFIFx3\pG,F 8CH#DBF#Sp Fx;A\, #h:B`\i1`i 3`i\`-MhF6&``a` F% ; E@ёBO0E0ќB>6ЮE]$O  D i E DEB   )iaE8 `` GEќB<ЬE $ D`E 8GE5B iB $D`EEO0$,AhB !t,Q\ 9BMahE(O2RE  *F!F ( #*F"($ F "poBdp FFF 2F)FH FpJ#FF F "chh{ DB DFO (FbEOF F!!QF<2 F !bQF)F +hZ*`x)+!K2! FQF/+`9F F+K**Yx ?) "3+`1F F?)3 "+` " ""XF(+h FZ*`x#Єτ5τЄ7% RRRRR x!^SBSA 2)FFxx+! Fm F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pڱLC+B &\\D 0D 2ҲBѩBFpF,O2ڿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFzFFB5*F9F0F#lsU F8F F+F)BНB 8FDBFx2,8F00F$ F8)FVF 0\R>O  '4-'< x <!x_ @K1   #B B@RR40#!0 B FFOEE8/p5EE<0#+pDјECX<k &0&"F+F:1$s<DF+F0&1Rк кz-'<  XF CE83:$s<D"F+FO FCE8p3CE8p3:B@(D FF; )@"FF !:,BE8^]8lCE8p3-AF*K*FFF G F'B<"pB "B0Bp;2B+Bȿ#D#F !!/F(CD? B <B"p7Bp<3F%KF*FFF0F?F("FB)+ &"F`B*B DB82B۫BԿF!ȿ"= DD"FO `B88B8p2ƅ-M FF(CF(O:(;xkBVE83psE<# <%+VE3pt$F-*A0*Y0: *JFO F+0 (Ox.*hZx_0 )\9F# F+0 L#s9xh)X7:xx*b*r%*X*VE<%#3p;xt+EspDFzx{+* г * #* **O8DDD@D #"0UD"0**џU;FO3#z)k) L)zFZ)O1Dl@l)xxl(L!7c:*P"ADFCCCCFCCCCFGDCCDCFCCFBF3F !SE8p3:*ܸ3̿F"ODDVE8U;83p !#FFD* ܸ3ؿ#D&F7SE8p3l)U+QF40FCFFg)FQ+yxU)I)M)RD) и? OD D! i)pm)@a)O hDa#QF0F#B4QFCF0FFFF(FQFCF0FF(Fc_vI{x\;FRFD@!O:oM @ @\O (\Pp) 1F1)А!$@p4 CFPD@x$@4){O F  F <9 һ FO.   "*Txl*B*L* "" s* [ F"4CFQF0FU"".I 7o  F+h4F`5VE82pD  D L)5%Fih[+0F FQF]FF? l) Z) h)*ht)z)!*h*h-h*E1,<ƅ FjB ` F S+[]pGF FoAPR]pG}F FOqF F }Q ]pG#F M Oku5 F !8#F$01 +.FO0Fx0+ Cx J\D 3۲x+#0 ` h # `pG h+# `, Jò\D D 3۲9+Կ0WpGOppG, F!F&F0xB.`F" "#`FFFzFo:F FBx*3B *(` x-,н@0@B F"hIx\D 3۲k+m+g+рS#`Sxi+2"`#hxB*3#`,-A FS!F FFfB FC1A8 F"hMx\D 3۲k+ m+g+щAQAQS#`Sxi+2"`#hAQxB*3#`8,pFF)KB J \@Fl;]v `!p@8B!`O0p,"տ!-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0QИ-EF&O8 jD# uB ci+#kHh#CЩh@F!D4 #BB!@Dj(??1!?6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@Dpii(??1!?N6yF+*ѽ@,j,DDhhbich+!Lhci!?D?1!? '6+Bۨi!i)D&('KhFBH +H ELFhԅԅ#J`J`J`J`KJ#?`pG-M KFhFF0F@I"42TO &F! apppqqRFIfq +2F "RFAF 2FKhMS^p N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`Tlh nTKhP A1JhB  L#h3+#` Ht#"#`K``5<-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQF{ B ѣyyC#г6@0FQ#q#qFBFF4T:F!FPFOBFF&II:FYF FDF51F*F<)F8FMO;h+"+KhEN0h"AF#MFFRF FLG"AF(h !h(h#;`#`3`T^Kh8 pG-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H0(b"!9H(\^##p#'cp#5Hpp'qF(Z<(Ra#cq#qq:F0FW4)H)K'F(FF@F<#;FFAF`p8F7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH]4;!cA,-AFFB!x)ѽ)ex1)^С3ڲ*SH6U+R#RR#RRoQoQoQ#R#RoQoQoQoQoQoQ#RR)S!RRoQ)RoQoQ1RoQoQoQoQoQ9RoQoQ#RoQeR")H5,D"&H"%H- #*F"I#H':F@F#0/F?- @#*FIH?'d/F"HxKp"HKO*F8FO5lhdH,-"sF1F \KB#MEq+p+x1Fl +xl,p@pcSc-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDlKx l4 F@hKx+Ob!FfHeI xdHeQF"cH#3`aKh^IF_H!F+M 3Zx2DWHMP"TIRF( "QF+?yLN7h/?}/?q/ FAFO FA0BI@)F@R F=IOb F#D#wcw#0JwFwh5J R$ "% 4BFA#&IF8:"I"BF .BFQF)!J9Fhp7D# FC"O1i)DcScPLX,-TKw^WSMb K`K`"K`K`-M$aH@4(!FF\Kt`\K]Hh%1`@@R! FZVIOb FZO#SJDwwFhNJ R$ "% ("",|"0u"4n#;OF9F8f"8IN+F*FAFpoxxFC#:y(FCCzy.OCc{*K-h*1 "8F9%Kh;G#P" .C" FD#O1xKIh#H0)DF`POG"P2`9̈́J̈́SMb^-WYSKhKhB H@̼ K Ih@o(O``H@^̈́W' (] 8FF#h FkiG"!(O 8 !F@h( F@IսahHo##"FCl hki㱀lA FwyByCyCyCzCBzC#h FkiG&ah@He(ah@H]##FF(FD#3`3qEIF"l2F(OAI"l*F(G+hki+V;OjFl;H 0C yC C C C#yyO  Fp+hkh+"F(FG,$oo-A' F4$H F"H^F(7F(2$Ol[l@F8FZhl.BHB[lH4$+H d%S""ʅ"2#` FFFFF1F(jFhBa}#}}C#}8A! H[IhGLH@TtTKOsB @s@ B  pG pGpKFOsBFd"(F;"I6@s rBӲ" +sjsp@to~)s!ds$ iss+tjt^8F"F "Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubu^E"Fp"[p#p0ICr Bp[#q#cq@#q#h#r0`qiFrr "" ! Fr rDFFB"w"JFh!4{rd+uu#",v$kuulvvvT-MFpFFF/>)2"J?FOb)F8F F*0 ZF1F8SFI"(F 4$K`K`K`K`|K`A FO6M O0oSnT$$) x"+219:*K? "+#ppG;:!H8 -(())+ #@O_ O KhcH Kh#HKh H"IHt(CF(H H H[ SPSTS!^%TSTHIkh (H"K @o Hj" K` ~H @>SGSKS<eS("]K-M`'"ZK[Nll`Fpp th F#0NK`- .&69 ]HLD( LEK`i "BKo`{?H";K`>"7K`&"hb,Jh/JhB"h#`G3h+3h++1+07`(F((KoL+"hbFH!hHKHh --.$ho?<40(ETTMT\-AHF FF:!@FnF@FUop8`*Fq F# ,D<(*FI-FCF#IҲ4]FEhx0; +!@@pOpFK FK mFhF JhB2CC KB 3B J` mJo{O0m FFhFJhBCCC" K H` " F mo{O0m FFhFJhBCC K "!FH`B F mo{O0m F FFhFy!JhB,71 CCKx"7,) "H_ @ oJx#p m H HO0 K@*(@"`o{U`YM F FFhF!%JhB>@2CCC5I x* ##3]#@$B& 0M/+(hI(hF(h"F9F0D+h3D" U M"F9F+hO0o{pFC#DBFF)/*0pmObFFhF.JhBPR#+L F mp+&M(h# w$Kx)$BJ+hh"FDKhB`+$dBIH&OQ(h)+ ##3]#@ $ O4o{(4U FF$JFhM0`"OpJBb`J`BJxO@p-ea a*FDK-h0*F!F8DKB3B KKhKIh h H Mo"X]lFFOrOS##F333#bbb ИBF2F"RjDr`*F9F .& 3D"F!Ha ]0]lFOSOr##333#bKx "I "F! H6 ]0 MI*h cbp+h #D-E]lFOSOr%#KUxUU%b "I AuD"F!H ]8 (F Icb%0#P``-M]FOSOr'#7KFxwww 'b. ".I D оB3F+F#S3kDs`2FAF"F!-%+DH} ]ORIbb "H6&(*F"S3 r`2FAF-%+D"F!K]h3KhOrOS##jF333! #H% ]]0Kh;+ 7>CJS+K+Jx$#Or33OR!##H#jF]KJx#3Or33O@r3Kh]5]Kh]KhKh]]_xptp Fo9KJhB5JL#h;+0%6oW FFEH|0###`D FFAH|0#|0;Hm##|05L##`p4H[3Kh!|C/H0.Kx+##`3##"#`)K`Ob(K`p@$X|0#H#M(h"K.h`0F#.`<|FO`I-Jh+D`+#-"K`xT<TTTpteuL#h3+#` H@ HO`#hI@|Ih>LOb(F+`!`{;O:h:IC h#Ҳ!h5H h3N0`@F #<F,H#I&J+H*I hS*Kh:;h(hC@B'H!h&L2h&H!hII$H h!"J@!K"Hh!IO`H!"KH`K`OzrK`"?A*PppT8UVUtUUhlU$UV;VVeus|Xx"K`<)$MF$HTBp"I"L*h"K"I` hOb'$hJD)hF# FhA%!J!ueu[v#vuu%vev<K6`uK u(F`; K`@UwnTT-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! Fr r%uuuu u4FFD9F2F1F(FM:<TKKKNh"2h:*S]jSSwOrRAI F?Ht0D F=I=I JhaX3`K2h`>K>I(h`]=HHE"$;K F`;K`O@a28Ka`7K"`6K!F6K6HrOr4K7E3 Sȅaȅpȅ|ȅȅȅȅPTAUVUU$Ʌ)ɅhlU$UɅV;V<`DžDždɅ0V}9zX Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-QR1=C.)D![NYd9ir;5<̬t@).'F%6L% `^]\Ac]^Yc^\}^` c%^YnW ?m9ir;nW ?m9ir;aʓ +ީB#8JzЀQj8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bPbP^P=PxTP\G@;@dG@;@hG@;@lH@<@`AG@@;@pAH@@<@tH@<@xH@@?@|I@@@AI@@@I@A@I@AA@J@A@AJ@A@J@ B@J@<@K@=@AK@@=@K@Ā=@K@=@L@>@AL@@>@L@Ԁ>@$pPHsP(qPLCsP BPAYPP]`FC=݋#1--'?M(s*K>;e0L60Be 9P@68kkkkkkkkkkkkkkllll&l-l4l;lBlIlPlWl^lellltl|ll$, l&ʅSnзqunfq'0t'0'0ń'0'0'0'0'0'0'0'0'0'0'0[r'0Ƅ'0'0'0'0'0'0rsRGBPBGR3BGR4oǹ繅allÄlÄlllllÄlllllllllllllllmm!m1mAmWmmmmmmmmޱ҅籅҅ǖs%4n@09n@ HIHJG)HMGv(", *$.)#-!+%/`@@jRGB3${<ZĄ<<(< RGB6U<<>n< w%wDw蟄蟄蟄ĦĦĦĦ蟄蟄Ħ؂؂!I65V!VWqWUW9WWWVVAnnneee}efgnEekuljlj3[Q8(Hƅ@ @ '@B……………………Å!Å4ÅIÅ[ÅlÅ~ÅÅÅÅ3ȅчۇ釅z)9Å3Å.ͽ۽齅  U A @x}uu@x}e ļռ漅dd d) d: dK d\ dm)i?PVaw%,'03Aԁԁ)ԁӁӁ G eX ej e|0e e e@e˾0e,x,-y- ---a= Q!/͗-U*k%,---<0,C--,,.m.3.---K0 -.]0-Q---#-.-rUnZn`n hn onunw|n n n nnńnnnnnnnn [xp8Dh  Ϙ  iqQv`ppp@@@@@@@@@;Zx0N <…J…X…Am{߁=܁L[jz,9,,+jhphxX~XXXhЭhػ껅!3GVezy\`} n u f  jPȄձرl۱f\`j}nruy| 0&'&-'s&a&;Vúκںٺߺ㺅캅 hQ_Ҝ ۜ 뜅    1L?љ1K f    љܙ ؛   , Hdљt~ ?~ ?fљ  љ  ) 6ϚRnfu  љ   Ϛߚ    9 KљM99 @ @`00 &6BTKkKaQ^ÅÅ=źmF…m m0m0m0(n08 n@ n@(n@0n@87;btF…Cm1I&Rw% |EńuuuQuuuuu uuuuuuuuuuv vv vvv ɱ&v -v3v 9vAvNvWv`vfvlvrvxv}vvvvv/v5vvvvvvv;V;VNouo1oo7oo = #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys !"# $$%(&*,'0(48)<@*H+P,X `-h p./ 0123 @4567@89:;<=>?    #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentu-boot*EHCI Host Controller   *+,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banks%s:%u: %s: Assertion `%s' failed.v7_outer_cache_inval_rangeforce_idle_busdo_bootvx_fdtfit_find_config_nodeusb_setup_descriptordev_get_parent_privdevm_kfreedevice_removei2c_idle_busfec_alloc_descsphy_device_createfuse_overridedc_ch_offset_ehci_create_int_queuealloc_double_indirect_blockext4fs_put_metadatafs_devreadefi_free_poolefi_runtime_relocatedev_get_uclass_privdevres_addfecmxc_recvfuse_progext4fs_log_journalefi_free_pagesdev_get_privdevres_freei2c_init_transferfuse_sensedev_get_uclass_platwait_for_sr_statefuse_readdev_get_parent_plati2c_imx_stopfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue #gpio-cellsCan't find empty command slot! Max transfer length is %dB timeout exit! alloc space exhausted DRAM: qca,keep-pll-enabledvddio-regulatorregulator-min-microvoltregulator-max-microvoltqca,clk-out-frequency%s %s: invalid qca,clk-out-frequency qca,clk-out-strength%s %s: invalid qca,clk-out-strength arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u imx6q-wandboard-revd1imx6qp-wandboard-revd1imx6dl-wandboard-revd1LCD_BKLENinitcall sequence %p failed at call %p (err=%d) MX6QPboard_revMX6QMX6DLD1board_nameC1B1PHY_POWERPHY_RESETBoard: Wandboard rev D1 Board: Wandboard rev C1 Board: Wandboard rev B1 auto-detected panel %s No panel detected: default to %s Display: %s (%ux%u) HDMILCD %s cannot be configured: %d unsupported panel %s ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeconfig with overlays but CONFIG_OF_LIBFDT_OVERLAY not set loadablesThe given image format is not supported (corrupt?) ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': Scanning global bootmeth '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid Automatic boot of image at addr 0x%08lX ... compatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s fwupdarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] CACHE: Misaligned operation at range [%08lx, %08lx] %s: %s: error: gpio %s%d not reserved bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s - %s Usage: %s - No additional help available.  Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...y Y yes YES Core num: %lu is not valid disablecore %d => %d %.*s [noreset] bmode - getprisecbootcmd=run findfdt; run finduuid; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x12000000arch=armcpu=armv7board=wandboardboard_name=wandboardsoc=mx6console=ttymxc0splashpos=m,msplashimage=0x12000000fdtfile=undefinedfdt_high=0xffffffffinitrd_high=0xfffffffffdt_addr_r=0x18000000fdt_addr=0x18000000ip_dyn=yesmmcdev=0finduuid=part uuid mmc 0:1 uuidupdate_sd_firmware_filename=u-boot.imxupdate_sd_firmware=if test ${ip_dyn} = yes; then setenv get_cmd dhcp; else setenv get_cmd tftp; fi; if mmc dev ${mmcdev}; then if ${get_cmd} ${update_sd_firmware_filename}; then setexpr fw_sz ${filesize} / 0x200; setexpr fw_sz ${fw_sz} + 1; mmc write ${loadaddr} 0x2 ${fw_sz}; fi; fifindfdt=if test $board_name = D1 && test $board_rev = MX6QP ; then setenv fdtfile imx6qp-wandboard-revd1.dtb; fi; if test $board_name = D1 && test $board_rev = MX6Q ; then setenv fdtfile imx6q-wandboard-revd1.dtb; fi; if test $board_name = D1 && test $board_rev = MX6DL ; then setenv fdtfile imx6dl-wandboard-revd1.dtb; fi; if test $board_name = C1 && test $board_rev = MX6Q ; then setenv fdtfile imx6q-wandboard.dtb; fi; if test $board_name = C1 && test $board_rev = MX6DL ; then setenv fdtfile imx6dl-wandboard.dtb; fi; if test $board_name = B1 && test $board_rev = MX6Q ; then setenv fdtfile imx6q-wandboard-revb1.dtb; fi; if test $board_name = B1 && test $board_rev = MX6DL ; then setenv fdtfile imx6dl-wandboard-revb1.dtb; fi; if test $fdtfile = undefined; then echo WARNING: Could not determine dtb to use; fi; kernel_addr_r=0x12000000pxefile_addr_r=0x12000000ramdisk_addr_r=0x13000000ramdiskaddr=0x13000000scriptaddr=0x12000000mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fisata_boot=if sata dev ${devnum}; then devtype=sata; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 mmc1 mmc2 sata0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_mmc2=devnum=2; run mmc_bootbootcmd_sata0=devnum=0; run sata_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; done%s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone !rclist_empty(&dr->entry)U-Boot.armv7bootp_archInvalid pxeuuid: %s bootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list , Build: %sPXEbootefi %lx %lxefi/boot/bootarm.efipxefile_addr_rtftpextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sset_dir_flagsget_valueset_valueVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizemulti_dtb_fitVideo%-12s= %s %sactive FB baseFB copyFB size%-12s= %dx%dx%d devicetree = %s There is no valid bmp file at the given address Image size : %d x %d Bits per pixel: %d Compression : %d noresetbootcmdError: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Trying to execute a command out of order ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... List of available devices: %-8s %08x %c%c data abort Data (writethrough) Cache is %s Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s -n## Resetting to default environment edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems-yReading bank %u: Word 0x%.8x: %.8xreadmReading bank %u len %u to 0x%lx cmpComparing bank %u: Value 0x%.8x:0x%.8x passed senseSensing bank %u: progProgramming bank %u word 0x%.8x to 0x%.8x... Warning: Programming fuses is an irreversible operation! This may brick your system. Use this command only if you are sure of what you are doing! Really perform this fuse programming? Fuse programming aborted Overriding bank %u word 0x%.8x with 0x%.8x... ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) CRC32 for %08lx ... %08lx ==> %04x: %02xreadingError %s the chip: %d Valid chip addresses: %02XError: Not supported by the driver Invalid bus %d: err=%d -sInstruction Cache is %s ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier | %-*.*s| %-*.*s| %s ParentDriverCan't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? FDXHDX10fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available PLL_SYS %8d MHz PLL_BUS %8d MHz PLL_OTG %8d MHz PLL_NET %8d MHz ARM %8d kHz IPG %8d kHz UART %8d kHz AHB %8d kHz AXI %8d kHz DDR %8d kHz USDHC1 %8d kHz USDHC2 %8d kHz USDHC3 %8d kHz USDHC4 %8d kHz EMI SLOW %8d kHz IPG PERCLK %8d kHz activeeth%d : %s %pM %s not used Supported partition tables%c %s: 0x%x-bootableUnknown option %s %s%xping failed; host %s is not alive host %s is alive prefetch abort Invalid pxefile address: %s Config file '%s' found Config file not found The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... stop%llu bytes written in %lu msfmtgsubCould not set var invalid op ** Abort software interrupt ## Executing script at %08lx pin-controller device not selected %s not found -pext2fatInvalid filesystem: %s Error reading config file undefined instruction starting USB... resetting USB... serialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)%2u %2u-%2u = %5u %s1.564bit ncq ilck stag pm clo nz only pmp pio slum part AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s No port device detected! No Link on this port! No mem for table! Can not start port %d dwc_ahsata_blkSATA Device Info: S/N: %s Product model number: %s Firmware version: %s Capacity: %lu sectors efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed NetMemEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p ERROR: Failure adding GOP protocol en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition %x:%xCannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout EHCI fail timeout STS_ASS reset EHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) fsl,usbphyfsl,usbmiscfsl,anatopRE is too long (code overflow)DISP0_BKLENDISP0_VDDENEHCI failed: timeout when enabling periodic list .callbacks${...}${.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... !read failedWriting to %sMMC(%d)... ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdev Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** ** Cannot support non-zero offset ** ** Error ext4fs_write() ** no block left to assign No Memory %s: Device read error! no block left assign no block left Recovery required File System is consistent file found, deleting Error in ext4fs_log_gdt Please supply Absolute path Invalid path It is a Directory Error in getting the block group descriptor table Failed to iterate over directory %s < ? > %10u %s Invalid input arguments %s ** Can not find directory. ** buffer ptr is NULL _get_node: malloc failed update journal finished Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no inode left to assign error in File System init Unsupported feature metadata_csum found, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. ** Unable to read file %s ** UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2+deb12u1u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s fsl,esdhc/aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p FECFEC%imdio_alloc failed mdio_register failed Can't find FEC0 clk rate: %d Read MDIO failed... Write MDIO failed... Could not initialize PHY %s phy-reset-gpiosphy-reset-durationFEC MXC: phy reset duration should be <= 1000ms phy-reset-post-delayFEC MXC: phy reset post delay should be <= 1000ms %s: error allocating rxbuf %d FEC MXC: Timeout resetting chip Unsupported interface type %d defaulting to MII100 fixed-link%s: error allocating packetp some error: 0x%08lx Payload (%d) too large No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer ///./..MMC Device %d not found mxc_ocotp %s(): Access protect error ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): %s: Missing FDT description in DTB descriptionUnsupported %s address size data-offsetdata-positiondata-sizeentry/imagesalgounknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... Bad Data Hash No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSignCan't get image data/sizeerror! %s in '%s' image node Corrupted or truncated treeUnsupported hash algorithmCan't get hash value propertyCan't get hash algo propertyBad hash valueBad hash value lenuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Jump offset is too bigError: writing directory entry %s: sda=%d scl=%d sda.gp=0x%x scl.gp=0x%x %s: failed to clear bus, sda=%d scl=%d outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to write file %s ** fsl,tuning-stepfsl,tuning-start-tapfsl,strobe-dll-delay-targetfsl,signal-voltage-switch-extra-delay-msfsl,wp-controllercd-gpioswp-gpios%s %s: Unable to get clk for %s MMC/SD: Reset never completed. FSL_SDHC%s %s: fsl_esdhc_init failure Cannot write to locked SD card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! mxc_ocotp %s(): fuse sense is disabled Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %upxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sBase path too long (%s%s) Retrieving file: %s Bank %s: %s%d: %s: %d [%c]%s%s%s.%s%dError: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s Skipping background bmp %s for failure pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drvNo I2C bus selected %s:trigger stop failed %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx clock-frequencyu-boot,i2c-transaction-bytes+,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: fdt fixup event failed: %d - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Could not find script subimage data Wrong image format for "source" command %s %s: wrong pinctrl info fsl,mux_maskfsl,input-sel%s %s: iomuxc fsl,input-sel property not found fsl,pins%s %s: No fsl,pins property in node %s %s %s: Invalid fsl,pins property in node %s %s %s: Error reading pin data. %s %s: Error mux_reg or conf_reg unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateNo MMC card foundNo block deviceMMC partition switch failedMMC partition switch failed load-environmentMMC: Net: %s=%s%d.%d.%d.%d%s: invalid channel %d DI%d counters out of range. DMFC high resolution has set, will not change Warning: channel already enabled %d Warning: channel already initialized %d Missing channel initialization Stride not 32-bit aligned, stride = %d mxc ipu: unimplemented pixel format The value of U offset exceeds IPU limitation The value of V offset exceeds IPU limitation WARNING: v_end_width (lower_margin) must be >= 2, adjusted ipu software reset timeout Channel %d is not disabled, disable first pixclock set for 60Hz refresh = %u ps mxcfb: Error initializing panel. ipu_init_channel_buffer error %d REV_DETECT.dtb./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' Device tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes No CLI availableunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc_blkmmc_bootdevMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd mmc write failed u-boot,mmc-env-partitionu-boot,mmc-env-offsetCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modebus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vStatus Error: 0x%08x Timeout waiting card ready MMC: no card present writing%08lx: %02lx %04lx %08lx ? %08x %0lx %04x #(-27:"/\|?*/configu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-type## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdinstdoutstderreth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,flushExpected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%dregulatorsvrefddrswbstwrite error to device: %p register: %#x! Could not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfigpinctrl-%d%s %s: could not find pctldev regulator-namepfuze100@8PMIC: PFUZE100 ID=0x%02x mxc_ocotp %s(): Invalid argument PORCSUIPP USERWDOGJTAG HIGH-ZJTAG SWWDOG3TEMPSENSEWARM BOOTunknown resetCPU: Freescale i.MX%s rev%d.%d at %d MHz Reset cause: %s fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%sJournal Recovery Completed Journal Scan Completed eMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%spart_offset is %lu total_sector is %llu error: overflow occurs pxeuuidError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 pre-reloc realloc() is not supported^%s$## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d %s=%s HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) Cannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) Badly aligned ext2_dirent stdout-pathNo serial driver foundError get-and-setting cluster Error: no space left: %llu %s: readonly variable%.*s.%.3s~%dWorking FDT set to %lx fdtaddrError compiling regex: %s %s: No match ## error: pattern buffer overflow: have %d, need %d i2c_sda%01di2c_scl%01dBus %d: %s (active %d) %02x: %s, offset len %x, flags %x (effective Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s (T)reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x enable-gpiosUnknown01/01/2023skufamilyproductUnknown Productasset-tagmanufacturersplashpossplashimageError: bad 'splashimage' address nulldevvidconsoleIn: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32536SL6SX6UL6ULL6SOLO6SLL6DP6D6ULZ7S7D8MQ8MD8MQLite8MMQ8MMQL8MMD8MMDL8MMS8MMSL8MNano Quad8MNano Dual8MNano Solo8MNano QuadLite8MNano DualLite8MNano SoloLite8MNano UltraLite Quad8MNano UltraLite Dual8MNano UltraLite Solo8MP[8]8MP[6]8MP Lite[4]8MP Dual[3]8MP UltraLitebmodehdmidetdetect HDMI monitornormalsataecspi1:0ecspi1:1ecspi1:2ecspi1:3esdhc1esdhc2esdhc3esdhc4display clocksmmc0mmc1FWBADAPT-LCD-F07A-0102menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-stdbootmeth_distrou-boot,distro-syslinuxbootmeth_pxeu-boot,distro-pxebootmeth_efiu-boot,distro-efiaslr-moveaslr-randefi-runtime-randrandom-randvbe_simplefwupd,vbe-simplePerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowssourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebmpmanipulate BMP image datainfo - display image info bmp display [x y] - display image at x,ybootefiBoots an EFI payload from memorybootzboot Linux zImage image from memorydcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheclsclear screenconinfoprint console devices and informationecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.fuseFuse sub-systemread [] - read 1 or 'cnt' fuse words, starting at 'word' fuse cmp - compare 'hexval' to fuse at 'word' fuse readm [] - read 1 or 'cnt' fuse words, starting at 'word' into memory at 'addr' fuse sense [] - sense 1 or 'cnt' fuse words, starting at 'word' fuse prog [-y] [...] - program 1 or several fuse words, starting at 'word' (PERMANENT) fuse override [...] - override 1 or several fuse words, starting at 'word'query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsI2C sub-systemcrc32loopmmmwnmprobeolenitestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]memory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperaselisthwpartitionsetdsrcpuMultiprocessor CPU boot manipulation and releaseNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoldisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part types - list supported partition table typespinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] commands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r default-arm-mx6-wandboarddefault-arm-mx6default-armSATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cntsetexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'lcdputsprint string on video framebuffer setcursset cursor position within screen in characterimxtractextract a part of a multi-imagerunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storagemd5sha1sha256crc16-ccittBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsinvmeefiloadervirtiopvblock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiinputoutputunusedfuncgpio_mxcfsl,imx35-gpioi2c-chipi2c_generici2c_mxcfsl,imx21-i2cfsl,vf610-i2cMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcfsl_esdhcfsl,imx51-esdhcfsl,imx53-esdhcfsl,imx6ul-usdhcfsl,imx6sx-usdhcfsl,imx6sl-usdhcfsl,imx6q-usdhcfsl,imx7d-usdhcfsl,imx7ulp-usdhcfsl,imx8qm-usdhcfsl,imx8mm-usdhcfsl,imx8mn-usdhcfsl,imx8mp-usdhcfsl,imx8mq-usdhcfsl,imxrt-usdhcfecmxcfsl,imx28-fecfsl,imx6q-fecfsl,imx6sl-fecfsl,imx6sx-fecfsl,imx6ul-fecfsl,imx53-fecfsl,imx7d-fecfsl,mvf600-fecfsl,imx93-fecGeneric PHYAR8035AR8031/AR8033AR8021pinctrlfsl_imx6q_iomuxcfsl,imx6q-iomuxcfsl,imx6dl-iomuxcfsl,imx6sl-iomuxcfsl,imx6sll-iomuxc-snvsfsl,imx6sll-iomuxcfsl,imx6sx-iomuxcfsl,imx6ul-iomuxcfsl,imx6ull-iomuxc-snvspfuze100 pmicfsl,pfuze100fsl,pfuze200fsl,pfuze3000pfuze100_regulatorLDO_MODE_OFFLDO_MODE_ONSWBST_MODE_OFFSWBST_MODE_PFMSWBST_MODE_AUTOSWBST_MODE_APSOFF_OFFPWM_OFFPFM_OFFAPS_OFFPWM_PWMPWM_APSAPS_APSAPS_PFMPWM_PFMsw1asw1bsw2sw3vsnvsvldo1vldo2vccsdv33vldo3vldo4sw1absw3asw3bvgen1vgen2vgen3vgen4vgen5vgen6sw1csw4serial_mxcfsl,imx21-uartfsl,imx53-uartfsl,imx6sx-uartfsl,imx6ul-uartfsl,imx7d-uartfsl,imx6q-uartdwc_ahsata_ahcifsl,imx6q-ahcibacklightvidconsole0videosimple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51fsl_imx6q_ipufsl,imx6q-ipupixel_clkldb_clkipu_clkthermalutmiutmi_wideulpihsiclow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusperipheralotgusb_dev_genericu-boot,bootdev-usbehci_mx6fsl,imx27-usbfsl,imx7d-usbfsl,imxrt-usbext4unsupportedEFI block driverFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbaseboardchassisseparateembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlan## error: substitution buffer overflow syntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed HUSH_VERSION0.01( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) dr_modephy_typeusb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found lun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx vbecur-versioncur-vernumU-Boot bootloader-versionVersion: %s Vernum: %x/%xU-Boot 2023.01+dfsg-2+deb12u1 (Apr 18 2024 - 22:00:21 +0000)Error: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel ~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666 - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS%;V;Vy%;V;Vfq%;V;Vń% ;V;Vy%@;V;Vy%;V;Vy%;V;Vy%;V;V$0%;V;V %m;V;Vscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr:{5y;V;V{59;V;V5ٛ;V;V5ݜ;V;V[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed]%5;V;V%Ā;V;Vk%e;V;V%iŀ;V;VG%;V;V%;V;V%À;V;V%;V;V%;V;Va%QÀ;V;V,5;V;V% ;V;V %;V;V_%;V;VL%=;V;V@5;V;Va%;V;V5;V;V,5;V;V5};V;V %e;V;V!%E;V;Vk5E;V;V%;V;V 5;V;V5;V;V reset - Reset cpu cpu status - Status of all cpus cpu status - Status of cpu cpu disable - Disable cpu cpu release [args] - Release cpu at with [args]5 ;V;Vk%I;V;V%;V;Vm%;V;V%8%;V;VYo%;V;V9I`naddr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] `n5;V;V 5E;V;V 5e;V;V5A;V;V5;V;V %u;V;Vȵ %e~;V;Vg5;V;V;D 5;V;V#5;V;VPs8 Sw    T   00y11110211>}| 21e}A+2M11y=5100y}l=00BMvW6((H@S $$$''(+++//0333;;;?>@CCCGGIKKKSSS[[[ccclllttt{{{  (**../////./..*)(!"/443/.*('!"'()./444/""24.("  "(/40!*44%  (43)  /4(  +4/ /0 01.2 3) //0. */ / 4%1.)2+/'"*()'. 4/ /4 / */3*4/ .44% (!343% / '4 4//+++- '"01       /   1. .//((/!/1 /44/ )441/4+)4444340"4334431.%+4244441/% /444440(/4/44( 44.!341 4234440.%(.4(!+044444.430"233!*1444440-!/4/+ /4 )" .3 /40 4444/444 )4414144/444#4443344441.444001444/ (4441+/444.%44' *4344/444) 4443344440 *444# 3444..0444%443444*  4444.))144+ (/41'- (0/(+44)  .'13/( (44443444(  44((44( 44%4443"44*/440 -41 044"443" 144( 44/14/44./44- 44./44144. .44/(443443.44/444.  44* "/44*""#4)+)44/% +4444% (4444/044444444444414443"44!*44*-4/44) /44!441 *4444444444) 44. )440 44)*44.+441)44+442)444.44/44) ". /'.(* //4++41.4*-44 *443000144.44*44443"44"144-4144( 44. *44'444111144444/ "44144*441 .44*441443 !444444#44*1)/44*1/"1 34/4/404!44)"44' 44443343"44" *44! .41 .44"44)  44* 44. 44.444..444(  44)-43443 343444/.444*443//344*/4/14*444*/ 1('44*444-4-.4/ (444414/%44"44" '44' +440../143'44'44- *4044%444444441  44)'44%443 043444444441!44044444*()/1/ //"!.43 (4)'4/ )44%4414/44%4442"44" (44% .4444444344(44-44%/40440 %344 44*(44"443144444%144 440+/4+%.) *04. 40%/4("4414"44"44/4.!43"44".44+41 .4*44* #44* 14+44* 44.44.44* /41 144"4424414404441*04 (3 1 44#/444434) )4+*4444/144!43"44"442.4044) 342044!"41""4344.340 44)440(44/ 440443444144( 1 /441 .$)  *44*4444.40 44144) 44444) "43"44!144' +4/44. *44*#44/44314.44.44144)344+ 443 144'441443%444'+ ) !34*/44!444+ *443444444441"43"44.)344-+41" /44*444+%444 *4444* 440 /44/44/)444/(443 /441444/441/443")4+#'.444034/ 344""44*444/4444%44 %444444444(.444444441144411444 44434444444441 444444444) (44432444/4444444443.444413444(. "%(3444"//!*//./!/// /.0" /./././.+% (/.///..((/3440*.//)././//..'0.../.+#.1443/%/..///..' .04440.  0*#.444              */)444-" 0144./ /.44041"/ "344 /!41'%14!. 044& ''43(*+.&34,3 /*144*(*141!4%310+%/44 ). . (43(/ + "34# 44("34"+04,()+( + 4 +)40"""(0/3( . -.13 "43((.44*.. .4" 4 4)'%*&4% 00% ."#//  +/ /',4+  )*" 1*23.(*3. *2- ((..*!4+ 4104' 41+ 0 %+ )14+)+/.")'1/-10 - .++(/ )* 0 .%%' "#(/ "#(/ (')+..1/4-( 0*+4/.-+)/4/ (41(  !'()044" .1 .43 !1 ."!1 *3!#4'14/'14.4 )14 / 044 4044441/#4 ++ 1!' "3(0"14444+1/+ ')(.4 %.  444+. *#3 / /-. '414*%) !* .10/.. /+4./ "(+ - %. / 4**1.0"*.+/44-13/* **0)"/4%/"#3 )4 / 1)1%  .14/ ( 1.-.3/ . )/4  // /02 1(4/D_D_L_L_T_T_\_\_d_d_l_l_t_t_|_|_________________________________`` ` `````$`$`,`,`4`4`<`<`D`D`L`L`T`T`\`\`d`d`l`l`t`t`|`|`````````````````````````````````aa a aaaaa$a$a,a,a4a4a>=SuRQQQUSSuRQQQUS@t@ qQQkyA-{}ymz)  @ @  Ac- 1u       /f…!}y}ʂ;#k…١ߡ塂)顂5;#/BOOTSERVd1a" #!e!'80E4%i+)e42831!7-5-M*]$&A+#12qU9U oooooo<B<5Cy<==ooQ<<A<9><;;=;;pPP2XXpXp`p`phphp1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@^ }%}рӓ{%{;V9{5B{f{m5*;V{%{ |Yo%y;Vy%y;Vp|5x|t~ 51~~z Ez0QG % yDx%Y~楅4~5ե;~Z~| %|-n %}7%n;V}%Q};V$%ҀÔ}%a};V%Հ攅 %!%р^s|%||%i楅k %餀}}5e. %巅>%!;VЁ5Mف%[ /-5#6^%1 /5(%?2V %L%Tw>5wFmՄ% ۄ%ɂ!%'55i5騀ń5p%3wH%7P;Vۍ 5i$0 %x)xK5I;Wm%e+m;Vz % z,z%ݻ㐅2}%9}]}x %xx% 5ǀ<!% )K%%5ԁ5$N5ˀT5ʀl5ˀ5ˀ%aҀJ% щG%Ѐŕ+%I܀0F%ր핅%Հs%Q؟矅5%=Հ+)%Ra%q楅%+ՀRsz%%zz! %Ϧ%q %M %u3w% %y;V5р._5wwȵ %e~̵m%Ueg5 l*52;VX%y ` 5:Te5mc %k5%߀%Cz5{V|%Y %̱E%aN楅s %xF…%&5%z%9z;VYM@vn7wؐMqwȐ qj܎m%m m$-DlБ`w…%##y^}'laq  C=06T`O#E#dxĖKmL8.4Ӂԁeԁ=4e2D0\wMlM|Ad\ (웄 _S㾅Ư%Pe;$Act],A-Kd̔KaKK̠΅<yPm.υu!v\ 1>lZ83…tTm ΅|w䔄1 0z>PlDE+-}k@ZmH`uH`vu]Haƅmk|Haƅk`EɅݣ횁@q0LRʄbQf vbRw%)'XQ[1YeXK.ˁ́́2ՁՁ؁ځY4CGGKMM _S.T쾅Uc#6bcY)U)KdUǁ pF…tr%y@ $…u!voN%yD@ $1>zAAx9?@4p0PpH`dLP    $(,048`dh x|lpt  lptx|$Ltt x |          H!L!$$($,$$$%%%%%%%%%|***+ +$+X+\+`+-/142`223 4D4d44x555t7888888999 99999 9$9(9,9::p;;;;<H<L<P<<<\=t====>>>>>>>>>>>>>>>>>?????X@\@`@@ADAHALAPATAXADD D$D,D0D4D8D>>>8???DAHA$B(B,B0BxC|CCCCCCCCCCHELEPETEXE\E`EETJ\JKKhL OOOO$O(O4OPQ QLQdQhQlQSSSTTTTTTUUU U@VDVHVLVXV\V`VdVhVlVWXX XXX X$X(XXXhZ8^@^H^L^_ ``aacccccccc@dDdHdLdPdTddddddeeee f$f(fggPi\ijjTmXm\m`mdmtmprr rprtrrrrr$tuwwwwwwwxxx yyyyy yhz{|D||} ȂЂ Ԉ؈܈X\`dlpt@x쒂p蓂lptx|,048<\`ėȗ@$`̚К p,048<ȝ̝Нԝܝ䝂 $(TX\`(,04ԟ؟ܟ048<@ СԡHĢȢ $(,0Hh죂HLԤؤ|̥DDHLPTX\`dhlptx|ĩt誂쪂txЫ<ptĮT챂кԺغܺ(࿂係迂쿂 ‚‚‚‚‚ÂÂÂ ÂÂÂÂÂ8ł<ł@łDłHłLłPłTłXł$Ƃ(ƂȂȂȂȂȂɂɂɂʂXʂ\ʂ`ʂdʂhʂlʂpʂtʂxʂʂʂ̂̂̂̂̂͂΂΂΂DςHςςЂ ЂHЂ$т(тт҂pԂtԂՂՂՂՂՂd؂h؂l؂p؂t؂ۂۂL݂P݂LLPlptx<@Dhl| $(,DHPTx,048,048`dhl`plp PTXlp               08<@DHLPTX|,,04<@D x|,LXp `P (!,!T""<#P$X$%%&''(())))* ,X/1333384`467 77778999: :::::::::::4;8;;;;;;;;4<<<p<t<===,>|>>??????H@di0_plldi1_plldi0_seldi1_seldi2_seldi3_seldi0di1lvds-channel@0J 0disabledport@0JendpointN^Qport@1JendpointN^Uport@2JendpointN^[port@3JendpointN^_lvds-channel@1J 0disabledport@0JendpointN^Rport@1JendpointN^Vport@2JendpointN ^\port@3JendpointN ^`pmu!arm,cortex-a9-pmuf  w^usbphynop1!usb-nop-xceiv^*usbphynop2!usb-nop-xceiv^+soc !simple-busf dma-apbh@110000&!fsl,imx6q-dma-apbhfsl,imx28-dma-apbhJ 0w    gpmi0gpmi1gpmi2gpmi37j^ nand-controller@112000!fsl,imx6q-gpmi-nandJ @ gpmi-nandbch wbch(70>gpmi_iogpmi_apbgpmi_bchgpmi_bch_apbper1_bch rx-tx 0disabledhdmi@120000J ws,7{| >iahbisfr0okay!fsl,imx6q-hdmi portsport@0JendpointN^Oport@1JendpointN^Sport@2JendpointN^Yport@3JendpointN^]gpu@130000 !vivante,gcJ@ w 7zJ>buscoreshadergpu@134000 !vivante,gcJ@@ w 7y >buscoretimer@a00600!arm,cortex-a9-twd-timerJ  w f7interrupt-controller@a01000!arm,cortex-a9-gic 1Jf^cache-controller@a02000!arm,pl310-cacheJ  w\FT ` p^apcie@1ffc000!fsl,imx6q-pcieJ@ dbiconfigpci0 wxmsi  { z y x7>pciepcie_buspcie_phy 0disabledbus@2000000!fsl,aips-bussimple-busJspba-bus@2000000!fsl,spba-bussimple-busJspdif@2004000!fsl,imx35-spdifJ@@ w4 rxtxP7kv>:>corerxtx0rxtx1rxtx2rxtx3rxtx4rxtx5rxtx6rxtx7spba0okaydefault^ospi@2008000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w7pp>ipgper rxtx 0disabledspi@200c000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w 7qq>ipgper rxtx 0disabledspi@2010000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w!7rr>ipgper rxtx 0disabledspi@2014000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@@ w"7ss>ipgper   rxtx 0disabledserial@2020000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx0okaydefaultesai@2024000!fsl,imx35-esaiJ@@ w3(7v>corememextalfsysspba rxtx 0disabledssi@2028000!fsl,imx6q-ssifsl,imx51-ssiJ@ w.7 >ipgbaud %&rxtx0okay^mssi@202c000!fsl,imx6q-ssifsl,imx51-ssiJ@ w/7 >ipgbaud )*rxtx 0disabledssi@2030000!fsl,imx6q-ssifsl,imx51-ssiJ@ w07 >ipgbaud -.rxtx 0disabledasrc@2034000!fsl,imx53-asrcJ@@ w27k>memipgasrck_0asrck_1asrck_2asrck_3asrck_4asrck_5asrck_6asrck_7asrck_8asrck_9asrck_aasrck_basrck_casrck_dasrck_easrck_fspba`rxarxbrxctxatxbtxc0okayspba-bus@203c000J@spi@2018000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w#7tt>ipgper   rxtx 0disabledvpu@2040000!fsl,imx6q-vpucnm,coda960Jw  bitjpeg7>perahb+2aipstz@207c000J@pwm@20800007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wS7>>ipgper 0disabledpwm@20840007!fsl,imx6q-pwmfsl,imx27-pwmJ@@ wT7>>ipgper 0disabledpwm@20880007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wU7>>ipgper 0disabledpwm@208c0007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wV7>>ipgper 0disabledcan@2090000!fsl,imx6q-flexcanJ @ wn7lm>ipgper B4 0disabledcan@2094000!fsl,imx6q-flexcanJ @@ wo7no>ipgper B4 0disabledtimer@2098000!fsl,imx6q-gptfsl,imx31-gptJ @ w77wx>ipgperosc_pergpio@209c000!fsl,imx6q-gpiofsl,imx35-gpioJ @wBCP`1 l   t ^1gpio@20a0000!fsl,imx6q-gpiofsl,imx35-gpioJ @wDEP`1 @l7#,gpio@20a4000!fsl,imx6q-gpiofsl,imx35-gpioJ @@wFGP`1 0lE$-^.gpio@20a8000!fsl,imx6q-gpiofsl,imx35-gpioJ @wHIP`1 0l~ W^8gpio@20ac000!fsl,imx6q-gpiofsl,imx35-gpioJ @wJKP`1 PlU"5g gpio@20b0000!fsl,imx6q-gpiofsl,imx35-gpioJ @wLMP`1 pl6 Vgpio@20b4000!fsl,imx6q-gpiofsl,imx35-gpioJ @@wNOP`1 0l   ^qkeypad@20b8000!fsl,imx6q-kppfsl,imx21-kppJ @ wR7> 0disabledwatchdog@20bc000!fsl,imx6q-wdtfsl,imx21-wdtJ @ wP7>watchdog@20c0000!fsl,imx6q-wdtfsl,imx21-wdtJ @ wQ7> 0disabledclock-controller@20c4000!fsl,imx6q-ccmJ @@wWX^anatop@20c8000#!fsl,imx6q-anatopsysconsimple-mfdJ $w16^regulator-1p1!fsl,anatop-regulatorxvdd1p1B@O 5-@regulator-3p0!fsl,anatop-regulatorxvdd3p0*0 ( -3@@regulator-2p5!fsl,anatop-regulatorxvdd2p5"U)00 -+x@regulator-vddcore!fsl,anatop-regulatorxvddarm  @Rpj - ^bregulator-vddpu!fsl,anatop-regulatorxvddpu  |@ Rpj - ^regulator-vddsoc!fsl,anatop-regulatorxvddsoc  @Rpj - ^ctempmon!fsl,imx6q-tempmonf  w1calibtemp_grade7usbphy@20c9000"!fsl,imx6q-usbphyfsl,imx23-usbphyJ  w,7^%usbphy@20ca000"!fsl,imx6q-usbphyfsl,imx23-usbphyJ  w-7^)snvs@20cc000#!fsl,sec-v4.0-monsysconsimple-mfdJ @^snvs-rtc-lp!fsl,sec-v4.0-mon-rtc-lp4wsnvs-poweroff!syscon-poweroff8`` 0disabledsnvs-powerkey!fsl,sec-v4.0-pwrkey w t 0disabledsnvs-lpgpr!fsl,imx6q-snvs-lpgprepit@20d0000J @ w8epit@20d4000J @@ w9reset-controller@20d8000!fsl,imx6q-srcfsl,imx51-srcJ @w[`'^gpc@20dc000!fsl,imx6q-gpcJ @1  wYf7>>ipg^ pgcpower-domain@0J4power-domain@1J4H07zJy^iomuxc-gpr@20e0000'!fsl,imx6q-iomuxc-gprsysconsimple-mfdJ8^mux-controller !mmio-muxU8h (( ^ipu1_csi0_mux !video-muxvport@0JendpointN ^Cport@1Jendpointport@2JendpointN!^Mipu2_csi1_mux !video-muxvport@0JendpointN"^Fport@1Jendpointport@2JendpointN#^Xpinctrl@20e0000!fsl,imx6q-iomuxcJ@default$^imx6qdl-wandboardaudmuxgrp`tD0h80l<p@0^Benetgrph@Xl0\p0`t0dx0h|0t0D0pH0xL0|P0T0lX0^,i2c1grp0@@^4i2c1gpiogrp0@@^5i2c2grp0@@^6i2c2gpiogrp0@@^7mclkgrp 0^9ov5645grpH,0^<spdifgrpT$^uart1grp0PT ^uart3grp` 0 ,^Lusbotggrp$ pY^(usbotgvbusgrp0^pusdhc1grpH0pYP8Y@(pY<$pYL4pYD,pY^0usdhc2grpX@pYT<YThpYL`pYPdpY\DpY^2usdhc3grppYYpYpYpYpY^3hoggrpH48L^$i2c3grp0< @H@^Adcic@20e4000J@@ w|dcic@20e8000J@ w}sdma@20ec000!fsl,imx6q-sdmafsl,imx35-sdmaJ@ w7>>ipgahbimx/sdma/sdma-imx6q.bin^bus@2100000!fsl,aips-bussimple-busJcrypto@2100000 !fsl,sec-v4.0J  7>memaclkipgemi_slowjr@1000!fsl,sec-v4.0-job-ringJ wijr@2000!fsl,sec-v4.0-job-ringJ  wjaipstz@217c000J@usb@2184000!fsl,imx6q-usbfsl,imx27-usbJ@ w+7%&0okay'default(otgusb@2184200!fsl,imx6q-usbfsl,imx27-usbJB w(7)&host0okayusb@2184400!fsl,imx6q-usbfsl,imx27-usbJD w)7*hsic&host 0disabledusb@2184600!fsl,imx6q-usbfsl,imx27-usbJF w*7+hsic&host 0disabledusbmisc@2184800'!fsl,imx6q-usbmiscJH7^&ethernet@2188000!fsl,imx6q-fecJ@ int0ppswvw 7uu>ipgahbptpenet_out B40okaydefault, 4rgmii-id=- H.X/mdioethernet-phy@1JcsY@^-mlb@218c000J@$w5u~mmc@2190000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery0okaydefault0 1mmc@2194000!fsl,imx6q-usdhcJ@@ w7 >ipgahbpery0okaydefault2mmc@2198000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery0okaydefault3 . mmc@219c000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery 0disabledi2c@21a0000!fsl,imx6q-i2cfsl,imx21-i2cJ@ w$7}0okay defaultgpio45 . .i2c@21a4000!fsl,imx6q-i2cfsl,imx21-i2cJ@@ w%7~0okay defaultgpio67 8  8 ^ sgtl5000@adefault9 !fsl,sgtl5000J 7:;^ncamera@3c !ovti,ov5645default<J<7>xclkn6=>? 1 L8portendpointN@'^Gi2c@21a8000!fsl,imx6q-i2cfsl,imx21-i2cJ@ w&70okaydefaultApfuze100@8 !fsl,pfuze100Jregulatorssw1ab82Djsw1c82Djsw2 52Z2Djsw3a"2sw3b"2sw4 52ZswbstLK@N0vsnvsB@-2vrefddr2vgen1 5vgen2``2vgen3w@2Zvgen4w@2Zvgen5w@2Zvgen6w@2Zromcp@21ac000J@memory-controller@21b0000!fsl,imx6q-mmdcJ@7memory-controller@21b4000!fsl,imx6q-mmdcJ@@ 0disabledweim@21b8000!fsl,imx6q-weimJ@ w7Y 0disabledefuse@21bc000!fsl,imx6q-ocotpsysconJ@7speed-grade@10J^dcalib@38J8^temp-grade@20J ^tzasc@21d0000J@ wltzasc@21d4000J@@ wmaudmux@21d8000"!fsl,imx6q-audmuxfsl,imx31-audmuxJ@0okaydefaultBmipi@21dc000!fsl,imx6-mipi-csi2J@wde7a >dphyrefpix0okayport@1JendpointNC^ port@2JendpointND^Nport@3JendpointNE^Wport@4JendpointNF^"port@0JendpointNG'^@mipi@21e0000J@ 0disabledportsport@0JendpointNH^Pport@1JendpointNI^Tport@2JendpointNJ^Zport@3JendpointNK^^vdoa@21e4000!fsl,imx6q-vdoaJ@@ w7serial@21e8000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx 0disabledserial@21ec000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx0okaydefaultLiserial@21f0000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper  rxtx 0disabledserial@21f4000!fsl,imx6q-uartfsl,imx21-uartJ@@ w7>ipgper !"rxtx 0disabledipu@2400000!fsl,imx6q-ipuJ@@w7 >busdi0di1+port@0J^eendpointNM^!port@1J^fendpointNN^Dport@2J^iendpoint@0Jendpoint@1JNO^endpoint@2JNP^Hendpoint@3JNQ^endpoint@4JNR^port@3J^jendpoint@0Jendpoint@1JNS^endpoint@2JNT^Iendpoint@3JNU^endpoint@4JNV^sram@900000 !mmio-sramJ7^sata@2200000!fsl,imx6q-ahciJ @ w'7i>satasata_refahb0okaygpu@2204000 !vivante,gcJ @@ w 7y >buscoreipu@2800000!fsl,imx6q-ipuJ@w7 >busdi0di1+port@0J^gendpointNW^Eport@1J^hendpointNX^#port@2J^kendpoint@0Jendpoint@1JNY^endpoint@2JNZ^Jendpoint@3JN[^endpoint@4JN\^ port@3J^lendpoint@1JN]^endpoint@2JN^^Kendpoint@3JN_^endpoint@4JN`^ cpuscpu@0!arm,cortex-a9cpuJya(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysbcd speed_gradecpu@1!arm,cortex-a9cpuJya(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysbccpu@2!arm,cortex-a9cpuJya(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysbccpu@3!arm,cortex-a9cpuJya(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysbccapture-subsystem!fsl,imx-capture-subsystemefghdisplay-subsystem!fsl,imx-display-subsystemijklsound3!fsl,imx6-wandboard-sgtl5000fsl,imx-audio-sgtl5000imx6-wandboard-sgtl5000mn8MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUTsound-spdif!fsl,imx-audio-spdif imx-spdif+o<regulator-1p5v!regulator-fixedx1P5V``^?regulator-1p8v!regulator-fixedx1P8Vw@w@^=regulator-2p8v!regulator-fixedx2P8V**^>regulator-2p5v!regulator-fixedx2P5V&%&%^:regulator-3p3v!regulator-fixedx3P3V2Z2Z^;regulator-usbotgvbus!regulator-fixed xusb_otg_vbusLK@LK@defaultp F.^'regulator-eth-phy!regulator-fixedxETH_PHY2Z2Z Fq ^/memory@10000000memoryJ #address-cells#size-cellsmodelcompatiblestdout-pathethernet0can0can1gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2spi3usb0usb1usb2usb3usbphy0usbphy1ipu1spi4video0#clock-cellsclock-frequencygprstatusclocksclock-namesregremote-endpointphandleinterrupt-parentinterrupts#phy-cellsrangesu-boot,dm-splu-boot,dm-pre-relocinterrupt-names#dma-cellsdma-channelsreg-namesdmasdma-namesddc-i2c-buspower-domains#cooling-cells#interrupt-cellsinterrupt-controllercache-unifiedcache-levelarm,tag-latencyarm,data-latencyarm,shared-overridedevice_typebus-rangenum-lanesinterrupt-map-maskinterrupt-mappinctrl-namespinctrl-0#sound-dai-cellsfsl,fifo-depthfsl,asrc-ratefsl,asrc-widthresetsiram#pwm-cellsfsl,stop-modegpio-controller#gpio-cellsgpio-rangesregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onanatop-reg-offsetanatop-vol-bit-shiftanatop-vol-bit-widthanatop-min-bit-valanatop-min-voltageanatop-max-voltageanatop-enable-bitanatop-delay-reg-offsetanatop-delay-bit-shiftanatop-delay-bit-widthregulator-enable-ramp-delayfsl,tempmonnvmem-cellsnvmem-cell-names#thermal-sensor-cellsfsl,anatopregmapvaluelinux,keycodewakeup-source#reset-cells#power-domain-cellspower-supply#mux-control-cellsmux-reg-masksmux-controlsfsl,pinsfsl,sdma-ram-script-namefsl,usbphyfsl,usbmiscahb-burst-configtx-burst-size-dwordrx-burst-size-dwordvbus-supplydisable-over-currentdr_modephy_type#index-cellsphy-modephy-handlephy-reset-gpiosphy-supplyqca,clk-out-frequencybus-widthcd-gpiosno-1-8-vnon-removablepinctrl-1scl-gpiossda-gpiosVDDA-supplyVDDIO-supplylrclk-strengthvdddo-supplyvdda-supplyvddd-supplyenable-gpiosclock-lanesdata-lanesregulator-boot-onregulator-ramp-delayfsl,weim-cs-gpruart-has-rtsctsnext-level-cacheoperating-pointsfsl,soc-operating-pointsclock-latencyarm-supplypu-supplysoc-supplyportsssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-portspdif-controllerspdif-outgpio x8(e%Wandboard i.MX6 QuadPlus Board revD1!!wand,imx6qp-wandboardfsl,imx6qpchosen1,/soc/bus@2000000/spba-bus@2000000/serial@2020000aliases"8/soc/bus@2100000/ethernet@2188000B/soc/bus@2000000/can@2090000G/soc/bus@2000000/can@2094000L/soc/bus@2000000/gpio@209c000R/soc/bus@2000000/gpio@20a0000X/soc/bus@2000000/gpio@20a4000^/soc/bus@2000000/gpio@20a8000d/soc/bus@2000000/gpio@20ac000j/soc/bus@2000000/gpio@20b0000p/soc/bus@2000000/gpio@20b4000v/soc/bus@2100000/i2c@21a0000{/soc/bus@2100000/i2c@21a4000/soc/bus@2100000/i2c@21a8000/soc/ipu@2400000/soc/bus@2100000/mmc@2198000/soc/bus@2100000/mmc@2194000/soc/bus@2100000/mmc@2198000/soc/bus@2100000/mmc@219c0001/soc/bus@2000000/spba-bus@2000000/serial@2020000 /soc/bus@2100000/serial@21e8000 /soc/bus@2100000/serial@21ec000 /soc/bus@2100000/serial@21f0000 /soc/bus@2100000/serial@21f4000./soc/bus@2000000/spba-bus@2000000/spi@2008000./soc/bus@2000000/spba-bus@2000000/spi@200c000./soc/bus@2000000/spba-bus@2000000/spi@2010000./soc/bus@2000000/spba-bus@2000000/spi@2014000/soc/bus@2100000/usb@2184000/soc/bus@2100000/usb@2184200/soc/bus@2100000/usb@2184400/soc/bus@2100000/usb@2184600 /soc/bus@2000000/usbphy@20c9000 /soc/bus@2000000/usbphy@20ca000/soc/ipu@2800000./soc/bus@2000000/spba-bus@2000000/spi@2018000/soc/ipu@2400000clocksckil !fixed-clockckih1 !fixed-clockosc !fixed-clockn6ldb!fsl,imx6q-ldbfsl,imx53-ldb, 0disabled@7!"'()*MN8>di0_plldi1_plldi0_seldi1_seldi2_seldi3_seldi0di1lvds-channel@0J 0disabledport@0JendpointN^Xport@1JendpointN^\port@2JendpointN^cport@3JendpointN^glvds-channel@1J 0disabledport@0JendpointN^Yport@1JendpointN^]port@2JendpointN ^dport@3JendpointN ^hpmu!arm,cortex-a9-pmuf  w^usbphynop1!usb-nop-xceiv^*usbphynop2!usb-nop-xceiv^+soc !simple-busf dma-apbh@110000&!fsl,imx6q-dma-apbhfsl,imx28-dma-apbhJ 0w    gpmi0gpmi1gpmi2gpmi37j^ nand-controller@112000!fsl,imx6q-gpmi-nandJ @ gpmi-nandbch wbch(70>gpmi_iogpmi_apbgpmi_bchgpmi_bch_apbper1_bch rx-tx 0disabledhdmi@120000J ws,7{| >iahbisfr0okay!fsl,imx6q-hdmi portsport@0JendpointN^Vport@1JendpointN^Zport@2JendpointN^aport@3JendpointN^egpu@130000 !vivante,gcJ@ w 7zJ>buscoreshadergpu@134000 !vivante,gcJ@@ w 7y >buscoretimer@a00600!arm,cortex-a9-twd-timerJ  w f7interrupt-controller@a01000!arm,cortex-a9-gic 1Jf^cache-controller@a02000!arm,pl310-cacheJ  w\FT ` p^ipcie@1ffc000!fsl,imx6qp-pcieJ@ dbiconfigpci0 wxmsi  { z y x7>pciepcie_buspcie_phy 0disabledbus@2000000!fsl,aips-bussimple-busJspba-bus@2000000!fsl,spba-bussimple-busJspdif@2004000!fsl,imx35-spdifJ@@ w4 rxtxP7kv>:>corerxtx0rxtx1rxtx2rxtx3rxtx4rxtx5rxtx6rxtx7spba0okaydefault^wspi@2008000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w7pp>ipgper rxtx 0disabledspi@200c000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w 7qq>ipgper rxtx 0disabledspi@2010000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w!7rr>ipgper rxtx 0disabledspi@2014000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@@ w"7ss>ipgper   rxtx 0disabledserial@2020000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx0okaydefaultesai@2024000!fsl,imx35-esaiJ@@ w3(7v>corememextalfsysspba rxtx 0disabledssi@2028000!fsl,imx6q-ssifsl,imx51-ssiJ@ w.7 >ipgbaud %&rxtx0okay^ussi@202c000!fsl,imx6q-ssifsl,imx51-ssiJ@ w/7 >ipgbaud )*rxtx 0disabledssi@2030000!fsl,imx6q-ssifsl,imx51-ssiJ@ w07 >ipgbaud -.rxtx 0disabledasrc@2034000!fsl,imx53-asrcJ@@ w27k>memipgasrck_0asrck_1asrck_2asrck_3asrck_4asrck_5asrck_6asrck_7asrck_8asrck_9asrck_aasrck_basrck_casrck_dasrck_easrck_fspba`rxarxbrxctxatxbtxc0okayspba-bus@203c000J@spi@2018000 !fsl,imx6q-ecspifsl,imx51-ecspiJ@ w#7tt>ipgper   rxtx 0disabledvpu@2040000!fsl,imx6q-vpucnm,coda960Jw  bitjpeg7>perahb+2aipstz@207c000J@pwm@20800007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wS7>>ipgper 0disabledpwm@20840007!fsl,imx6q-pwmfsl,imx27-pwmJ@@ wT7>>ipgper 0disabledpwm@20880007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wU7>>ipgper 0disabledpwm@208c0007!fsl,imx6q-pwmfsl,imx27-pwmJ@ wV7>>ipgper 0disabledcan@2090000!fsl,imx6q-flexcanJ @ wn7lm>ipgper B4 0disabledcan@2094000!fsl,imx6q-flexcanJ @@ wo7no>ipgper B4 0disabledtimer@2098000!fsl,imx6q-gptfsl,imx31-gptJ @ w77wx>ipgperosc_pergpio@209c000!fsl,imx6q-gpiofsl,imx35-gpioJ @wBCP`1 l   t ^1gpio@20a0000!fsl,imx6q-gpiofsl,imx35-gpioJ @wDEP`1 @l7#,gpio@20a4000!fsl,imx6q-gpiofsl,imx35-gpioJ @@wFGP`1 0lE$-^.gpio@20a8000!fsl,imx6q-gpiofsl,imx35-gpioJ @wHIP`1 0l~ W^8gpio@20ac000!fsl,imx6q-gpiofsl,imx35-gpioJ @wJKP`1 PlU"5g gpio@20b0000!fsl,imx6q-gpiofsl,imx35-gpioJ @wLMP`1 pl6 Vgpio@20b4000!fsl,imx6q-gpiofsl,imx35-gpioJ @@wNOP`1 0l   ^ykeypad@20b8000!fsl,imx6q-kppfsl,imx21-kppJ @ wR7> 0disabledwatchdog@20bc000!fsl,imx6q-wdtfsl,imx21-wdtJ @ wP7>watchdog@20c0000!fsl,imx6q-wdtfsl,imx21-wdtJ @ wQ7> 0disabledclock-controller@20c4000!fsl,imx6q-ccmJ @@wWX^anatop@20c8000#!fsl,imx6q-anatopsysconsimple-mfdJ $w16^regulator-1p1!fsl,anatop-regulatorxvdd1p1B@O 5-@regulator-3p0!fsl,anatop-regulatorxvdd3p0*0 ( -3@@regulator-2p5!fsl,anatop-regulatorxvdd2p5"U)00 -+x@regulator-vddcore!fsl,anatop-regulatorxvddarm  @Rpj - ^jregulator-vddpu!fsl,anatop-regulatorxvddpu  |@ Rpj - ^regulator-vddsoc!fsl,anatop-regulatorxvddsoc  @Rpj - ^ktempmon!fsl,imx6q-tempmonf  w1calibtemp_grade7usbphy@20c9000"!fsl,imx6q-usbphyfsl,imx23-usbphyJ  w,7^%usbphy@20ca000"!fsl,imx6q-usbphyfsl,imx23-usbphyJ  w-7^)snvs@20cc000#!fsl,sec-v4.0-monsysconsimple-mfdJ @^snvs-rtc-lp!fsl,sec-v4.0-mon-rtc-lp4wsnvs-poweroff!syscon-poweroff8`` 0disabledsnvs-powerkey!fsl,sec-v4.0-pwrkey w t 0disabledsnvs-lpgpr!fsl,imx6q-snvs-lpgprepit@20d0000J @ w8epit@20d4000J @@ w9reset-controller@20d8000!fsl,imx6q-srcfsl,imx51-srcJ @w[`'^gpc@20dc000!fsl,imx6qp-gpcfsl,imx6q-gpcJ @1  wYf7>>ipg^ pgcpower-domain@0J4power-domain@1J4H07zJy^iomuxc-gpr@20e0000'!fsl,imx6q-iomuxc-gprsysconsimple-mfdJ8^mux-controller !mmio-muxU8h (( ^ipu1_csi0_mux !video-muxvport@0JendpointN ^Cport@1Jendpointport@2JendpointN!^Tipu2_csi1_mux !video-muxvport@0JendpointN"^Fport@1Jendpointport@2JendpointN#^`pinctrl@20e0000!fsl,imx6q-iomuxcJ@default$^imx6qdl-wandboardaudmuxgrp`tD0h80l<p@0^Benetgrph@Xl0\p0`t0dx0h|0t0D0pH0xL0|P0T0lX0^,i2c1grp0@@^4i2c1gpiogrp0@@^5i2c2grp0@@^6i2c2gpiogrp0@@^7mclkgrp 0^9ov5645grpH,0^<spdifgrpT$^uart1grp0PT ^uart3grp` 0 ,^Lusbotggrp$ pY^(usbotgvbusgrp0^xusdhc1grpH0pYP8Y@(pY<$pYL4pYD,pY^0usdhc2grpX@pYT<YThpYL`pYPdpY\DpY^2usdhc3grppYYpYpYpYpY^3hoggrpH48L^$i2c3grp0< @H@^Adcic@20e4000J@@ w|dcic@20e8000J@ w}sdma@20ec000!fsl,imx6q-sdmafsl,imx35-sdmaJ@ w7>>ipgahbimx/sdma/sdma-imx6q.bin^bus@2100000!fsl,aips-bussimple-busJcrypto@2100000 !fsl,sec-v4.0J  7>memaclkipgemi_slowjr@1000!fsl,sec-v4.0-job-ringJ wijr@2000!fsl,sec-v4.0-job-ringJ  wjaipstz@217c000J@usb@2184000!fsl,imx6q-usbfsl,imx27-usbJ@ w+7%&0okay'default(otgusb@2184200!fsl,imx6q-usbfsl,imx27-usbJB w(7)&host0okayusb@2184400!fsl,imx6q-usbfsl,imx27-usbJD w)7*hsic&host 0disabledusb@2184600!fsl,imx6q-usbfsl,imx27-usbJF w*7+hsic&host 0disabledusbmisc@2184800'!fsl,imx6q-usbmiscJH7^&ethernet@2188000!fsl,imx6q-fecJ@ int0ppswvw 7uu>ipgahbptpenet_out B40okaydefault, 4rgmii-id=- H.X/mdioethernet-phy@1JcsY@^-mlb@218c000J@$w5u~mmc@2190000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery0okaydefault0 1mmc@2194000!fsl,imx6q-usdhcJ@@ w7 >ipgahbpery0okaydefault2mmc@2198000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery0okaydefault3 . mmc@219c000!fsl,imx6q-usdhcJ@ w7 >ipgahbpery 0disabledi2c@21a0000!fsl,imx6q-i2cfsl,imx21-i2cJ@ w$7}0okay defaultgpio45 . .i2c@21a4000!fsl,imx6q-i2cfsl,imx21-i2cJ@@ w%7~0okay defaultgpio67 8  8 ^ sgtl5000@adefault9 !fsl,sgtl5000J 7:;^vcamera@3c !ovti,ov5645default<J<7>xclkn6=>? 1 L8portendpointN@'^Gi2c@21a8000!fsl,imx6q-i2cfsl,imx21-i2cJ@ w&70okaydefaultApfuze100@8 !fsl,pfuze100Jregulatorssw1ab82Djsw1c82Djsw2 52Z2Djsw3a"2sw3b"2sw4 52ZswbstLK@N0vsnvsB@-2vrefddr2vgen1 5vgen2``2vgen3w@2Zvgen4w@2Zvgen5w@2Zvgen6w@2Zromcp@21ac000J@memory-controller@21b0000!fsl,imx6qp-mmdcfsl,imx6q-mmdcJ@7memory-controller@21b4000!fsl,imx6q-mmdcJ@@ 0disabledweim@21b8000!fsl,imx6q-weimJ@ w7Y 0disabledefuse@21bc000!fsl,imx6q-ocotpsysconJ@7speed-grade@10J^lcalib@38J8^temp-grade@20J ^tzasc@21d0000J@ wltzasc@21d4000J@@ wmaudmux@21d8000"!fsl,imx6q-audmuxfsl,imx31-audmuxJ@0okaydefaultBmipi@21dc000!fsl,imx6-mipi-csi2J@wde7a >dphyrefpix0okayport@1JendpointNC^ port@2JendpointND^Uport@3JendpointNE^_port@4JendpointNF^"port@0JendpointNG'^@mipi@21e0000J@ 0disabledportsport@0JendpointNH^Wport@1JendpointNI^[port@2JendpointNJ^bport@3JendpointNK^fvdoa@21e4000!fsl,imx6q-vdoaJ@@ w7serial@21e8000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx 0disabledserial@21ec000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper rxtx0okaydefaultLiserial@21f0000!fsl,imx6q-uartfsl,imx21-uartJ@ w7>ipgper  rxtx 0disabledserial@21f4000!fsl,imx6q-uartfsl,imx21-uartJ@@ w7>ipgper !"rxtx 0disabledpre@21c8000!fsl,imx6qp-preJ wZ7>axiyM^Opre@21c9000!fsl,imx6qp-preJ wa7>axiyM^Ppre@21ca000!fsl,imx6qp-preJ wb7>axiyN^Qpre@21cb000!fsl,imx6qp-preJ wc7>axiyN^Rprg@21cc000!fsl,imx6qp-prgJ7>ipgaxi OPQ^Sprg@21cd000!fsl,imx6qp-prgJ7>ipgaxi RPQ^^ipu@2400000!fsl,imx6qp-ipufsl,imx6q-ipuJ@@w7 >busdi0di1+Sport@0J^mendpointNT^!port@1J^nendpointNU^Dport@2J^qendpoint@0Jendpoint@1JNV^endpoint@2JNW^Hendpoint@3JNX^endpoint@4JNY^port@3J^rendpoint@0Jendpoint@1JNZ^endpoint@2JN[^Iendpoint@3JN\^endpoint@4JN]^sram@900000 !mmio-sramJ7^sata@2200000!fsl,imx6q-ahciJ @ w'7i>satasata_refahb0okaygpu@2204000 !vivante,gcJ @@ w 7y >buscoreipu@2800000!fsl,imx6qp-ipufsl,imx6q-ipuJ@w7 >busdi0di1+^port@0J^oendpointN_^Eport@1J^pendpointN`^#port@2J^sendpoint@0Jendpoint@1JNa^endpoint@2JNb^Jendpoint@3JNc^endpoint@4JNd^ port@3J^tendpoint@1JNe^endpoint@2JNf^Kendpoint@3JNg^endpoint@4JNh^ sram@940000 !mmio-sramJ7^Msram@960000 !mmio-sramJ7^Ncpuscpu@0!arm,cortex-a9cpuJi(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysjkl speed_gradecpu@1!arm,cortex-a9cpuJi(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysjkcpu@2!arm,cortex-a9cpuJi(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysjkcpu@3!arm,cortex-a9cpuJi(Otx2   (Otx2   l(7h)>armpll2_pfd2_396msteppll1_swpll1_sysjkcapture-subsystem!fsl,imx-capture-subsystemmnopdisplay-subsystem!fsl,imx-display-subsystemqrstsound3!fsl,imx6-wandboard-sgtl5000fsl,imx-audio-sgtl5000imx6-wandboard-sgtl5000uv8MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUT+8sound-spdif!fsl,imx-audio-spdif imx-spdifEwVregulator-1p5v!regulator-fixedx1P5V``^?regulator-1p8v!regulator-fixedx1P8Vw@w@^=regulator-2p8v!regulator-fixedx2P8V**^>regulator-2p5v!regulator-fixedx2P5V&%&%^:regulator-3p3v!regulator-fixedx3P3V2Z2Z^;regulator-usbotgvbus!regulator-fixed xusb_otg_vbusLK@LK@defaultx `.^'regulator-eth-phy!regulator-fixedxETH_PHY2Z2Z `y ^/memory@10000000memoryJ #address-cells#size-cellsmodelcompatiblestdout-pathethernet0can0can1gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2spi3usb0usb1usb2usb3usbphy0usbphy1ipu1spi4video0#clock-cellsclock-frequencygprstatusclocksclock-namesregremote-endpointphandleinterrupt-parentinterrupts#phy-cellsrangesu-boot,dm-splu-boot,dm-pre-relocinterrupt-names#dma-cellsdma-channelsreg-namesdmasdma-namesddc-i2c-buspower-domains#cooling-cells#interrupt-cellsinterrupt-controllercache-unifiedcache-levelarm,tag-latencyarm,data-latencyarm,shared-overridedevice_typebus-rangenum-lanesinterrupt-map-maskinterrupt-mappinctrl-namespinctrl-0#sound-dai-cellsfsl,fifo-depthfsl,asrc-ratefsl,asrc-widthresetsiram#pwm-cellsfsl,stop-modegpio-controller#gpio-cellsgpio-rangesregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onanatop-reg-offsetanatop-vol-bit-shiftanatop-vol-bit-widthanatop-min-bit-valanatop-min-voltageanatop-max-voltageanatop-enable-bitanatop-delay-reg-offsetanatop-delay-bit-shiftanatop-delay-bit-widthregulator-enable-ramp-delayfsl,tempmonnvmem-cellsnvmem-cell-names#thermal-sensor-cellsfsl,anatopregmapvaluelinux,keycodewakeup-source#reset-cells#power-domain-cellspower-supply#mux-control-cellsmux-reg-masksmux-controlsfsl,pinsfsl,sdma-ram-script-namefsl,usbphyfsl,usbmiscahb-burst-configtx-burst-size-dwordrx-burst-size-dwordvbus-supplydisable-over-currentdr_modephy_type#index-cellsphy-modephy-handlephy-reset-gpiosphy-supplyqca,clk-out-frequencybus-widthcd-gpiosno-1-8-vnon-removablepinctrl-1scl-gpiossda-gpiosVDDA-supplyVDDIO-supplylrclk-strengthvdddo-supplyvdda-supplyvddd-supplyenable-gpiosclock-lanesdata-lanesregulator-boot-onregulator-ramp-delayfsl,weim-cs-gpruart-has-rtsctsfsl,iramfsl,presfsl,prgnext-level-cacheoperating-pointsfsl,soc-operating-pointsclock-latencyarm-supplypu-supplysoc-supplyportsssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-portspdif-controllerspdif-outgpio @8(F&Wandboard i.MX6 Dual Lite Board revD1!!wand,imx6dl-wandboardfsl,imx6dlchosen1,/soc/bus@2000000/spba-bus@2000000/serial@2020000aliases"8/soc/bus@2100000/ethernet@2188000B/soc/bus@2000000/can@2090000G/soc/bus@2000000/can@2094000L/soc/bus@2000000/gpio@209c000R/soc/bus@2000000/gpio@20a0000X/soc/bus@2000000/gpio@20a4000^/soc/bus@2000000/gpio@20a8000d/soc/bus@2000000/gpio@20ac000j/soc/bus@2000000/gpio@20b0000p/soc/bus@2000000/gpio@20b4000v/soc/bus@2100000/i2c@21a0000{/soc/bus@2100000/i2c@21a4000/soc/bus@2100000/i2c@21a8000/soc/ipu@2400000/soc/bus@2100000/mmc@2198000/soc/bus@2100000/mmc@2194000/soc/bus@2100000/mmc@2198000/soc/bus@2100000/mmc@219c0001/soc/bus@2000000/spba-bus@2000000/serial@2020000 /soc/bus@2100000/serial@21e8000 /soc/bus@2100000/serial@21ec000 /soc/bus@2100000/serial@21f0000 /soc/bus@2100000/serial@21f4000./soc/bus@2000000/spba-bus@2000000/spi@2008000./soc/bus@2000000/spba-bus@2000000/spi@200c000./soc/bus@2000000/spba-bus@2000000/spi@2010000./soc/bus@2000000/spba-bus@2000000/spi@2014000/soc/bus@2100000/usb@2184000/soc/bus@2100000/usb@2184200/soc/bus@2100000/usb@2184400/soc/bus@2100000/usb@2184600 /soc/bus@2000000/usbphy@20c9000 /soc/bus@2000000/usbphy@20ca000/soc/bus@2100000/i2c@21f8000/soc/ipu@2400000clocksckil !fixed-clock ckih1 !fixed-clock osc !fixed-clock n6ldb!fsl,imx6q-ldbfsl,imx53-ldb' +disabled02!"'((9di0_plldi1_plldi0_seldi1_seldi0di1lvds-channel@0E +disabledport@0EendpointIYSport@1EendpointIYWlvds-channel@1E +disabledport@0EendpointIYTport@1EendpointIYXpmu!arm,cortex-a9-pmua r^usbphynop1!usb-nop-xceiv}Y*usbphynop2!usb-nop-xceiv}Y+soc !simple-busadma-apbh@110000&!fsl,imx6q-dma-apbhfsl,imx28-dma-apbhE 0r    gpmi0gpmi1gpmi2gpmi32jYnand-controller@112000!fsl,imx6q-gpmi-nandE @ gpmi-nandbch rbch(209gpmi_iogpmi_apbgpmi_bchgpmi_bch_apbper1_bchrx-tx +disabledhdmi@120000E rs'2{| 9iahbisfr+okay!fsl,imx6dl-hdmi portsport@0EendpointI YQport@1EendpointI YUgpu@130000 !vivante,gcE@ r 2zJ9buscoreshader  gpu@134000 !vivante,gcE@@ r 2y 9buscore  timer@a00600!arm,cortex-a9-twd-timerE  r a 2interrupt-controller@a01000!arm,cortex-a9-gic,Ea Y cache-controller@a02000!arm,pl310-cacheE  r\AO [ k|YYpcie@1ffc000!fsl,imx6q-pcieE@ dbiconfigpci0 rxmsi{zyx29pciepcie_buspcie_phy +disabledbus@2000000!fsl,aips-bussimple-busEspba-bus@2000000!fsl,spba-bussimple-busEspdif@2004000!fsl,imx35-spdifE@@ r4 rxtxP2kv>:9corerxtx0rxtx1rxtx2rxtx3rxtx4rxtx5rxtx6rxtx7spba+okaydefaultYcspi@2008000 !fsl,imx6q-ecspifsl,imx51-ecspiE@ r2pp9ipgper rxtx +disabledspi@200c000 !fsl,imx6q-ecspifsl,imx51-ecspiE@ r 2qq9ipgper rxtx +disabledspi@2010000 !fsl,imx6q-ecspifsl,imx51-ecspiE@ r!2rr9ipgper rxtx +disabledspi@2014000 !fsl,imx6q-ecspifsl,imx51-ecspiE@@ r"2ss9ipgper   rxtx +disabledserial@2020000!fsl,imx6q-uartfsl,imx21-uartE@ r29ipgper rxtx+okaydefaultesai@2024000!fsl,imx35-esaiE@@ r3(2v9corememextalfsysspba rxtx +disabledssi@2028000!fsl,imx6q-ssifsl,imx51-ssiE@ r.2 9ipgbaud %&rxtx+okayYassi@202c000!fsl,imx6q-ssifsl,imx51-ssiE@ r/2 9ipgbaud )*rxtx +disabledssi@2030000!fsl,imx6q-ssifsl,imx51-ssiE@ r02 9ipgbaud -.rxtx +disabledasrc@2034000!fsl,imx53-asrcE@@ r22k9memipgasrck_0asrck_1asrck_2asrck_3asrck_4asrck_5asrck_6asrck_7asrck_8asrck_9asrck_aasrck_basrck_casrck_dasrck_easrck_fspba`rxarxbrxctxatxbtxc +okayspba-bus@203c000E@vpu@2040000!fsl,imx6dl-vpucnm,coda960Er  bitjpeg29perahb &-aipstz@207c000E@pwm@20800002!fsl,imx6q-pwmfsl,imx27-pwmE@ rS2>9ipgper +disabledpwm@20840002!fsl,imx6q-pwmfsl,imx27-pwmE@@ rT2>9ipgper +disabledpwm@20880002!fsl,imx6q-pwmfsl,imx27-pwmE@ rU2>9ipgper +disabledpwm@208c0002!fsl,imx6q-pwmfsl,imx27-pwmE@ rV2>9ipgper +disabledcan@2090000!fsl,imx6q-flexcanE @ rn2lm9ipgper =4 +disabledcan@2094000!fsl,imx6q-flexcanE @@ ro2no9ipgper =4 +disabledtimer@2098000!fsl,imx6dl-gptE @ r72wx9ipgperosc_pergpio@209c000!fsl,imx6q-gpiofsl,imx35-gpioE @rBCK[,@g   {y~zY1gpio@20a0000!fsl,imx6q-gpiofsl,imx35-gpioE @rDEK[,gJIHGFEDOvuqgpio@20a4000!fsl,imx6q-gpiofsl,imx35-gpioE @@rFGK[,@gai cQY.gpio@20a8000!fsl,imx6q-gpiofsl,imx35-gpioE @rHIK[,g     '8=.Y8gpio@20ac000!fsl,imx6q-gpiofsl,imx35-gpioE @rJKK[,gxML/ 9%$#&gpio@20b0000!fsl,imx6q-gpiofsl,imx35-gpioE @rLMK[, gK   Ngpio@20b4000!fsl,imx6q-gpiofsl,imx35-gpioE @@rNOK[,g   Yekeypad@20b8000!fsl,imx6q-kppfsl,imx21-kppE @ rR2> +disabledwatchdog@20bc000!fsl,imx6q-wdtfsl,imx21-wdtE @ rP2>watchdog@20c0000!fsl,imx6q-wdtfsl,imx21-wdtE @ rQ2> +disabledclock-controller@20c4000!fsl,imx6q-ccmE @@rWX Yanatop@20c8000#!fsl,imx6q-anatopsysconsimple-mfdE $r16Yregulator-1p1!fsl,anatop-regulatorsvdd1p1B@O 5(;regulator-3p0!fsl,anatop-regulatorsvdd3p0*0 ( (3@;regulator-2p5!fsl,anatop-regulatorsvdd2p5"U)00 (+x;regulator-vddcore!fsl,anatop-regulatorsvddarm  @Mpe| ( YZregulator-vddpu!fsl,anatop-regulatorsvddpu  |@ Mpe| ( Yregulator-vddsoc!fsl,anatop-regulatorsvddsoc  @Mpe| ( Y[tempmon!fsl,imx6q-tempmona r1calibtemp_grade2usbphy@20c9000"!fsl,imx6q-usbphyfsl,imx23-usbphyE  r,2Y%usbphy@20ca000"!fsl,imx6q-usbphyfsl,imx23-usbphyE  r-2Y)snvs@20cc000#!fsl,sec-v4.0-monsysconsimple-mfdE @Ysnvs-rtc-lp!fsl,sec-v4.0-mon-rtc-lp4rsnvs-poweroff!syscon-poweroff8`` +disabledsnvs-powerkey!fsl,sec-v4.0-pwrkey rt +disabledsnvs-lpgpr!fsl,imx6q-snvs-lpgprepit@20d0000E @ r8epit@20d4000E @@ r9reset-controller@20d8000!fsl,imx6q-srcfsl,imx51-srcE @r[`"Ygpc@20dc000!fsl,imx6q-gpcE @, rYa 2>9ipgYpgcpower-domain@0E/power-domain@1E/C02zJyY iomuxc-gpr@20e0000'!fsl,imx6q-iomuxc-gprsysconsimple-mfdE8Ymux-controller !mmio-muxP8c448 (( Yipu1_csi0_mux !video-muxqport@0EendpointIYCport@1EendpointIYEport@2EendpointIYGport@3EendpointIYIport@4Eendpointport@5EendpointIYOipu1_csi1_mux !video-muxqport@0EendpointIYDport@1EendpointI YFport@2EendpointI!YHport@3EendpointI"YJport@4Eendpointport@5EendpointI#YPpinctrl@20e0000!fsl,imx6dl-iomuxcE@default$Yimx6qdl-wandboardaudmuxgrp`~0t0x|0YBenetgrph~000000000 0$0(0Y,i2c1grp0~X(h@tDl@Y4i2c1gpiogrp0~X(@tD@Y5i2c2grp0~P8p@dLt@Y6i2c2gpiogrp0~P8@dL@Y7mclkgrp~ 0Y9ov5645grpH~(4T<Y<spdifgrp~ Yuart1grp0~L`PdYuart3grp`~d4h8 `0 YNusbotggrp~pYY(usbotgvbusgrp~\,0Ydusdhc1grp~pY (YpYpYpYpYY0usdhc2grp~pY 0YpYpYpYpYY2usdhc3grp~pY  4YpYpYpY pYY3hoggrpH~$xHY$i2c3grp0~0x@|@YAdcic@20e4000E@@ r|dcic@20e8000E@ r}sdma@20ec000!fsl,imx6q-sdmafsl,imx35-sdmaE@ r2>9ipgahbimx/sdma/sdma-imx6q.binYpxp@20f0000E@ rbepdc@20f4000E@@ rabus@2100000!fsl,aips-bussimple-busEcrypto@2100000 !fsl,sec-v4.0E  29memaclkipgemi_slowjr@1000!fsl,sec-v4.0-job-ringE rijr@2000!fsl,sec-v4.0-job-ringE  rjaipstz@217c000E@usb@2184000!fsl,imx6q-usbfsl,imx27-usbE@ r+2%&+okay'default(otgusb@2184200!fsl,imx6q-usbfsl,imx27-usbEB r(2)&host+okayusb@2184400!fsl,imx6q-usbfsl,imx27-usbED r)2*hsic&host +disabledusb@2184600!fsl,imx6q-usbfsl,imx27-usbEF r*2+hsic&host +disabledusbmisc@2184800"!fsl,imx6q-usbmiscEH2Y&ethernet@2188000!fsl,imx6q-fecE@ int0ppsrvw 2uu9ipgahbptpenet_out =4+okaydefault, /rgmii-id8- C.S/mdioethernet-phy@1E^sY@Y-mlb@218c000E@$r5u~mmc@2190000!fsl,imx6q-usdhcE@ r2 9ipgahbpert+okaydefault0 ~1mmc@2194000!fsl,imx6q-usdhcE@@ r2 9ipgahbpert+okaydefault2mmc@2198000!fsl,imx6q-usdhcE@ r2 9ipgahbpert+okaydefault3 ~. mmc@219c000!fsl,imx6q-usdhcE@ r2 9ipgahbpert +disabledi2c@21a0000!fsl,imx6q-i2cfsl,imx21-i2cE@ r$2}+okay defaultgpio45 . .i2c@21a4000!fsl,imx6q-i2cfsl,imx21-i2cE@@ r%2~+okay defaultgpio67 8  8 Y sgtl5000@adefault9 !fsl,sgtl5000E 2:;Ybcamera@3c !ovti,ov5645default<E<29xclkn6=>?  1 G8portendpointI@"YKi2c@21a8000!fsl,imx6q-i2cfsl,imx21-i2cE@ r&2+okaydefaultApfuze100@8 !fsl,pfuze100Eregulatorssw1ab8-?jsw1c8-?jsw2 52Z-?jsw3a"-sw3b"-sw4 52ZswbstLK@N0vsnvsB@--vrefddr-vgen1 5vgen2``-vgen3w@2Zvgen4w@2Zvgen5w@2Zvgen6w@2Zromcp@21ac000E@memory-controller@21b0000!fsl,imx6q-mmdcE@2memory-controller@21b4000!fsl,imx6q-mmdcE@@ +disabledweim@21b8000!fsl,imx6q-weimE@ r2T +disabledefuse@21bc000!fsl,imx6q-ocotpsysconE@2speed-grade@10EY\calib@38E8Ytemp-grade@20E Ytzasc@21d0000E@ rltzasc@21d4000E@@ rmaudmux@21d8000"!fsl,imx6q-audmuxfsl,imx31-audmuxE@+okaydefaultBmipi@21dc000!fsl,imx6-mipi-csi2E@rde2a 9dphyrefpix+okayport@1Eendpoint@0EICYendpoint@1EIDYport@2Eendpoint@0EIEYendpoint@1EIFY port@3Eendpoint@0EIGYendpoint@1EIHY!port@4Eendpoint@0EIIYendpoint@1EIJY"port@0EendpointIK"Y@mipi@21e0000E@ +disabledportsport@0EendpointILYRport@1EendpointIMYVvdoa@21e4000!fsl,imx6q-vdoaE@@ r2serial@21e8000!fsl,imx6q-uartfsl,imx21-uartE@ r29ipgper rxtx +disabledserial@21ec000!fsl,imx6q-uartfsl,imx21-uartE@ r29ipgper rxtx+okaydefaultNdserial@21f0000!fsl,imx6q-uartfsl,imx21-uartE@ r29ipgper  rxtx +disabledserial@21f4000!fsl,imx6q-uartfsl,imx21-uartE@@ r29ipgper !"rxtx +disabledi2c@21f8000!fsl,imx6q-i2cfsl,imx21-i2cE@ r#2t +disabledipu@2400000!fsl,imx6q-ipuE@@r2 9busdi0di1&port@0EY]endpointIOYport@1EY^endpointIPY#port@2EY_endpoint@0Eendpoint@1EIQY endpoint@2EIRYLendpoint@3EISYendpoint@4EITYport@3EY`endpoint@0Eendpoint@1EIUY endpoint@2EIVYMendpoint@3EIWYendpoint@4EIXYsram@900000 !mmio-sramE2Ycpuscpu@0!arm,cortex-a9cpuEtY2  02  l (2h)9armpll2_pfd2_396msteppll1_swpll1_sysZ[\ speed_gradecpu@1!arm,cortex-a9cpuEtY2  02  l (2h)9armpll2_pfd2_396msteppll1_swpll1_sysZ[capture-subsystem!fsl,imx-capture-subsystem]^display-subsystem!fsl,imx-display-subsystem_`sound3!fsl,imx6-wandboard-sgtl5000fsl,imx-audio-sgtl5000imx6-wandboard-sgtl5000ab8MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUT sound-spdif!fsl,imx-audio-spdif imx-spdif&c7regulator-1p5v!regulator-fixeds1P5V``Y?regulator-1p8v!regulator-fixeds1P8Vw@w@Y=regulator-2p8v!regulator-fixeds2P8V**Y>regulator-2p5v!regulator-fixeds2P5V&%&%Y:regulator-3p3v!regulator-fixeds3P3V2Z2ZY;regulator-usbotgvbus!regulator-fixed susb_otg_vbusLK@LK@defaultd A.Y'regulator-eth-phy!regulator-fixedsETH_PHY2Z2Z Ae Y/memory@10000000memoryE@ #address-cells#size-cellsmodelcompatiblestdout-pathethernet0can0can1gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2spi3usb0usb1usb2usb3usbphy0usbphy1i2c3video0#clock-cellsclock-frequencygprstatusclocksclock-namesregremote-endpointphandleinterrupt-parentinterrupts#phy-cellsrangesu-boot,dm-splu-boot,dm-pre-relocinterrupt-names#dma-cellsdma-channelsreg-namesdmasdma-namesddc-i2c-buspower-domains#cooling-cells#interrupt-cellsinterrupt-controllercache-unifiedcache-levelarm,tag-latencyarm,data-latencyarm,shared-overridedevice_typebus-rangenum-lanesinterrupt-map-maskinterrupt-mappinctrl-namespinctrl-0#sound-dai-cellsfsl,fifo-depthfsl,asrc-ratefsl,asrc-widthresetsiram#pwm-cellsfsl,stop-modegpio-controller#gpio-cellsgpio-rangesregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onanatop-reg-offsetanatop-vol-bit-shiftanatop-vol-bit-widthanatop-min-bit-valanatop-min-voltageanatop-max-voltageanatop-enable-bitanatop-delay-reg-offsetanatop-delay-bit-shiftanatop-delay-bit-widthregulator-enable-ramp-delayfsl,tempmonnvmem-cellsnvmem-cell-names#thermal-sensor-cellsfsl,anatopregmapvaluelinux,keycodewakeup-source#reset-cells#power-domain-cellspower-supply#mux-control-cellsmux-reg-masksmux-controlsfsl,pinsfsl,sdma-ram-script-namefsl,usbphyfsl,usbmiscahb-burst-configtx-burst-size-dwordrx-burst-size-dwordvbus-supplydisable-over-currentdr_modephy_type#index-cellsphy-modephy-handlephy-reset-gpiosphy-supplyqca,clk-out-frequencybus-widthcd-gpiosno-1-8-vnon-removablepinctrl-1scl-gpiossda-gpiosVDDA-supplyVDDIO-supplylrclk-strengthvdddo-supplyvdda-supplyvddd-supplyenable-gpiosclock-lanesdata-lanesregulator-boot-onregulator-ramp-delayfsl,weim-cs-gpruart-has-rtsctsnext-level-cacheoperating-pointsfsl,soc-operating-pointsclock-latencyarm-supplypu-supplysoc-supplyportsssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-portspdif-controllerspdif-outgpio