eGON.BT0߱z`SPL,sun8i-a83t-cubietruck-plusﾭ1)   /0@0   P!:0@"  Рw`K 8N" I{((_" Io O0lGuGCF+     H  ~G" I;i_" I1i lGuG8 FD B8,F (4 F8KhB `pGPNw3q!) !* !* !Ha@_Os",_,_AB,pGpGH (A  #OsAnCf"C"""n"fOsZjBBZbXj_Zj "BZbpGFFFt$t;h_3@BBHG_OB#`_I`Oh_h_XBXApGUU0$P%0@#@C@%00$$F FA LC )HpF`ۿt*L!Ci@#@CCa$$F FA LC )HpF`ۿt*L!i@#@Ca$$F FA LC )HpF`ۿt*K($C($$C$pGK$"$($"($pGL h@r(-!@0V `TN FF-  FF- *7 F FX04C(F07 F FP0#B#(F0_OsOrenB2f"B2"pG_OrOeSS[ CC_` _տ_S`Os "_տ_JepG(H_OtO#cdcl_CC_cd 2_տ_#2 g~_Osd gvcm#@SCSce_KbOs "_Rտ_BZe_OB _J\!_Os"`QK[ ;C@C_OrA|Pb^Osj_H#AXC1A16nOs<_CJ2R/KFOR! D pG .2Cr Dv_OsO2,_" ,pGF#OtXC<_C(,_CB*[DF!OzppG0Exy=%xDyCcTBTA$:""_< :O<:)2:C#xCx:Cy+C#C:CC_J`0 _"KF`H00J(0#@sC@sCs0pG0@PKi_oo 0-MKKOc0K%Br%_%OtU \1Ozp#C\10#C0#n#C#f2#C2#j#C#b0H#C0 KO1@CCC3*F0H2CC2#nCC#f0CC0\1CC\1#0#0_N$` 0+@K_ApC#c_@#cc_#c_c@G@O "#O $OfFO 4!H%FHOAaAAQ_LE0%eE0e_C cC eC#_#f3C CC _BbB2cfBr_rKfC#_fo_ CLSC_gjKCC_0GW_@(P'e@_`e#CC_0_\M]K0_#0_YK+a_XKka_WKa_Oca_SKb_d&b_c+c_Ockc_KK+e_OSke_HKe_Ose_DJc_c_d_d_?K+d_2#kd_LP0h G8#F" I}@0B*F!FHO08GG! ! @! \$ F! F! F!4, Gx!E !E !E !F !F !F H$ F! F! F!4Q, @ @BO08F@@COapCOapC@PACO`CO`C@0!C !C @C @AC !C !C !C OaC OaqC !C C ,CHMFc<H < I |h[h[hGFpG7F))" o F~a 0$&1[hP1hFrO0O0pGh[hhGFOzp" F FO` F#0#FYhkh K@ @BCCC" Fc #p0#F F&l0" F>p+`p)Fr@ ѳ* ,ds9Ld!!&CBB@r"(F}Fh>FpOtOtoOzrhF[hbCi;!(FGF&iF(FF8Rod G0FBomL!Z#0#4 ] -MFFFF@h?F`(Fz(*iB-HT&0F Fo(ѣhZhi-52FAF FGFFE]F(UF-4""i o)## FF- !! F@ H9F*FBo /DѪ"KK#0##Or# ]0KhPQB} }0 ?$?!F(ѕ 0BoI 0Bѕ 0Bѕ 0B"/(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oF-AhpJ?C|BF}À ?%?)F_(@P1+OpPP(Or)F0+ZJR#ZK`B@0RBR^#C3BOPpPK("bB0r00`Z*#s0 n 0q.D o [0#00[0#F0 x,#,'J` #K`݀.CR3#1aEѕ06Օ0ѯ#"F FA#0iKF [CSR"#0p0 }P1+#P1o o?XF@@-EFF'_ q0"#!(FC F(? N1F(FF(F FF(ڣh[hh F@G Bh\iiB(!FB8FAbwpG-EEiFF-@#d1# F#webh[h[i+vO`h F[hhGF(@oLcg#\#b F*F)F F FF(k F#r0h FhJK@+ #Os#*F(0+BK`@77#"0# F(=)#0#hhhREOCC Fr(+?JOzpe FG(ck#xscccsa#Jhl0B2`%(F n) FI F)! FXFk+ 8Fwzd *5#H1omH`o^FKhFhCSCCcHh[hh+! F @#Hca9oz#I1#L-MFస%(F`@F$I1+^%H1IQ+^#",0# F F(@6"\#,0l0*F # F F(@h"+:0 Fl0 #,0# l0  F(@ehOd&ebe@a9)9 FeF(ЎkHQ+ Fr(FF! FF(@Ҁk+ 0Fz?d ROC`ksa#l0sI`HA\HP#0'KC!igcg0C\qLq d@-3|CC=F"3@#5CC@ZC"5*D"2Oq"#g$#&#(#*#,#.#hkZ ", " F #O ,0l0" F 0 F(F# Fq0F(= F.z FF(3hbI+7#H0l0F!c F1F`F3#3##O '?`1F FF(} #caHIBHI@HI>HI<@sCs2W+.CHOBKFU`H#khDCS#c=KdBVO0KB$KB$J#B""/iDSmCC0CFFC#eCC_jh `#"#6nL@x}u(8(HHopGdLMih(]@  8F F_ Jiaii_+ ۣik__ ic8(FoO0 pCjFi[i]h_%2_i FZ` #o`p FqjD(%3#_iS`C3_i FS`(3j+ѿ_"i `+ѿ_"i_"i-Mi FhF+@ ** O#OCJhHC@HCQHCs.\ѩh_ia*C_ia LKzFik_@FBz @汳hKz+4OOH,Fik_0F$x(р @̀kh Fik_0F o򸀻jhi}j_`7h@rhhhTCSCS*CS_iahhJC_iJah_ia*C_iashh ##hiSChO*BBo`O8OjO EbEXӢik_BKxX'p_irFMCSD i"@+`Eѿ_j_`ij_+ai[j_kaij_a%_O2icih_C_i`(FO5 O5Fik_om_"i F`]<"-A=LF>!0F:K-a:KOq3bO@bOS6Jsb6K105K6H05K g<#kC(FP oO`OpIp@CB@SBF@BBFIC1 F1ɲ" @! (@! oO`OpIp@sCBٰoO`@tCBFIt@ 1ɲ$ @!F(@!FºoO`HOHpIHpD,&9 !@@ ɲ@CB F/O/s I/s1'0GoH !@@ ɲkoQF ̿F ȿF ĿD,F=9!@@ ɲb@GB F;F/O/sM/s#(GѾBAhB3F@HRBFHS51ɲ0H!@@ ɲoQD,&9!@@ ɲ@lsB F/O/s I/s10H!@@ ɲoQD,79!@@ ɲ(@SB F/O/sI/s10!@@ ɲ@SAOOoQ!  {X (0Q+o]0@H Kh(4M O0Cs0@iGFCj F@GFj F@G8K9 (FS!P !(F!F(F8@TG!8 FD8)F!HHK8S @I F >F F@ZTG6n L FI'F F+ 6nHpGN{۲_#C_s˲_p!_qӲ_spGFQ}۲_Zտ_#q_#t_"r_sKƿpG8 F_!q_#t_#)Fr8@}۲_տ_ )pٻpGF#}۲_ x_}_pGKIFH[DB pGAhB0NNNpFh F0Ci;)F Fp@Go%pF Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-ﾭﾭﾭﾭﾭ@@@@@@@@@@x}uu@x}e @ @ `ppp00'@B :989(eGON.BT0TOC0.GLHUnknown boot source %d FELTimeout initialising DRAM resetting ... SPLsunxi SPL version mismatch: expected %u, got %u DRAM: %d MiB Failed to set core voltage! Can't set CPU frequency U-BootTrying to boot from %s SPL: failed to boot from all boot devices U-Boot SPL 2023.01+dfsg-2 (Jan 18 2023 - 01:57:16 +0000) spl: unsupported mmc boot device. spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_sector: mmc block read error spl: mmc: wrong boot mode MMC2_2MMC2MMC1alloc space exhausted cyclic function %s took too long: %lldus vs %dus max (((((AAAAAABBBBBB### ERROR ### Please RESET the board ### Error, wrong i2c adapter %d max %d possible Missing mvtwsi controller %d base twsi0MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d #(-27jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdH@J# `JDas U-BootXJXJRUNTSERVdPRJqRJJJRJJWJAXJXJJRJJJaXJJJ#??OopGpGpGpG@pG@#???OopG8F F90?"3@SB#@BؿO)F F8@>?DpGpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF  ޿//ПM P-xР:Р:1ALРT P<Q,,0 S@@ </pTJdJMJ _/_ РP/< /0Od@P TP  Q:< 80QR:/# kl#iF#]pGs0F[k`H F( H!@("H@SKIt,FH@GO@{O`w0;  FGp0k窕JJSJJ֕JpGF H(03 F] H@H F@>JJJpFF(F0Fpo!F(F(FO6F`I6(^H@+J3J0G%@$0C#&@CC'@CcLBLBH )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFH@ (obox6JJJF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk_ HZ HHU HLP@ORH@SJ_JhJoJyJL H L :L pGOCiF8 >2H0J3 `pG@JpG pGH?UJ-EF"OI1kkMH%l@U pF PkP kYEH@Dj"kakCH@>#jbjjAH@8#i@Hciii@0#h=Hhchh@(.N!n!OZ"z"_C#c#_ v V 0H@#l/J0HFF@F")M )K+FP<'H@&lk $H''%%o@||Ʊ,H#E@׺5 <9F@F@.$j9FPF@4,U$ 0_J1J1J2J;2J_2J2J2J-JַJ1JSJ2J2J2J2J!JF-H@k F;c-k"JF-H@k F;ckmJF-H@ok F;ckeJF-H@[k F;ck~JF-H@Gk F;ckJF-vH@3k F;ckJF-bH@k F;ckJDù@ FFH@  uJOB < R< <  < < pG0AQA@aC pG 0 k lk SB!0?CS?opG??#S?opG%J F!0_ #P?0#S#?CY?OU3??C?o?C?o?[ O$OopG" I?h(ɲ_)9) " I?X  ))H?    JJ J~(A  #OsAnCf"C"""n"fOsZjBBZbXj_Zj "BZbpGFH@ 'J K"_`"_B`"_` 2_` pG@0$P%0@#@C@%00$$F FA LC )HpF`ۿt*P#_@pGL!Ci@#@CCaL!i@#@CaK($C($$C$pGK$"$($"($pGL h(U JI `xJTJJ FFH#h!PTJFH# h!`]TJ7 F FX04C(F07 F FP0#B#(F0Osj_H#AXC1CA1C6nOs<_CJ2R/KFOR! D pG .2Cr Dv_OsO2,_" ,pGF#OtXC<_C(,_CB*[DF!OzppG8#F" I}?0B*F!FH?wO08JJ!𵓰 "F xF(X+U "<0C@(N(O1F"F ?-(F 5z` #I > '(7#C 0 0R  0 '( "F9F ? '(4, H'X! J ?H t$j0J}0Ju0J0J0J! 5! 1@! ) F }(,  J0c1?p//KB?{F F@6n 2COAO@@@ OOB@ Cj@07XBXA!(H !'H !&H " (6#I H  B ЁiYi*##H #= Cjc @!KJ?,H l ]H'( IH (IJJJ^JJSJJJ'J pGF F -EFF4MFF*F#9F0F0,H8&0KB0BؓB$K:F;1F#PFqHB0BғB!FH? BB0DBB!FH#9F0F#J(H?XJJJQJJuJJ:F" F-MdF0 3C0բMOr!(FH'TFa#F9F>#0c/+"!?-^# 3-U# 3 O OFF((r~Hh@-7 3+)FxH?5*hwKBvHXOnM0+lrHNO{(F.nH(F kH<(F4hH? gH1i)eH?-Ы+ ++@0h0+ZK!(F$`@")FXF>Z#K\{dRHhd#)F8F ( d;e xed@F((1AH000000 0@D000000++m/J! W(k0i+HZimlk'HQimlv$HHiml1 H?iml<H6lFiml~(H'XJSJJZJ'VJJJJJJJJ\JʻJJJѼJ.JEJcJxJJkl+QЫi00+ 0 D0|rIc RmF(LH&wH&r񼀔7F(@ǀoÀ fH FH?+mC~Jiml({H{H{J)zK AԒ0++#RF F(@Fo 0p O0{9FFZF@F0 @ @F_ F& oUH?hTH?e SF O8NH?V?1'?!?0 8 ѻE B BclC"0+4>H`/=H\R=#8Fv8FF(r0q 2h%-?ea#FRF@ GF(AF"H?T#FRF GF(#FRFOpGF(#FObQFF k?d?.m'J4J?JJJJXJ@JJpJJJmJpGoFO,@28 AH?  A H H?#08 FJ#JNJ-AFFܽDU F>7(h>EB'o ZlB@H!F?NG  Jo FFF#[lH&P!?-F #:F)F@ H!F?&G H&F(0F> κJ׺J>J0oF"Zl 0 I(F?#h5F kF"Wu!kF"FN8 Jo-E FFFD[l "0+%O -+&FW(>0EED0F# #:F)FF?@H!F?3FQF JGjF!PF+H&IK(FF JSJ>J-MFLHFF&0FpFO 0F>_Bغ"BH?o#FZF(FM`F=) b,f*!@F?O GF2H?LoWcl+=0):(F(FFH )F"J53H&Fб`>#D+F0FJI( 5IFH?  F H?y F% H >JJJƾJžJˈJ;JJJp FFF&"0H&\ p1F(F0GJJpGpGFFFF+F1F:F FG0+дpO0 KS pG4aJhx *pG3`hFBhH? J-AF xF/+ FF}{ñ#0(F>`F>\D*FH?no# }Or!i=)F= H?YBF I?4 FehG( ;`wJJJsFF FF&Sh!?( 3F)F FpooF@hh i`iii j`j F@-Eh FF9FFHF;3 *\ԚBѪpT `P! HB"h#U#c`Sz\ 2Ҳp1J-A F!hF a`F ) )#)#Fkx )"3b`+` .# "*# "!F# "!F&OW6) h==0c`6 gJs" FiFFh( !h2FH>eop+`!JF"iFFh, )h:F H>Ko "!(F>0`(F F JFH&MH"F!>(o oJJ)FH>o@2FH@0 F0 0 I00> oJ:JJ-M% F mK")FFa@")F$#[ F:#b#k ckB|H&F`iP aObvH a %(F="F(FH mh#ahmH>i8FjJ c[(ahfHdH&A4!FbJ>V( #8F^Jh?(ah[HjZH&"FYH&FXH&FWH&3F*FUI#>?j QI=!2(#l0jei0-YOr54(F=$F#= D=5Doai#=H)F=F#= F=ObF!F*F4H>!Or54-K-F!Ob4=#4=4=Ob a4& aH _ H a>H&#i +@=F i=D5(FCPH>M J J>J J J J J J J. J5 J> JH JP J` JSJi J J J#i)FJ >t H&P@@#jS +$H&7 F+ +$(F"FF( !8hTH&F(UцH&FH&F-H UFJF j =4 (>!jDlxHzI/.F j =#F =D(F= PF= F6@FD= F = ^DDD0F FeH>]JFF`K  1F#jZJ>]F#YFLJ8FF(F. #i3ahQH>%dj,?J@H&!>PF3F(=FH&EH>4)F>>F#x + F@I=nF8 F=(%F4 ZF!FF=:#(F 0=`#)F8F-J_()F-H>(FG F(I=>F(OQPF@F3)F"HAFPF+()FH$(H&+? K8hIJ J JJ J5JSJJJ JJ J J J J( JNJX Js J J JF(" U-M FF(FFF( ZF)hH> F:F)F0F)FH>CF:F9F0F(MJ7J-MFF+@>!H>o8F'/a=:FF  +++)FQ "3"+FRD(F2FH> HF?D F(jD"!!( 2FH> Fdoi<ac"d`"  +ǀR#8J:J:JQ9J:J:J:J9J9J9J#:Jc:J:J:J:J9:JG:JU:J:Js:J:Jy:J" p + +khc`h=Rh`8o J2FUH> 3QIh=F(=0q a(1F=#3pFBI`i= !0F=M1FBFa=ni/^i+YZFi+N#j+G cj+@$#4#cV(#c." +QR#:J7;JA;J8J7;J8J8J7;J7;J7;J7;J7;J:Jg8J;J7;J7;J7;J:J!J'!JN!JJi!JF$hhl`/|=A3"+FRD&"FH 'eq!JF}H FF="F F=8D"F I H>0o# }I>2F(F9JGJgJpF%Fh`hUhB Fp@<80F6hsF FcF"!{caa#2F1F#F(F( F$ Fp-M$ FhCJ 3 @K#F*i(hF(mЫF:H%pF"[_E'+,NF3H>H 0FF0F,K (GliEDT<#<$h<S!I@F>kBFAF0FD(0F Mih1W8 =5(F+FW8 =+FDF?hFQF0F_(0ih H>[4 gfff.JMJ`J#(JJ-AFFFF!"0g``#su(F=(F=L apo H=C a(# "iT/!(F=(C3oSJipFFF H> p#a!F(F F 7*JFF@"hF=d @"iFchXBXAFh@O3 <iXBXA< S/pG0FFFB"@T!0<5;`FB0D0`U?73#D 8`h+ pGB 0 FFh FFIH7JvJFIHJtJFIH޿BJ`wJ-M zF1`زF F,FEIH>T #D3`IH>K BEoFH>@- )FH>:o%O3QF8FIRFAF8F :&(@JDJNJVJkJFIH#J(vJ-AF  "7I8H>5I7H> wF`}FF;F2F)F-H=(I,H=hH"i$I(H=bi!I&H=*) FIF H=%O|B)F F*F9F@F=+%9FH=5 +!ihH R@9A=𚿔J^JtJJJJJJJJJ8FF#h+O0`h()F< h8 4FIH<JvJFIHݿ'?JtJFIHӿm;J`wJFIHɿ+J(vJFIH6J0wJF2=K` |JH% @!=O@J8H% "!=84@@P8 aB8PH-%0"!=,D  FJJH%@Ͽ"!=JB-AF FFFDDFE7F(GF>B)F F:F%(FF8BF9F"H=%oh,<,3B{УlBj! F9F(F(XFXF( K2! J0 = (0縗J֗JJJ-AhFk F;hF[hF0F2F)F F;hAGo%F hB -M hFF F0DH= F#;hC;` F(h!F(eУFF [E[E3H$-F(;<_c(o(F%YF u E(   1F<"I<F&,o0F(E'E$04YF <F"AF(FK:DF#a=ba(hF(0oo 2F!FH= J$JNJFJ1J8F Fh#he` +-ihH8@=ChhHYhH8@=8uJJJ840F FC!)Fh8@o F8@F@h88" F!FUO3%`b8Fjw k@rFF%ci4l3"kѥbh``#h%a i3aiiB;! Foj`j3BbR#0`1F F(l`a&#h[特bh"`h!i3B`#h`%a*j4Pcbbh""jR#p8F (9F FJs FFFB)F Fy Fop F(Ѣj#kS"0`40 F1F FA(l&#h[`a1F F]F FF pFF!@"F#&a%bbpF@jj k`k@iF3#S``#`C`hh FS``#`` F@jF+jU(o oF F jHZhIj= FFFH= FJJ@h'((H H@h'(H FFi%ԻpGhk[hGFpGhkhGo%pGhkiGo%pGhkhF`Go%pGphFk FhSF!(FL)F Fhp@Go%p-MF&FHiV GF(o8F!0FF(>$ OKFO BE[EO bQF xBhтH$ 4  ,CjZМBb#400lbo pFKF*F!J< k< c%1FF FAPc#b(F6po FSJJFkFB!yF"##F0k%dF((F] F#BB #Ubucoo o-AFFF@FYFAF8F F%*hBAAF8F`"#1F F#%+`o aCa 8yFh`h iB 88AcKh(F(cJ7F FO(` F07( iB08-E0  uñ1F n-KLOK\CdB{h+ 5D7XJI( "QF@F; O3RF9F#(мJJJ7J#J+J pGp FF"! -jfk# J TRFop1F(RJsF FF!"FhJ F عci i$fiF0F*Fu/F:h1F F KU`W?+*F/Fo"O1 FsϴJF{-A FFYF"!0Fj4# J1F(FtF o AF(F(SJsFF FF!"h( 0Fkk*k F? HoooJJJJJFH F@H۹JJ-MFF F1F F1FUE! F8J28 F1(F( )F F1Fعs9FBFF0F:( 'H:F%HHP ;HP#@WFJhJJJ-MO FFFF) F(Ucl+^Д"0+Z!hsHIMH;LJ#)F F1,F8IIH;' #BF)F;F F10F(7FBJ)F F1F+I?H;O#ZF)FCF F1FP)F F0s(F+.WF)F F0gFYH;r9FH;m1FG(H;gYFH;c7%H1F #H;X9FH;TH+2F9F F9FJJ\JJJ JJJ5JJJJ5J3J8JFJ<J\JJ:JJJrJJJChDpGF FFFz( 2F Fh)FhG Zh`O0-MFFF0F, p:N"!F(F1F@F:AFFPF:!F(F{/N!F"(F0"F9F(F0"FF1F)H; & %HQF;!F(F#J1+ h[H;H!F(F0F!F(FP W#? [FRF0F.sNBNXF:( N N iJJJhJ0JNJ[JeJJ;J,JJ0F F"0)F F`")F F0{ IF H;< 0l )F F>JJ-A!IF1H 1IFH; &)FH;!F(F0FOX,+ +"!F(F041FF8F;!F(F6(@F;!F(F0FJJBJsJ!JF 0XBXA F 0XBXA F 0XBXA 8F F0عclh(F$!F1gFFF J(F1x(F I1(o F8ooo)JJ FIF1 ]9F0FJ0F8F#!(F:9FpD`F)F*"%FT9F*F0F0F Fo J5J0F1F0 F-MFFFF#M1ZO \Eo[FRFAF0FFF0F#(B  F,F F8 FlFFz #*F F(o8o-MFF hk+JR#H2FQF;O10FFhFQFH; F YF0Fc#F ,/QFH;0F#ڒHoZF!F0F0F H;- !FH0RF#0FP"FF0F0FRFYFH;q0!F0F~J |H!F0F (yHo wH!F0F/D0:F!F0F0}8"!F0Fw"!F0Fqع--"!F0Fi"F!F0FS(a"!F0FL(ZѸO?-H-F"!F0F;(?"!F0F4ȻO+-!F0FDwFh|F8F!FF*FEH;o1-"!F0F x"!F0FF@"!F0F-!F0FQQF2H$"!F0F("!F0F("!F0F(x+M!F0FH+DQFH;o*+orh-2D*КB(ٱB&QFH;o_JJJ%JJHJkJJJJJJJJ1JVJ:FQFAH;[#0F!F 770X(eѝ70 +`-V-T-0#BF F :F+F @QF(H;&og7F-8F0(h H@BBF9F0FH5` +?@ +F`5BBF9F0FB9FBF0F7F-ѝ70+mJJJJl FF I:FF(####9FF F 9J-MF# F *hh/f9( o IBFF8F: 0+=9"F@F-Ip@Fo "(F'I9F($MAFU;9XPFshGF( FF  CF!J:X*IF(`I(F H:PžJJJJJJyJ JTJ_JlJHpGHpGHpGopG(opFF "!"FIl)Il"#IlIlpIl 8IlFo0Fp Il Il9Xa(疚JJJJǚJԚJߚJ}JK`#C` >J-A}FF>!Fi:, WCF$?miR*o }29)FF(Z@FiCihDo-#F"0Fih(oOr!F8F9@FihhD+-#F"0FiE(bx *O0@@* :a1#xBch 1ooopİFFmF`- C)F 0FJ:C FDpo狨J8FF F9Fر FI F! I" I H9 K I(F F8@o 8YJeJJpJJxJ-AİhFMh%N%O FD#h0Fh9F(69F(F/(@FIFYhFlF(F(F(hFU>JžJJFFFG*pFFT!:IFF H:N"Fq(FFH$: FpO48J`J-E8FFFF 3Xh:xa:)*#)( "I`h`hJ+  B H:O0@!1F(F8 #KBF@sSF礯JXJǹJ FH"!F@JJFF"H:T F(($HHt"hKBHm  FNH F&H_ FWHHV HQO1 FvH F F( HJGJJ'VJJJJJJJ/J*FF Kh@&$!W$:]4(&B0F|JsF F"#&`KHhV:kF"1F Fp|JΙJ7ML#d FIFaCH:0JJm۶J*̿XhH98SJ"iF 8G:HH 3]JJ-MFF FFFCFP6ܸqbI`h90F(@Fh:YFFh:YFF i:FCF9F2hUH:Y#FBF(F1hQJQKFBFFOH:G` "KIBF`h9F(?Ѡh:FF(F4`CH:+"BI`h90(Fo "9I`h9X(F1h(9F6H:  "4I`h9O0(F(9F.H:+I"`h9F(Ѡh:eFF(F#("F9F#H:"I`h9F(Fh:JYFFh:EYFF i:@FCF9F2hH:#FBF(F1hiJKFBFFHhJ#J\JJSJJJJJ*tJĎJJ6IJhJJ B!HJpFFSF . jhx-*H:sO4 F p%`M)FIOzu H:X$=zJJ-AF+ FFO0" IphN(ChbB-hKB)FF3A`G JxJFJ *-AFFO4 F-hF0 A4H9$,Шh9/KFB(-Ihh8hF&)H9$hh8 F"H"I8RIF8M"F!F8F93F(O4(F !F"@F9#F(!F0F $ KhB9F H9$ KhRJJJJJJJJ-EF##MT5"FCFFFdKhH !92H7#BF!F0F0;(#0#Oc"F1FCF8FXJ|JJ-MFH jd,hB TH,HI#.#O!.!@9#NOH  V+ZEPF9h9FE $hJ%JJ qJJ pG B!H&Jk N ]   -AF+ FFO0" Iph(ChbB-hKB)FF3A`G JxJ B!HJ-Emh/Z/M0L8?/U k8i7PF=" ##:JB Bz,F#hxHD? X( BDd" Cc€ 0#H9?8  ףp= ף?Jh8c-AF+ FFO0" Iph:(ChbB-hKB)FF3A`G JxJ*sF+ _F(H9 p"phF9F"FFh9@Ozr K `jC H# H9*FIH9 O0JJyJJ J*FFIXh8tF$&FW&6 B -&JsU-;\h!x-)5axp)s)0ѕ/!0h90(=69H$cxp+!9~ FH9l 1F(FGF H$9_ Fp$$Kh9$FJnJ|J*FFlKhlH klH kH98 !!Xh9.FeI`h8( ;()F`H9!9F]H F(_[H F(FhF8 F8FUH F *|RI9DQH FOI 9'MH (jJH 0HI F9<FH F( DI9DCH |F( @I9D?H qF( =I9DJJJJ. JJH JJ5 JJ> J%J+J4J;JGJJJͿJJNJhJ*!Xh9 pG$!$!$"3$!$"%$!$!$"p*FH9 "p#h`h Fh$n8+F2FahH9 $J2J$" $"$"FFqZ, * I+Z(  pG(x:8\( pGJ-EF9H F 5!9F!F0FF2H %1OBܽE.H O7-8F 0F 0F8G5D0F8B0D'ѼB"F1FEH9NH9K,4OpeEHE9.FKH97!F(i92hFRhFBHH9(}@F$$"DIhh7ȹ/4h0hh.8.F)ЧBHzQ4X$  J]JJ0JeJJJJJJOJJJJWJJ+JJJ"(F8*x?* 2`23R*)FH32x )Щ[**3MKx]*0x *24X$ B\Dx])?[8K2 CF$7E@F7*D4S/BD7hhxg+@̀#/2/њ0s+))i0h .*0n+s+H/F!F0h.!FF0h.0Fn+/!hi8\FO5{BݓB 5n* ]E !F"0h. F@F:!F0h.ښ0s+@Fi / "!i8F F)Fȹ-"h9I.&. F7k7D F7f0>DB!F'- +OBYF9F8F6%Ha+F$I8;s+rF.FHp+#l+@ЀO/6/4hQF0h.b)0h,Z)F"F.F"FQF H8+O JJJEJSJ\JiJcJ}JJGJ$-(!FH8(FqH8")F0h.0EF pxK)FIH 84,ݙH+JD_E n K`K`K`KH7J3 ^*H h  H76JJJJ~JJrJJxJJRJ*-AFO0Xh!7!Fh7Fh(F!h7u!F i7pF@FPk;F"F1F_(FIH7 )F(~JJ-AF+FO5(F!ph7<!Fh77Fh(F(FWF@{9FF!h7!0i7!Fc+ #NxF0B 61FFIH7% GJJ*-EFO5(FXh!7!Fh7Fh`(F(FFs1FgFع!h7&bFD!FH7IFF'D;+ܺ 2FIH7;FIH75%#!F F  @F" 4FAFH7SJ~JJ2J-A*FFJXh!7|!Fh7wFh(F:@FF8k )FF8IH7 !h7V(( .F i!7OFN4+F9F@F1F@F7 F6OztO0GJJ~Jx F**O07!,,,xh7,O3@  x*+!07$+Cx{+0FF;}+# p*+FpG pG-MFFFF6SF4Lh BF(F!h6-(T h6EEOeh>PFF8FF F6-G @ 8 (Կ  (̿  C1FPFz1FF8Fu-! #XBXA  B  BBB  4\E)FH7 dkJJ*FFh (F(3 H  (hahho@ #O02J"K`KhK`pGLJ<JDJKhK`KhK`KhK`pG8J4JLJHJDJ@JKhK`KhK`KhK`pG4J8JHJLJ@JDJ &@ DO0pmF FFOa αp I   FH7eO5$pDD2J+FFH~ I0F  ?(F!?4!F"F H7A!FH(F mpJJSJJJJJKh#JhY`ppGLJDJ#I/*D?pGDXJ8 K Mh,L (8(x < tJqJXJ-MO|}l 5fGFO6 z@%TF=r   (fc(r(p  | Qh9JB (c(ܠD!F5Fȱ!F/H"D7(FP8(#0+d!@F;). : Ff!F5B3#D(&FB8F|Bp6#F:F1FH7s!F0F]!FH (!B F: :(O0 |} J=[J JJJJ8HFF x1PBPAK-``h"!7FH7/ F8d$F  Ozp6YJyJJJ|JJJJJZJJ<J!JTJPJ}JxJtJqJpJ8JJ JXJSvJh F tHB8F`S pNҲ@#nI `mInH p#!mKpeI hB3 ` hiH+e~!+1qc!!+qqaЁx_O 9ɲ9` !+qZx`@(HXH+pO@qNXH+y O-1rEQI@y+pO#qr?N!+r=1 +r; +1s:"#ss #s~#'s3t#3p spY#O p{p 0T07Dp+?(A@'''''' ' ' ' '#3p##'spY#pp7q0 00qsqqBI Kh Khd' . NOzp6?&"KH`1F Fx2F1FH61FH c!FH6{ K`$J4JxJXJtJqJ3JpJ JDJ<J|JJJJJ[J*-MFF:KhPp!0h B)ph6JhDh6F!F : ;F)F"F(F4 K5DPp`O0 JJJ|J*L!Xh6u `!hH6 |JJ* 3: FF!H y]O00Kh'`hx<05*(1FchYx-=Рh 7 6-h 9-! i6->ѻ7"I5p}H6O;XF!`i6~<0i+F-VF&$6@pOBO B ;!F :=H;0!F :w!FFZ( ;FCF!F\K\I ,(F!FXH[F64r+Zѝ6pO K`>K8 :K`:K`~Os*F>0!F >*F!F9H6O 59EҺEаE3H6p4䲺EѰE*F!F.H6d>,H6_5Fw+!O 6@'NE8Pҡ*F!Fe0*F!F0F6EO 59 >0B4m+kO 6@ONE8PD|JJJJJJJ]JQJKJJ JJ~JJ!JJ JJfJ[J#*F@0!FH6!F0F6)FH6O 590B4䲯@0#>  @C*F!F@0(8F"pI5(@Ā80 +؝90 + hH6O #F6p EbM3F9F@"F9F(F6#O 64 ⲓB +VH6{߲TN3xB BAFC3LLHh"F6r#3BDH6iFK6B #uhCHUk@CF6Uj1*Q@)@06J7M_*F! "3H69+H6630J*)!F(Fk,ID+KF*H6Dт!F(F + !I"J+F!F(FqI"I5(-h@JJJJJ!JhJJhJJJJJ=J JJ7JMJ8J%J]JsFFF"6VFB0`O0p x-* HJx:"!6BF #`x*-M*FFF@n[hxKh Kh KhKhKh Kh KJHKFhhHx5V(1kh[xx+-Ѩh>kh 3ChCj w.[j+gr.щH  #7w.=/&U'!6GF#r.7/PU'.!@F53F(;Р ZFAF5 `  # O @ D( 5IX*O4t $  A$ETD)IX*4[( Bk $,4B$,XI4CIX4=(R$,  `$, HJ}JJJ!JJ-JַJJLJ;J=(J`J}JJJJJIpY44uIpY4'4n IpY4`'4f H ^~0F5.HOO4Of JS J_JJJ:F*h$+C4K!h F&F}2F!FC F(D1F,J,H5)K`i0+?!F(H58F!hh5g!F!hh5`!Fh5[(F!H5'! FF!hh5H!Fh5C(F!h5<! F1F J H5(F!Fz H5O7HJ\JJJJJJ L! hpC !h 0{+ = H HJJ*F5Xh!5!Fh5OF!8h_Fh#F2F9hH5g(F(H5_ (Fr"F1F F K JFBF H5L` O0HJJFJJ\JgJ*-AF?Xh!5!Fh5!Fh5hF! Fp#F2FH5(Fg(H5  (F;F"F1F F K JFBF H5` O0HJMJFJJ\J}JpFK!hFF(Ch+H5$ Fp.!hh5CF FPF(H5BHJfJJ*-AF5Xh!5"!Fh5!Fh5XF!F*F#FH50F)F;F"F F K JFBF H5` O0 HJJJ\JJ L#h+g( ##`! hM0 H HJJ-AFFF" FWI dbChB -сh KB h;F)F0FFA`GO0 LJxJ𵇰6F' PNhO,<,3B l0F6 KlB;FbhH5j,<:JJSJJ*FO0Xh, K`( 7u(ahH5 H5 甸J"JEJ-EO F@PKFOHFFg QF5*JK`- -y-O5(FiF`h5ehF(F4DB]J|JJJ> JJH JԌJ+JJJJ. JJ5 JJJJJF ,F (F $F -M(FF}X(\&O 0IFZK"x-* F3F(?6BO'I6B; (A,;!Or#"%;NO)F s I+F* 2F:F4}"335- F"  H4O0 }ODF / JSJNJJ J$F!} FF!FOr! +=jF B !}"Fh4FxùF `(//JOq 4. h h C#FJH4$O0破JJ J-A*FFO58IXh3Fع3+hh ( . id(F"+H4%)I`h38"A$I`h3F8"AaI`h3"I`h3"I`h3~F(.FHLKOXJJBJUJ-E*FFFPF E 9IXh33F&=4--4HF8 -.HF-Ih3,Ih3F*Ih3 Xh(H4Xgi!H9F%ch!h@F4(AFH%#QFJH429F(H4'2FF  JJJJJ6JJuJJJJFF F"!hF4Q:hFhxh`"#1F(F##` pG pG*-M@O O7FTFV#ر3+  BU 3vlJ( hE$@  *%*/5>M\l|hh3|d d @(,  (W,9i lt(Y, F?H3{ ",!h:H3o "/U|"sT#6U!chF;+0J1JR# 1/H[3P@F22( HSFBF)F'H3@)F&H3<,  й (' H3&PF2(0F2(Cl cF (  ()F F\#;p @JJJ`JJ JJJNJF "!hFliF F8FiFt RClhF Y I(Cl Gаq ?$?Os"F(!FH3PJ-MFSH31QI@QJ F 1NIOCMHNK F31SJH3(FGH3~,FO1CEBHM3q?H3l !ta(F(DуH2H2рH0(HiAF2F;|(F 4F@F60F3,uI`h16F(Xli[ !F6D?4$?@4 nF  G AF(F$?B_H2M!F(F JFxiZHF2?RH290(SHFNHzAF(F#F Fi@FHI`h1(I#iFO4DJ{`DK E&11F(F 0GF`xh$1i8H(Ri6Hx(K1F3He(D1H$I(<.H2 60B  )I`h1(F%I`h1}(ޮ(F&i g0F+H2'mJوJJJJ6IJJJJJJSJJ>JKJJJJRJeJxJJJJJ J-AF')FXhx-*%JFhD3`>. (Ff+O?+#F9:FAFT0c(%O50JJE8 *-AFFW I "XhJ@hCF:F1F(FFA`GO0J#0 FFJ /,H2F F 0 ! H0WH2,FJ/-JaJ*-AFF[hx-*[xa+!<5, '&DBKHh-ц 39F"<7"F9F BH-0 C0 HxsJJ*JJJJJJjJHJJp!F"<,S_.x-.iF FQ!o.a.f.нp@ "),FH pJ*[h J# /M@ ]O0J-EFF.FQ_+x-+ =!(F1;Fx)F7H2] >?+f+_H1J.h`0kBF(F,I/\ 0 'Z'170BD FF!FH ;F &P+:F)PE&pџBKW# /8F+ K)FhH2O0J0JJJJ3J0*FM00 M0hhFȱOa FJ2"!FH(kh!x J#A"iF C p#"iF O00JJKJ*FF")O0pGKhpG0J K0#0Or x3iF ]iF  KJ-MFh#FFF 'F^F ;-`h x-)4!2*F!>4/OP"9FV:H/:7K8Hh2A s)b) c)O0t)+S '+OF#)dF+EO PFM}!24FI2Ho ;OtP"!H/V۸9]* 8`1 Hl;F"FHJJJ9JJJ=JP08 pG"F!F4@ Hd "O1GVH13JJOzsXC1ͺpG pG LFg|0>J?I`| >HQ`| =I`| Q02IY0ZF)FY0 YDO[DZp(F0+FbhSh`? к Ѹ6O q /#CF# J`6R&0 F F (.d+bF*.FJJTJ J0=!F0Op0Fk0!XY_F!0[YB0FY50XY(;#tJ`**׀@΀OXh/@+%F!/F!0S'0B00F;0#7 0S'0 F  F( *kTHpXXx0+(;#  D# [/(F0% #+T(DBp!(F(F?Kh{oJHl4  JhF H0.-&FH0(H0% ]JJ!J'FFH0 F J X \ X <I{@~\  I K J[`P$ D$ !<R JJJ  pG pG pG pG pG pG pG0M#30.FU;@P@GF(2hIH0.QJJ pG#lFJ& FH0@0J0JFFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;!-E F!FFF&!FPF&CF:FO OE&pHC-R{?'`(x ?DDpp D  3-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFF&(`L#9F0FJ%Jh#`#mJ-MFFF& !F(F S+ +"9F(F%EIFEH0O0!1Fu!F(F& F ;FR (F {+ +"!F !F(F $%F ,#F#FRK$!"FF( F D4OO E4BF1F)?F D{JȊJ-MFFF%;ۺ ;F2F!F(F M&bSF2F!F(F%(F FFFF%CF*F9F0F&F, F&z*FFIH0 FJJ7F%&fFH0HzF$ F0/0#F!(FJ&&JFHJ0JJJ-MBFFF$ F!=J(F%OFFEAF(F%#[EBAF(F&O8:FCF(F&L &F'H0mTFAF(F&(?"O !F(FJ&&6!F(FJ&(F&FH0?O!F(F J&68F&FH0%JsF%&FH0!(FJF/03F!F(FJ&H &|FH04F Fp H/0!F K(F J&1&eFH$@JƾJ>JPJuJJJs FFP&F*FF!FHp@0pJ-E+FFFF #2F.I.H0O4 F%&&IF'H0!(F%J#!F(F K!J& &CF  B \ C# CCF:F(F!FJ(F&% IF H% IF H0ETF03$璈JJJӍJqJBJ}J#iF#]-M=IF%A(q&:O9I F%9F F%%FB))a# F%K"F9F.(R9F.ع+I.{(D  F ȹ  E! F%5F0'CF+(I/0Bx*  E#O )F FJSF#)F FSF J6 JJu0J}0JJ J FFh%$FB !F0F%#+B!F0F&~ hQ3j1 D DD$d$#s` F4#2F0FC&2(KyJpF IF%p1FF F&k %FH/?-H/:H/7 FpsJJJJphF$H/% p F%0%FH/ 6ai )" H/i+ai"H /H/#+` JJJJ!JpF( H/$ FpN4hB)F.($hJJ"K`[`K`pGJJ 0F("!H$`d` F8Fhj[kK(F0)F H/O0 KZh\`#`Kb``h 8`>JJJ-MN`4h\B@F/%H4W?kZh)FPFh/uhCYh H/n5 -$hXF/fJJJ!JJFdK` !FH/M JIJ8 MF(h0!F0.(h8 F( JKhpGJ-AFO=hB1FH/ $4X?[hK1FXh. 4U$4 ,-hJ"JKh0pGJFFF ;FO21FjG(( FFF@3FO2)FkG pMHN,hB H Khap@ H1/0F/$hpJJ-J!JJ3J-AFF" FF O0Os@B"AF8F (ѽ0DA 3`+pp" |0H/r ]O4  J7F FOzp0 ")F F Y8H/OH/L Or0B@okF")F FAH0")F F 3H")F F* HL0 @`d _]JJoJyJJ7F Fp")F F 0&H/&H/ ")F F !HOr0B, 0Y kF")F FH0")F F H")F F H0 @yJJ]JJJJ#"D-1,*AA!+1g" BoBg@ɿ𵣰, GFF0$?bp 'pb 〢OB)*(9+Ozp.|>93 #oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H/ F }F1FH/o")Fp$JJ8BhF* F#1#f1 +g0&+%+%IH/o@!%fg+*"HOzp.@+# f8###JwJ-EFFF%<@x#hn"A!d# F#A (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F("#xcx#Ie\B3ZB\\+#xB F#p#(oJ+8FOEY(M)` o89=+Ozp.Ko3 TopG7hn&A!OsG"#AAF(۴#I Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H/o"p1FH/`JҠJFFʲ!q#pp#&QwBH/o$ED&1+ 3nhC$Os## "DApXJd#0hn#D$!# "DA00hnD$d%%C# "!#DA0-A} ?FFFF$?˳³#p(z#FF(/#x+,O38c9#FBF0F( #?4ZB"F*p }Bcx+#x;4F?#oo"-MFFF(Ozp.1F F?@ !?F;FF1F Fڴ !H/(Fk>F0F5Fo `ix)ЙH/<*x *FHO;)FpoFa^F1B!9xzx*T0**? )ІH/|9BۃH1x[E3Дa.~H(F%Oz1B&O @s F19Fp!# K%1#&1;xDr#C&!2&!) )`HADB^Hs]H#sC%ݒXHl %p D9F D"sD\HxB"T Jp)HHuBFHwpк?DHp# p F D9F2F)F F560B5l#hn FA!d##!AA "PFH)+H/of gBp.( "1F@F&H "1F8F1F "(F! #BF FV! #:F FN)?Ǯ #*F FD8J~JJ£JJ J%JHJnJJJۤJJ J#-Ah`FFFBF0 H/L F1F(FZF(Ѹ(F6d#ih/`#"(FAA H/#Bp.V.(FA/!(F)F(JåJ pGFFF,Y(FMCh+h;p$9 iv(H.#;p3p(F6iFJd#0hn#D$##"DAb0d#pA, *%)%hn#D$-DA"#ACpd#0hn#D$##"DA,0pGiwv8 pFnhC&d#"#FA#AF , 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FFb۸@(F"1FojT9F(F(('O Ozz (?"1F(F@< .TBF1F(F(۸@ 7/O O41FH.#"1F(FTco"oг ""1F, K"1F(F8 F@"dJ-MF:},  F&?(L`"1F(F('7x1F / '(F:F(:F1F 2yx!C#q #r" &"! yy3+r@szcsx 9y"zC'1+"!(F#<0`@// /+hn"A!d##AA(F#A((F[(&@, F(O3c&gz 9B򪀤H0"F.B8F {d/d0&`azp a 9B&O 9BT0+@#0KhBT 9 ; g#? J BД D{iB1F(F ^({ 4;iB#ihS``#2z+"srzbszsA`/`@h#1+?X@##dS@4S@s,9i8F#c1+l.+hnA!d## "(F #AA/(S :}i66"1F@FI61F F_! (IH.{o `D`{h `z``a6`O  C F:iB"ihJ`` F`#ah ;I"1F(F Е1+"1F(FAF(F"1F(F}+AF(FAF(F["1F(Fg?."1F(F^"1F(F!i2*a1F H.#0 \oYJ`J(JJ<J1@9i "a pGFhhnA!Os#"zAA"!#R(#h9%H- hazhA!nCA@AA H- hzhA!nCA@AH- O0IpF "!(F@C h0hnA!Os #%#z*FAA!#H- hazhA!n NC1CT hzhA!nC1CI(F p`-Mx hFQHh Fn\BO$ kzD4 CD@DD#&BzD4 CD@D0+b !F(hFO CECFFOs !FSF(h F(h 9+LЙ?!F*h9 E&+h9*;&(h"hnA!Os0+zAA!#_(hI hnA!AA+hI0F  E 3ЛF  Dѵ`J#sa# F%0$0F j hOzuisBp-=ѣi3H.{ao #{+ 3x++ 8 @Bp#++O0 5J-MOF FGFO а G&?)F Fk{F+@)F F+ L0+M0+ (Tл +h9(FjGoPk{+< "!0F#3p0)F[sp#0F3q0@0k{F)F0Fe+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x.O0H-F:FFo(ۙJTJpLF "! F`0##p0)F[cp#0#q@0 #0 F+kG`p@J-MFFFF*eY F`F !/Lz `4POcUE(C+ #!Zi"HjC "`*"p"pp qO Rbp0YF0 H%rGȱ XF" z;ѧ !n u8F  DD@J-MFFFF*e FOF N!@/Lz `4POcUE(C+ #!Zi"HjC "`Y("p"pp qO Rbp0YF0 H%rGȱ XF" ;ѧ ! 8F  DD@JOshn#D$"#DA-Mx FeI ư W *F'?H&?4 hzhC#n` CC@CVK3`0s`Y0`O3s0)FsssOs  #2F h( FXO0FchA0-X hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz`J0JUSBCUSBSst Y% N0 H. phFAh0F. FR5LJ-J"K`pG,J(H.vLH!h.q h(̿  @B_J,JJ-AFFFJ&!1+Cі"1;+>8"AF F'r%`"1#s#1+cs%P+&?J?K!QbF#"c !B ܐ"(Fczzc{ zk!{ +-1H.0J0K0H. +!*ё*a6Lbrr+!*ё*!r.!% 3 1zѱ%0+#%0#h(FhnA!CAAA!bK$9(F( ?O# I#<J-6JܧJ9J6JJ6J-MFFOO °~L *? hSrz0 "! F##p0[cp$#0#q1F F3kGF`lH-zO70FB0+єL0:+єM0L BaH-ck{+х 8FB\H- /YK@Ԛ0"+# ks"E  "Z#O $0U0^0 "!XF0"[cpO  01FXF3k"pGF(sh GC'?s`"8FpO # "!PFy%""p Rbp" 1FPF2kGx;!H-shO4b#s`Os#;h{h2?!!?#""?A!!/!!?4##'a G@J J¦J J-MF , A!FF(F#(f0h'hn _A!Os#$?3zAA#"ABؿFOȿ;FZF !-%#Os0"I, t#F#FCrr1F(F(030F  F(F(7GE$ ItF((F矢J,JJJF BoS @B0-MFF,F$,!,4F0LF0PF F,!V , F(#;]F4`!XF9F@Fr8F>@FhPFe0F [F!F0F( 8F(F$ 4BPF>@F;,%JKR'S'B'`C'@UE@F) !F0FX% gBF8F65pJpJ-M'F"F[&B AF0FT@Fo5 I,!F(F,(F,FB7!F,Z&Q'@,4 F,(F F,AD@FF(@Fo  FpJpJJ/J-AFF(FW O%hBoT H,F-h(< 4`AF,(нB+h,FU Fo-MFFm(}){Ѓj+{h+VOFh  #i FG'FW ?hBѣi+Cbh0H(+%jB,H-biJS  +F-hS GU ]F,;(=kh 0H-so m#h[h 3`iGF(%j+hBU FhYF,(=oojJJ!J-MFFF(CЃF[ @EF F80F,K ` Fo Z PF$h(ѺJ|1F,(УEF#hТFT Fg`kjjb``j3b o-AF, FFFSF#`Ba aG`aab](F,`8 F$ F` #bcbFرFU ?hBѠhn Fk S b8F_3F6hoii+"#aD pG:B3F FCa +Ai1 )Aa !AaL!)$]ɲ"*V.g+ɲcG,jрS*.Vɲ+T9,рDϲ/"ОFJ+Q\)@Ѥ:+3ؤF+.?JT*)ٞ+S,9,G,Ф:+F,!(F=,'O!(Fz.+ɲS,рL .DɲA (F_s+ɲ)[!(FRA,1!(FL>,5!(FF~!ɲH, 2!(F:C, K(F#DI,N,??J,?p!0[+Ѝ"%0(~(ѝ"01;+  "02+Ѝ# 0+ٍ$~(t% OcAF <$B!(kD ( C+SbpyfQ 6QQQQQQQQQQQX+@1)K+D"FF)D+b !FFH,  #F<+ 3DJlJlJhJlJ\lJHJWJ#$ 0 <,цCB(]4|,? <Bo< k1ZFF)D+YFFH,   QABMJH ,o |;B>B:jaH,\u <d,)?%JH,H U;+(1щKh*Q`1IH hh`hB` 7KS!@,)q!F(F+(F+F(?*FFpJh+pI hBmH3h`BĿ#`hBiJR#@bL 3^J^H, ;+K\E#8F+U+XD@)F8F|(? OcAF!+?2hHK)FS"+53hBJ3+#h3`Bȿ`@Jh3`o+}F8F,F ?Ʋ .# .'S&TJUJUJOUJUJUJUJUJUJUJAUJUJUJAUJF.G.V.%@3Bw .i#8F#pI(M,D#H#pq`}#O0+pxPFg;CE#,FWJSJܛJhJlJlJ\lJlJJlJJ!F(FF+~x +y!F(FFoKD$#3k3]3#`0 M3J"I plJ-Mm FFF+#$"FFMo-w##p mGF+k; '.\)k=XF1FF\. \)`8ЃF1F`++'.\)Dk=#$.\)#(.9{.7-"pfp%4=4).}.iF#F >sEۼ C!$"(8?+-;=3#F#o\++Ы#-MF%O@@;`[&0BZ&0S%@ kK FG(K`5pJpJpJpJ-AFF$( OX%0BW%0S$k 1FG4pJpJ-AFF$( OX%0BW%0S$Ck 1FG4pJpJF$ONW%0BV%0S$kG4pJpJ 0+ 0Y C ppGFIFFF+_` FI+Z0 FI+U  0- 59F8  !FH,| vJu J| J=J-MFFF$\\Z%0BX%0S$ѽ0YD:cSBSA4 "B9FXFG4I +[ pJpJ҈J-AF F$, OB4, *FX$W$( pJpJm cS+Oa,Fe F m@pG 0+B7F @*0ս@ ;@-F @˿0ս@F ξ F@ ]_KFؿ%O2FĿ PUjlB D!O5(bF @ ] D$x1K  B0 pG@0 ) pG8FM(h0 F +lG#+`8pJ@0 pG F(j# FGpF F(j F@G(1pG Kh 0+(( K`pJpJKh`FpGpJKhpGpJ"K`pGpJFF}hB 8F Fc)FFH,'F FF(JB$P, F8|HH`| I`| H`| Ha| HHa| IaO3 qJ=[JZJYJ-ZJZJJ"KF [h LH!hHHahHHhq@H1H,r1 H,m H@1,f qJ"4J*4JG4JO4Jm4Ju4J J-EBI | AHQ`| @I`| ?I`| >Ia|0=JaF;HF:H9FF k0F7FJ# 3>Z%(ѻ[F !0F *5"F)FX+5@xC  ;kEPFX+*&&O _JiJ7F FF , (O KOs H0(OKhhOs}uJSJ-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F)[8@F)dF$5? U,F$ F5BU )MPERF@FU)(ѧBJF$ FoSJ-MhFIh )F 00F)%1FȿH̿F)(FK xF , ,t5A+FK< , ,- "0C,-OS x$+JGи D#wK!Os'(8(Z0U )@F)"F@1DB/DBt$t0DYByO *lD``WKXIXH#AC*FUH 8-?d  _(и  (NpIXF)oFQZF#2E3BF۠ lи 0U )I$,"}PFU7 2UDDs T!H)%FH)!N%F\ pX HH*0 Y0FV) '{M+ HLHIX C=DXF>nJ|qJ}uJNJJJm۶JJ!J8F F)( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*ء7BJ;B4#*4# 4#4zCO0Pt '&%O wJ J_NJ -MFFFO zL)44+.+BO +404,04B o0O34PF4F(@)є+4 +$ 4Bj#DB*4 $C4444+Nє)4+4+ݳB3FFF8F 4v[44/D+DD4$4\- (D<+4# ()о$4\- (;48$ DB8$[4;۲B8  \$A+. 4+#)4>(4+  C 434F #)4-p+4?jP;o(4+  C 434wJpG FL4;+        7#)4G(ڽ@H)wJ0&KS HpGl`JJpJKFzL#DBahB40FciGch3r Fp4B$JJJF$ F!(-E{F+OHEYh7)E)BKRHHE)&)G1)DHEZ4t)b)C)I)|)+Ѐ)ZEzAz5H)5H c{3H!{)NKMMMGMI-HEZ)(H)Ah'H'H'H&H&i~gio %| tC  kClC I$ F)F-OX: FSFOH)HHHH)HbJ[JJJvJJٰJJ+JFJJ!J±JJJJJJpF#N#rKM.DB FkiGkh#rp5JJJpFF(!zp@!H)Dh Hl#hI+01+++$&+,H7+C+H |+ b+t+H+HHI2FahH)+i{ Fp@GHHHHHHp$J$J%J(J$J$J$J %J$J(J$J$J$J J#pP0FFFqPh["F1F(FG(opo\o%8% F `iK`Cid`,I(DI (?PP(F8<J$J-M FF.! FF(F F(#,U FF F) Fx{"F9FH)o(F;0FF PF)Fx#RF9FHF1F8FGF(#0oYF(@#{+#hC+ F籏J׏J-M F!F`Fx"FHFH)"FFcT4:FYFc ZFrH) FF̱#x FnI( F)pFx*C<*FfH)o 8hz+i+OZF`H)o 8hz+%$2F!F8hF`l-f*fѥBx"1F%F4,-ex"0F,FR8hz,ТGc2F!FF(B!FBH)hi+,ZF>H)o\ [*+BiO ?!!?##?A!!/!!?4""a1F8h.$*,6 "0F"I(&@1F H)YwH)U9hFJi? ?##?@ / ?4""aJJJJJ)JRJJqJ<JАJJ-EFFFFбh۱$ hB2F!F8FhG o FQF@F((4O4o%O3ҿ-MFFF FY#!(F(F((F("cTFFBF8F( RFYF0Fr FYF H)0Fg BF)FSF8F[*F9FH)"J0"J7F,hFb,C,, KJ7,Fkha3 I)i0 KJt,FJJJJV&Jd&Jg&JY&J><J^&J-AF FFDhF<08F/hBbBAh8*F0F0!DAGo% -MFF FFhF<0@FhBbBAh8*F;F0FF!DM`Go% -MFF FFhF<0@FhBbBAh8*F;F0FF!DM`Go% FM( F@ -AFF(F(-$O`!F0F :F !kh)(AFF(Fx"@K m04, *!J"J-MFFFFF3h<0{0FtM((0F\GhWDki:F#F&0FCF"FQFGBF ki:FF[4F FWFo%-AF FFFd#h<0k;F2F)F FFA`Go%81FU+-ѐ1+)#FrI  34, " I6( 8"IR(( O0O0SJWJCi#s#@3 ?%?+F"!F(FO0F(F(cn+1+fff-MFFFj0?#?@ ?#? TH)O07F[F"@Fy`A(yh FKH)!U(Ѫ*FEH1;c rF |(x@>(y(;лjB813(1Os`j+@FCC D#`ꉫ1FCCc` .I,(+y,ISBSA*x[*Cd:k3FP)1+yu0 A(y8(65eEy-(2bEXF(v%%`0Ic`Osd`,(PPRCCSD)FFFO"J"J"J<J"JF"#F*]-MFCi?3#?@3F F:` PH)7F W$?#F"n(*FGH) F(!BH1bx{DF!y)c-=($#y+c4\Eј0*+Ѹ 0PFAA;hDj:h3F- FEѩ)c"BBCC*D{`)|-о*`Fc"BB(C C{`HKTF j1F{hH)V-6)H*+єO"J"J"JSJ)J)J)JFH)3"#F F21%JF@i Fci-MFCiFoFFгvM"+F! F(+x+'2FahoH(O:"mIh'@/3FbhiHi(O 0[0E +F"YF F(+xk"\I]H'F/3FbhXIYH+/2FahVH  H0G"K+I0 FKKJ0KkYFDKz(/3FYFbhGHRFYFSF1 2D*+/2Fah>HU++/2Fah9H9I,'1F  F@"! 0 +{Bш+/?hbh,Hb1 2op(D+/?U1Fbh#HN0+"#O4s0 aiћ0 PF0Oc#Os{J"J#J#J;#J{J#JS#J#J#J$J<Jh$J=$J#jF!]𵡰#!F0ahH(! H(% N )F#0F5(#)F F0%J&J;&J# Ip" F M0#\.#2$*;#$0HpJJDi!FF@,DD?4$?@4 ?&?#F"!(F(?.JU#!Brty+S@@(2B 8FO0F`"!hF"iF F'8 FC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : " $0"Caw&0Oa+w% p#`'01 005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCb# tctCtt-EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF P")F@Fb{#{!FC#{(FCC{CbI"F @F6SEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PART-MF HF(|,zFi@1F,f?6&?@6 ? +? "[F!(Fm(F_#FQF(Fe(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF F*iin"8F8 *"9FPF'2h#"QFkfhlQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+nff>QF0F, @ yF(ii0F,I0HFA!J0KAAAaSF2F(FBPFQ P0UC#R CCS CcT B"VBBWBbZCQFY X0C#Z CC[ CcB  IGNOREMEFm Fqi8F,+F"iD0F( ;F"F0Fl O0O08oEiF Hp )FO0,r)F,n(8 8di8!F,d!Fn&Js#F"F F( "i# FV:CXBXAp-EDiFF!F[ F,:C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`si`yJF ! (I,'"I F'00@ @[H@"dP'@F 0J<J _J-MDi!FF[ +%D?4$?@4 O&?1F@F `6(EH(EH(DH(DH(3mhB7F Fi5(Д!0 B""0BB#0Bbz`%0$(K+&0-KK'0Kk)0A!*0AA+0Aj,0C#.CC/Ch F[F)FzhH(100 5B"203BB40BbC#6HCC7Cc(j!F H(fH(a[%Jy%J%J%J%J%J%J%J-ADiF F[ !F+D?4$?@4 $ ?(?:AF0F|`z(F )F8'xh F7Fo-Mz`FiQ0FP F@ R0F@@S01F@`8+1F@+f?6&?@6 ??*"?F{"!(F;`{(F;hH"!p;`aJU";h&!"ơ!a*i1F:! !(FRFm(FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh#Y0Cb{Z0#{XC#{CC{!FCb[0Fd# tctCRFQFtt#F(F(Fo7FI0HKA!J0BFAAAa{h(FE F100BFA!20(FAA30Aa1{hEc~!~~A!~RFAAAa#F(F(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbAi+lE W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(F"E'FF"0A !H0 8DB0 H"9F   B Ppx75Q2FD]"qoLoIoF^JE# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww siF;" 0! B" #0$P%P&P'Pi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/08#P0o"() B* +:F0FLPMPNPOP-P.PQPRPSPT0UPVPWP%tetttXPYPZP[P8'@ @B-MDiFF[ !FFF+D?@ !?\F"F!tiA0!F+D?@ !?GF@(Fo  F"F!CFZF)F0FFxSF:F)F0FF(:F)F0FF8F(F#F"F F(O08h#! P%E%"2iEE#:Ee$A!&AA'AaBB0FG8O0-EDiF!F[ +\%D?4$?@4 G *?  U"#0FF2i G;$?0F+F:!F azh0FZFO5-MF"FFFHFйF$h 7[EݘQP B"RBBSBbZEEH'*O:PF%"!"FJ8 2B "9F&(:F5H'! $A!" (PAA# ,`Aa% L,& LL' Lc) E%* EE+ Ee- 5F&. FF/ FfFjW\fBBYYE3FPH'-  4x7oW ,*ЃBB FH9JXJJJ#-EFF `FRFh,=,3B, oo(FNhFB ChCE(F.ȿ$j,=pF F$(h(,o Fp+hB(hF((F8FF+z F\ 8#JR3@BHh3 +HtJJFF$N(FV4&@KS4`s%(F4 ,t.O>&(h,<,3B FChFB ѠiB F(jtJtJ$F%F)F0FA P;z;4 8F|5, 'F({+i FoF$ O!F(F P3{+!F8F'0F`4J7 FF0)FH'L F0 J7F FH'z F)FFЃ H'lo F0((F'+{+oJ*JhkhGo%pGFpGo8F F )F F8@׾8Fh h F!F(F8@Ⱦ-AFF FFh,<,3Bo FhBChB@(FjF h@(]ý ]F0!F@-EFFFF#hF<0#Ci:F3Fm0F FCF2F9FGBF ki:FF Fo%-AFF FFq#h<0k;F2F)F FFA`Go%-AF FFR#hkhS2F)F FhAGo%osFF@3F*F!Fp@posFF@3F*F!Fp@posF FPoh,<,3B0Fp FhBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% h,<,3B FhFB BhE8Ft`\Fjڣ F?!!?##?A!!/!!?Ea4%%a`argD``-AFJFF!ChT'V&FرF F1F ;FiF0(F# F uo J8FF(F F8-A!MfF4FB6h#pE qEwErEDEӤE ahq``!!`)hL`,`, J Sh3S`!iPi Jh3`(JJ-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0FEap FM :F(2Fi #aeaJhL``h2`J(J-MFFO OXhF F  Ff!lF FJIJJpFhFPAhi zFB #SChЍh I H& pZ%hX_Ih6 C_Z!hP"JƙJ!˿!ȿ pG8?0 ?!F@ zF8!"F(F)(F8F8@ F(IH&E FhJJF(IH&5 FhsJJF(IH&% FiKJJ-M0FFFF#0xhF(@P! rF(O24Ccc,bc `Ca <dcdabd[hZlCh[ldh) +l H#(;ks cl Ccd9k*(𜀠`[hkQcl Ccd( a3hk3j[hlIcl Ccd(t`k4cc#d` F!Fh.E[hh+UѸXclC@cd(F FGF( F(ah,H&dUF&#lkS``clc&d F`cl F!##acl F#` F3hj+ FGF(лi+ FG(ahH&' FGF(@o o o oo ^J,JFhFFFFl_ O3(F#oO0$4#F(IH& Fi.JJF(IH& FDjJJF(IH& Fj%JJpF(XClԀi&hjӱ F1lj&o  FF(cl%(Fpa#j[h]ke F@#j(F[hYl(`bihUkj[hkU F0(F1l(Рb#hi#clCScdl* FGF(йosF(Cl$ Fp"  F((F.hF(KѨi(-klCkdi+.(FF(;ѫi+/l+!(FF(.3i+3(FF(3!(F;jh"I"H&Fklձ+j[h[hT+(FIch[j+(FGF(kl(F#kd(FGF(iC+j[h[hT+(F I@"F 9F}oz绊JJ5J8FP4O<<#FScl F )F Flcl F#! Fdcl F! FV FFi+#lkS``c dcl`h FGF((F8o-EFFO U4OT<BPF#hB FF8ahH%Fk4F<燲JhFj;! F#j[h[kC F! Fi{hRkj[hkC F|! Fcl#ScdFF(oCl$ F" -F(F2F(FiF/h;l oB3B' ZL(FF({i+is;l _KF0(F"kl #kd F( Ooto(FGF(jh IH%Zhj+(FG(jhIH%Looot9JJղJ-EFFF'ozT4Ph_/@p @Mbp F\bih3F!(FBFh_H#2FX!(F`_Fh_1F(F Fp 8F0F(Fu `O3 Jll``# Jll rJIl` 8o /J:JHJ-AFjFF!(F:hF!(F%hh&z_OD `"9F(FF_.`_FH'Jd1F(F@@F`&a ʚ;-MFF"F!  ,ƀ,À,RFh9FF  )40,h0  `-if/:R+F! FF(P?! FZ+FB>F(=)F FPFh DL9K0_`_H#*F(! F`p!.տ""X!P!BH_` F*F^F()F FFh_+>s)F FFR+F! FyFH#H'FD+)F F*FF/: _`_(!*F F`WFF;_`_(!*F F`FO:wpF"t%uh_b"Bo=_`poohB`ؿ8F"t%u_ Kbj_+ F8@¿"}Bo=8>|8F@2 FB"-#-*bi*BѢi*?hhxi_+c_*a_#(Fbi_#p @ErBo:#ko8-Ѣh*hhxRx_c_a_a_N#b8@o8FFF F!(` F<_! F_1(h_#`_@C`8@a@2B F-#hDD_c_#b@B@ErB:#oFFhiB`h@"ʿBiiFB`ii 0+ИG(FiciB*#aD y0+ FG(O08F F"!w 8@lhkhGFpG@lhk[hGFpG8FihF "0"W##`Ked#dKPcK!bKb8@ɿcJ5JJJDl F#hmk"@P0h F@Go%Dl Fr#hmk"@P0h F@Go%FFFF:F1F(F<#0#FYhkh K@ @BCCC" F#cFOzp"#" F FO`" F7F))&$ao&n Fa 0(*1[hP1hF!O01@#"~P$ F!F( FH#J (KS HpGiJ[J #0#d0 F#" H#`p)Fj@ ѳ* ,KdkAL,Bd!!CBB@r#(F"F0OzrF!(FbCzF&iF(FF8Ro d "P0FdBomFpOtOtoOzr FJC!FG&O(FwpS`o9B H#oE,6Ozp"4F4F,H#om@JJ0c#0#" ] -MFFFF@hF`(FzV(*iB*H#&0F Fao(2FAF F#FFEUF(]F-4""!i bo## FF- !! F ( H#W9F*FBbo /Dѱ"fJJ#0##Or# ]0KBhPB} }0 ?$?!F(ѕ 0BoI 0Bѕ 0Bѕ 0B""(@p)F F}!+ #"!0FvF%- ?%?)F0Fp K*F F }p#oFQ-AChJ?C|BF} ?%?)F_F(@0+Op(Or)F`0+JR#Ka`B@0RBR^#C3BOPpvK(&bB0j00`Z*#k0 f 0i.D g [0#00[0#F0 x,#,'J` #K`݀.CR3#1EƳ 0B0D021BS262 !i4##"F F(F#00[CSR4#0Օ0/ѕ0,Օ0g#00g#i0 00h0'8F }. [CSR&#l"D33o o?hJ@@#"F!#"!)у#"-EFF'_ i0"#!(FC F(? N1F(FqF(F^ F-M} o*FF&?1BhKDJB ٦H"*o{ F }f0ўH@ HOh/58F!F&jF90!FF&b)H"o+i[FO F !FS;0F&DF  9YFH"B k 0# C˲D#tH1F(FxF(і 0B0DEQFjH"{ 0+ՐLC  "OP zFF J_* (њE Ж0RHIF0NH"kO4?+?<0#"F(F(d#00gO O"x!(F۲ҲF(W  O't!(F۲Ҳv(8я'FOZFh!#(F۲a   _73/ќ"!(FJh+?ծ0SE#"F(F;FSF"!(F3F(оF?J8J\JJJJJ?JJBhihB(!FB8FaupG-EhFF-@€xIgvI`#1# Fa#u( F(@O`!(x FF(~#of#a F*F)F F F}F(h F#r0#h FhRK@+ #Os#*F(0+JKc`@77#"0# F(J)#0##hbhhREOCC F+?WOzp!Q)F(?z 0?wj#xsbiF(?{(F #cs#a#Jahd0B2b`%n) F 5F)! FF#k+ 8F&zd ! 5#0omH"o^FJJJFh[hCSCb F0`H"oz! F(#01J-MF`h %(Fb0+_%0P+_#40##" F F(@v"T7#40d0*F# F F(@^ch"+B0 Fd0 #40#d0 F(@DahOcddd&e@a9)9468: FeF(Ў#kP+ F(F[F! FF(@#k+ 0FLzd !.OCc`#ks#a#d0rIa`HA\HP#0 KC!#gfchA+FV@&i5cg.݀;|CC&"3  #>CC ZC"62D&2#"(#*#,#.#0#2#OsBԿagcgBgmck^ "4 " F .#O 40d0" F 8F(w#O F|i0F(j Fqz F|F(`chgI+C7#P0d0Fb F1F`F(H3#3# `1F# F'?F(/;hcyhCE :+:JHOJKFUc`HjbhDCSbEK!dB)DJjj@AO#xx@KBH@H"?M#`e>I>I>I>I@sCs2 :K/KO Gܠ'?#l0#@# # F t nF(ihjCb"W<7O WV ;hFYh"H 2!O  H +#a Q.H "oma0HCoa !0F#v8F "O1(FFLP06FF"O1(Fa\JJJJJpF"O1ckF+Xj "00baa"O1 Fs"FO1 Fl HaO0"O1(FOzp^.'JsF FFhSBjh!h[hkH1 `fbp&J-A !O1@FFF{F0BF9F(F"FH&JpFF F "O1|"O1(FuDC(Fp@ "O1j-A?F FFFh )j;FAG7iA&CN.*FF FAQ"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1o pGF F@}O1F"FFF"O1 F2F0O1 F"O1 F O1F"FFF"O1 F*FO1 FF"O1 F(FlF#"O1"O1 F cCc"O1 F#"O1 F F FOC"O1#"O1 Fl "O1 F@S "O1 Fs"O1 Ft F 8CjF;+'JO12P#"Y#"O1 FR"O1 FS PE"O1 FA#"O1 F: F^ 8yJ-EFEFx"O1(F,gF@#"HaA:hWEHHH@CO(гO #Ozs@4aka0FOzq8F#. _Ozp"O1(FGFF#ad#y.JJJ -AFFH@C#"O1(F"O1(F#FA80Fa@EH=a0+! + #Ozsaka0FOzqG#d. Ozp+"O1(FF8Fd#JlF "! c"! F3OC"O1 Fk@S"O1 Fc"O1 Fdbj" *#sCs"O1 FL"O1 FMbj :*#C"O1 F6#"O1 F/@S"O1 F'F"O1 F#"O1 F F<  pG pG pGHHHHH tJ4JJJtJ-AFhFFFwFh` &ah3m[@Sh|h)ѿ_"aCO"!h_!AC_!` x_L@ 8@_ p!xɲ_1Cɲ_!p!xɲ_9@_rB!pOUѽpFh F&`#bhhZCX@h@h(@pm I.Fh_EC_X`p@p#8Fh FChihhB ڪh[i@)F c`8ooFh`"chhCh!0s 8Fh`"ch MhD+h3OzpXC#+`ch! V 8JpFh`"chhf{ChZh** |hX_C_P! Fi(Fh#: h HX(Fp J IH F(#" hHJIJJJJ-MFF(F]F(F (Ā(FcI_FX'(F^I x`H60hB$E[i@񝀦D YF(8 YF, YFXXFII"F!XFPF0[|["hFAI+XF@I F`!XF:F0FXFF( FXF5IF(!XF"F(;F!hF.JwiF(F F`=;F)hjh h'H;F%J&I;F!%JhF\2FiF(F*FP-;F)hjh hH;FJI0|{;F!JhF?iF(F_FFH 7a7`6 QoJJJʕJJJJՕJߕJJJ JJIJ-EFhj`"kh F(_Fp#B h7H$0F5J5IHFP#" h/H,J-IZ0sbhhZi_bhh#_Z achZh**%jhr|"hX_#C _bh!h|Pm!(Fch|+#hj_C_"hbm+# !F(Fu(F#" !obh#*!(Fhh<JJJfJFh`"chhi#@0]O0# !,J2l F(1%&OB V%jFS ]h#FF$F`<8F#hbhh<5JIHjRhRhT*h!Fk[kG!T  8hkkSo%!T (!FGm'J{'J'JJJhkhGo%pG8FhFk[h;G)FF F 8o%hklF`Go%pG pGpFFFF(F D07F +F2FI FpFJ-MhFFHF<F(UFl1F8F+[1FHF(RFl1F F+K 0+A1FHF(:FlrF1F8F,.ۣ,ѣ1FHF(KFl(F1F Fo F o #BڸGиxи $O'OO1FdH]F(FlF1FPFI,+h<0;!(FGFEo%!F(F0GF(?41FJH'F(ހFlQF1FPF,+h<0+ )(FGFE!F(F 0GFX4(FW#+h kjGF,h1F,HF( lF01FPF3W   1FPFBEQF[(@+h<0o%)(FGFB!F0(FGF=0,1FPF4SJ]'JmJd'J+hk i+"F(FGFi+hkTj( "\E H 0*  ))hhk kj,(FGo sFFFX00FFp*F FJ("pFFFh$ r 0I(F ( `*FI F p*FI*FI)F FJ琙JJJJ Fh 0y7 FMByc A3D!(FJ(F0JJy@ FFFF8FP "3h2h$ e 0Rz I6_ ™J-AF-F FVF(9F F F8` FlbhIZF(F`yB F Fر$!:h"`P"qjyAFA22DBq"qO2S86oo FJJpF F<Fk ,$$h2F p$"h +K2:do5#` -AFFFFl ;F"F1F(FFA`Go o%-AFFFFl ;F"F1F(FFA`Go o%-AFFF F#hFZ*)F F( )F#;C F3hoOppG) р#"2!i(oro\F0JF FlhCJ8F<F(so<:Il `o<7Il ao<5Il`ao<2Il ao<0Ila.Il$,Il%"*Il b(Il&l&I#'$I2"I(F4#icch= #i=КBjCbi=i= 8#20BjCboE-J]-Ju-J-J-J-J-J-J-J.J$.J=.JFIFlb@lboj0FF\ 1F(:BFjB1Fj_(6-JF{(h F@Go%Fm(i F@Go%-AFF]F`iS8FGFѐ$05j8FFiAF8FGF3j{u 8F(1jKD! Fo%o F FF\ vph )F Fk !)F FhG 0p8hFk+i+! F+iG(8hki !G pG@l׿8ElL8(F@lڿ@l8Fhk FkhG c p8@l-!h8 @BphkF3hF0P"!hFYah "\# K)F KhF K K Kw  FG(p9J9J9J9J9J FapG8 *PD8(FR [pG|pGXpG R hkh"GpGl`.R0F4I F0F2I|F!Fc F` 0Cs0 :!*F9F0F9F*F0FF(0FP8F F,#X!F2Hc((!c (!c (c k(H.J>DJ.J*8FFD2 8\ FBKFа_аOаO аaO а?ЩFH j!FHLP0<@?LP0e (`3LP0HJyJ<JpG FCi ```h`Zh"shshbsi#a𵉰F7F(F`F(FBѨi(7o `"Il-`"Il'`"Il!jF``!(F|hF_ a#iSOI:Fl (F;F#a.## ca#O(&JJJ6nHJhhDh@X\_pGG!F@i`i@!o  F3!@i$   hhh#D@Ҳ_ZT8 F!F@i "F!hi , 8>o  F) *+J@iV HCJpF F@i!! @`i`i!`i"!2F`ip@!8 FCiFi!Q!.F(F 88F F!`iRB"!`i|"!`iw`i!Bir"`iFmk)F F8@8sF F FFiH3O( FC0`iF FjhF FO1ha(F po pG"FIlIFOzbl3Il IlF FIF`E`Gs S` 'JJJJphFk h)4 GF(F$#Fs"!FdshjhHOzrZC#F0a@ih Ho Fpsh! J3hJihHo%AJGJfJSJrJ𵅰 iPNhO,<,3B  FR FF Fr8Fahk{30Fahj,<#Ozq*h FJC(ahH? J JW JhkhGo%pGClF{# F@hkh]G"#O(]i#_AAx P\#h_x P-AFFFKDh#EwDhh/Ozr#@F9F!cxX_#yh"cy CC_bxPxX_ Kx\h@ C!@"CC_x0FPA J"#FH F 8FF FI(`o8 Fh`( F F Fh^ FPhk+`;h;1F(FG@F Fsh+ѳhk`{h+(FGo0F#lJI##`!F(F0Y.Jf.J0F#JI##`!F(F0Y.Jf.J8#`FFl FI*F F8@8m.JhhkhGFpGhhkhGFpGhhkiGFpG8F$khB 8(h(4p FF&B #h64 F F(p-A%FM`+FJIFOA 0`2h)F@Fw<BClk0F<Fz_zVE%BMѧ՝zzE%BDf{_{ֈE%B;%{_{E%B2ՖzyB,Ѧz]yB&e{yB y+o'P{KyBՐ{yB ѥ{yB`|xXBXA  0 hkjGo%pGFJ[ xppGJF0 hkh]$`6F F!FGpo%-M0yF:hF8jKt p4F(0F%Fh7L܀,>,B"єh,<,B5;h+?v  FH 'H@$Kx< Fqh F50FFHW5j,>H##50cl FUCy Fnjh,<,3Bcl F@Cy FYjJ|J$JJJJpF8F(FiFi(F,Y20 i F#`p@Ob F a,Yps FFFR_(3F*F Fpok(#` FF :A@C烈0][#F$RO a`3B0>8PDT:[h_!Կ_OBT:Za#:_T*S`_"%T:`T:h_=H_"2%T:`T:[h_Bp=HIO08 {JJpj#OUAT4XBRDp3+"OUX6CDSPD2*H JpF`8%&#hB F pV]5-MF F FBF"HMO (O@F!?"hTh$bbatebf`#`e`->5D`O F!?lcihZ``iaiO1!?M_<J-MPE@ T?!?j@:0@ p_zH:3HH:O4 F0_@@ O4$ H:3H:Hb.տ_#00_&@ ?!?@:@`@ $?!?.@_#00_տ_#O40{@:Ozp0P_"ZS 63Q#0+@$_ p'O F!?ci"h$4uKuHS"`iO!?h"ջ%|1E! [!h! C`0D| : `iO!?qah$|" `iO0F!?{4h$0+|0;B h[ph qj(@3[D 00$0 >K"FS$>H|=KS$@ 0Buљs 0+l0+n O&?1FPF/0 #B^њ0+Z01FCC0PF *ӲM+~+i&*? @@*R& ZE@ 0XF06 .њ0۲+IPBX X D@D ~J2JaJoJJaJ#$00+0 0S:#:_T*S` _T:b:EF0:#00 `O1!?w0 0S:# :_T*S` _T:b:E0:0 `O1!?G 0ah 3T_ y$Fbh#hB (chT" Qj)3Pic`-M hFiFSiFiiPCH:3vHMO3FSb \O{C#~Z#~eH(dH"~X)vb:Db`chR`##v_cv838#bCYCC OhOXHRh<B HB8H@Pc~+#~+ڲ0#uuO#?F F|,л6л%лeb1!+a#,`+b$B-"~Q(F%HU3@+"OqHq 1.)eb0"H>ebYFqHq 1 OX b l( N/30@("(F :P3Jp3J3J3J3J*""vua~)ʲr**@𙀢}_"}ҲB)+@'@u#CnF ZBT2Z!REȿF3 +9F F ZAX1Q# BDA# ;D+ݝ 09Fcu `O PC EU AF@* O DR "}B` F ` @ ?!? D` F PC**hѿ_T*b*"a**jL*R*B*_T:Z` PCJO?1!?FY !!n#_ CCZfOw'FECF𑀻Nлu+iGp@2FOL@@ nd`` F PC* _T*b*"a**jL*R*B *_T:Z` PCJ`3 F 3h6?J@K)FFD_9K7H*F'CF2F8C PCL**_"T:` 8F CFOR CV GF!?CF"Or@ .#C#2FH[FH#H2F[FH" PCL**ѿ_"T:3 HJ#.F# -MFF.("OF( Fȱ%, B ! FHuD# U FHi$ Fa a 9Fa#K D@ HMT#5#%`c`DJJnJ-M FFF(FFF!!F F0:H&o `a aGaa1F2HO0O{ 1JBJAPF)hF("FPF (&HBp-A8OzxPFC((cj۹OzpH#cb #9#j9 F-  #j29(+?D8F!?DJKJJJ-AFx FF#*F!F3F A[F FF#*F!F3FIp-MFFF!FF0F`H!FHjO5(F PEp;"B@Ɂ,tk 0C# @A! D$ B "@#cEtгڠ+W܁+>Ђ+<Ѐ+N%\XгSУ+T:4h_DoGܳoo@#2B9)65555۳ocoѿ_O2T:+#%"EDFFBF"F8FIYs#T:m_##%"`)%"_O2T:e9)S!\J\J;\J;\J;\J;\J;\J\J;\J;\J;\J;\J;\J;\J;\J\J\J]J#]J7]J_T:4#`_T:4#_T:4Os_T:4O3_T:4O3_T:4O#_T:4O#_T:4O_T:4#T*h_b_"T: D`Y_T:4OsT:4h_D_T:D"p9 + ++ԮBE(BF*(" H% BE(BF*("H@BE(BF*("HJJJJ@3BBE(BF *( "$HT:l_B p!Ap!qCqqT:l_xq)#rBE(BFxB(FHA r#xCr1pr"p%)#"F1F;FXFNF`JFFF(F'Oq'qPDFTjF@ (Or!@ ?!?(F(yO3@RHzSdB8B0B9BD1 B@E91:_%T:b_T:b@*_T:a_B/"T:d_RT:`bZc_ObT:Zd#HZ:_T*S`_JT:Za_T:B`_S"T:ap[1h_H(Fo oJFD(PD@ z o8FF(F[@0PD 8 8@8-MF F'PF{F;F|J}Il"@OAh9 (o (FF+QF FJOJ. XDF&дSF!hbh heH] XD (@=FSF\J]I+  2E+%[+FVJWIl yOAO  (ЪF+QF F (O A 8DF(0\SF!hbh hBH 8D 8,W#hbhh9H/F<+F!hbh h4Hk+F,J,ISF*J*I+  2E+[H"AF FF( FGF(?G@F(д#hbhhH<[F!hbh hHU[F J I J I J I4#hbhhHLJIXJJJJJY.Jf.JbJJ:JJJJ`pGhn_#C_fpGCh[h_Bh1 pGO3 `pGLP0-AFFFF4h_ c<@DE=O0 -!$ Fhh_# _h `hOAK0H砆J FD,##-1ѽ@Ϳ -AhF FNh hJ[SCHi@F@0ц'n6@@ Cf+h!hXh?X``(m!?D(m竪FF#00Ch F;+  0 ~SChC`p F?!DFF!? FH#R"b"B`+bF 5!F431D+1FHyO0EO_ha pJh_#_"@;OAK(HWom 砆9Jh_C_OB@;FK(H9omOzpj 砆JpChF^h_hh_(%0_hO@A`h"K0 p@H8B%1_ORhF`hOS0(phZh_B_h0 DZ`砆J1@-EFFhc(1$1 ;$1zpO4 h'BAF3i@FhA;`$1+ݨhWF FE HO4piHhE0FB FFJ FF, -MF, FF9FF@FcBڑIHl$ F +ѵO F(`#WSC@ Fm`(q``;D aF@ ^`a(_!h!`i n1@!pc C+s"PB?FiC?1!?FDh?1!?D`iD$1+5F #i`hCE? i(Fqh(`ih Fh`!QC8B O   `@ ciL!0@F9F  ( M<@ A1AAC*KF0S9)FYF@F ! PP Y` BqCA`I @a P@Xa @P@a @@aP2DC h([s$13$1JJ@FFF-A FFF"!F(FFP w,A3Ozs1F(FF$fB HomE1F, 14 (F FO4oJ-M°F , #?  JF+$+!! 0 DF@ FHmHO0J `"!PFD! F?XF ## n O83@C0 0O(+' PKC"CphCCc,!CC CCB *YWzBzAC30OC'0QFXFJw+F@7@ JJ[ [s ! B"r"BF%KA @FCCAqAHa(=H "K" FJ'`g``s0H F@>F+@"bP Z` I J6( F``/J5JJF D+@?zJ+J+d9FFm FPF f F#DF_h[h_?_hS`hh_U A8+Ozxf>9FWPF S FOh@E `9F+dhh_C@_h` "hBsF0(#FHRh[h_<_ "hZ`5C _h`OBhF:K0(8H!!h[h_տ_ "hZ`(c+ ?D!?'H(F(3(@+4 +3 + [@"# #P+(Р+# !@ n"@ C f9F F OO0 B##qJRJJFF,F$O0pG-MF, tF+>h#B@?#0, cxFK+B3"B<л9лoHB@#EہBػoo#9#9O0boix)+ѹNOzp5xB:F*Fyy5FC#BFF 3(F<1 1GF(лoZHB6@#EB3B@#3Eh_!*xxB"*6*$*@B!~q!  B@.CS_o3`oл#Ozp0/:F"yyC#BFFxxC# **5*fsMOzp oB>FyyB$B4F,8"F)F2gNOzp'0D00B=Fyy,FC#BF۲+?/YJOzpR#PWJVyyB$BF(FFpFxF`8@QoF(F8F@7h@D@@?Ozp "F){@HʻKJ-AF'Oxh0Х` ?2F!{H#0KJ! h Ahh0pG-M1FF*hS /B𥀢 "t aa"D& *@"!00#  p$pԁfjhsBHO # H( FY 'o!Q!I I A QAQ!a"@ꀈ Q |@!!& *@/S@!B(F! Fa?H0& *@T040#P0O Y 0, (` ) p~1&jB( h*݀b{*  Fh0CaXBObh "h /"0@i0i# i$ hU ! h +|h( s2C#c0#(0 0' n@&  #Oc*CShC 0h0 D$p} F"і!D (#$ #$&)ѕH  9C!(q8A!  ճ0@N"#{IH! FFF!0UB!0B@O2#{IHSu *y 0 ;0C0k #J}J;JJ-EFFjTj F&0sO +h%ثh.Mг r:O "hI 'n # Cf#%0hAhJ``C``kG#h% hB?"1i( hG#a#+bk{ #kb"#hZa&0+&00 rhi) hGnak{+#+b#}+%ih F]`+`#`#a,hB ϳ# # 0O @@@BGIHH@FPFoF# # 0#00O #BF1!F#0F@Fa/@Fppjj"j[B(;F DBFoJ@Faj[Db* BآjB ci6գj+B#`#"!#1jj* B(Fo"j@FDj;Db1+?g#ejj* B(F/OorIH`#燊JJ_J0J-M#x$@FFpԱ4B0#hS B`BзP Ы i h00Ч#B`0o@F %U%mm B`PP(KaiBFbPF#Momii Jis$eiB(FD@FaiiDacBs sFHjEыi@sFscF #-Mww1:jFFBB0!8FMhQ _Bи@ @)i@ЈoF!8F#0kiYFs3ja#:F0FM{ lՒ&(kЉ)Z}*WqB!BM18{hB0#CE01BB +@S $P /B"S :hhn @ "CfB``!1`!0FB"O :(@M9$BDE@?xA$ AMBHiiX"Fs1C@^b4I5H$ BoS `!0!0AiCT 1EA(ڳ a/Br;F l  1FF mB 8HgYF6H`z RF1FiXF#GF+۸hh6иh5*i 3Fc #!H3ϱH[ 9F   Ozs JHDHA1FH HI FJ rtJ>JJJJJJJ JsJJ!J)JJJSJ8F+F* !h`h`- hHQ8 8O0 JFF F@K -EF+F_hhhF $ F Fh!FFhi F>Ѩi!FF *F1FF@F#tTFPF.F#HsͱH)FOzs J! H H%FO4J JsJJ!JpF+F"hhh7F Kh.Ahh FpH"O4$J J*F hXhHh8 O0 *FhXh8h hH O0=J*F hXhP!ih8 O0 H&$ MO> H H +hC,,!:!8Fjh4D5"JJJJ!JHpGJJhrBЈBJpGJ7%L#!hq( H !hq 0)F+F*F!hq JJiF@ ]¿ F2`h O0 KFh(h0"/ O0J "!Fh F@-M&# h!FK[lihi  D @BBOAcC.+sO0BBr;B22*= @ @+5O HFOs ""O3, E3SFBF(#`Z`g 1F1F YF   ZZE;U5F*1"  BB '*8FZ*BFDA*D;D  3 C #F5F1FSFBF5(?<FE#D 3 SFBF(?%"!BFO4J0F Hhh HhP EE0O0JJ-E FFFFD(QF HO0X2F F+FdJphFFF+ChBуhB F{)F@ F `@*F!0F Fk pf`` 牊F@)OhjFpG-MFFFCli@ 9FF:F!Dj 03 F CliO iYF 7 J(ki>0FFZFQCSDD@#F>(Шi p 0 9FF(AF FjF0FFQFQFD0F FOCi 0"9F 8 -ML#hFiF 3FSBli2j^Յ #h$O i(6 3@3FO 23 B.O2vF2B XE*! 1Ih"F@F@`FvpBhEF!D@Fz H@FqoE ڶh@Fc0D2  V+$@F,OlM ZE\ۺ)!F@ F"FQFaHgO0O2^K`^K`tm @B+h."F!U(WHP BPFO1O OJ@ `!FS"FQF+` HH@m@0+h K S+x 1YE ΀%!F@ (F"FQF2HO2,K`,K`m0@B."F!+h (H0BPFO1#J@ `!F+`0#F"FFU@m@0NG!F@ F"FQF: HCJR*JJh*JJJ*J*J*J4+JJc+JO2K`K`AFF[ @ FB3h/"F!| H 0BPFO1#J@ `!F3`0|#F"FF@+hS(0@03hS*H3%!F@ QF"FQFхHO2K`K` 0n0@B."F!+h }H0BPFO1#uJ@ `!F+`0#F"FF~@3n@0iN-!F@ F"FQFc`HlO2VK`VK`+hHFS 0@B0"F!3h RHN 0BPFaO1#CJ@ `!F3`0#F"FF#@+hS*0@0>M>!F@ F"FQFO24K`4K`AF[ +h@BAF[!F"F!@[(3hS(0@0+hS"p0BPFO1#J@ `!F+`0Q#F"FF?Q@܄JJ+J+JJJ+JJ-,Jc,J؄JԄJJL hH#J#``O2K`L hH#J#``O2 K` L hH# J#``O2 K`JJJJ܄JJ؄JԄJJ8 M L(h8!h)q##+` hq##`8@JJ-MF0F FF#`hhB!$#O 40F[FhfXEۻs)FzHh( +irЭ `h;h0F[F8(3ی!@ zF"YFL3hh#`i+k+@O O+G~O F0h" F k#0pCOyDHhhBH FhD`e O/9HOO6HM4H-UиOeFl(Fqi:i#F*FEp@ؿJDx B\D 3۲;J0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)D%B F|JJpF JFh FX Jh1 LJ$h&DB HuO0p*F-(|JJJlJ{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-MF FCh + +LOsBW!F6H# 4KB# FYCrF FiB'hB(F (BRF9F X(akh+2 +, +*hDYS[xP\ H o +ч F|GCF燊 FGrGCGF+hS$+h3O0J-MFFFŠi;?2F?1!?F1F ?(?B F 7F BF!XF{`(FO00FAFMDB F2FFFXF@EѪDBCDF!?2"?F2F ?%?*FXF(F"F)F0FF*KFhFFO4 FYi@ ?1!?JF(F! (O4(F@")F F㊻ #@!F"3`8F3h4 +O!F H$dB#$4 H #$3`"!FH(#|J,J,J,J-E F FF(:`h (`b 604 `30C#b+Уj7J Shb00.h+Pb ,0hE%-0B)F)HC(Ho8F?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @ b@D #aJJJ6J-M?FFFF0F?#?F3F ? +?  BF 7F)FXFsZF!0F{`({hFO0 FDBF*FFF0FxPEѸ0DCCDF !?#?F3F ?(?@Fi"F)F@FBF!0FQ(F8FhhŊrdiiCDh , kCi!Dy Ho8jdB(,FicC)DJ8iF "!(F,#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IFK(FW8(O0+\.+oOT)F0F0FOq F,!F+(~J-EFF%@NO., ,!FPFx# Ԥa+@5B(F_$`J-EFFFO O#FEFxZ-B F8 DEх/*\*FFxF/)F\)F)SFB L#<`DF;#x%F +.+kx[.+ѫx;(F"8(DB5`K;`x +.+)J-MChF+FF[ + +gф@F^DCF#@FYCF FiBOh B(F8 2(?ۨZFAFPD(7a#skh+3 +, +-(hD/00OA@/S/"pC 0+h 3C# @FDDCDF+hC$`+h#`  0(h00C3 0(hZ!R)hZCR۲ 0(hֲ00"C# 0(hZ!R)h 0(h 00C 0-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F%4F;FpFFL!F(F4(F"F1F Fp-MMvAh )!  ÊF D !  AC+ͱ-ch +mKB 3B)F Fch +OS +OsBOso@sSC-$F2F%WO` 2B ahr )&Op@|)`FE0QF F$chF +!+@sB(@VOcSE@QUFF8FOsB(@@Os@E(@86K )M)@ OpE[b2F3FCBAHQF F BF=bh *)*@rB4(ObB@FF )Op@w)8F HOrB(݀OrJB (ԀBF !B A  ` b B s<  c C_ФO:h*ZCi#X@Ev*.@@F @π SC :FYC SCB[DfDXN2h㊘BFBF9F0h2h㊘B9D1B1  CBvbh *Os@q* FBOFFRO1@  8`(kXHO0c BAMN2h =㊘B0h:F@D2hG㊘B cXDD@'L6K9Fh3Kh#⊐BfDD3 BI#'KQF FYbhF *Os@q* FB)F Foch + + +opE*FQF FK@uOucv7&1F FX6J.Jch +3 ^.:㊧iw3DZKhB+XH&QF Fbh *Os@q* FB?QF F%FFQF F=5FIK'ihFFOzWFBw i F(2[A2ch +Y+Z +opE*FAFYAF FBBEF/i Fr(!G!aD-ch +)+OsOcBWF.F(bh **OrObBJFJ@uOuKJ/JCi?3#?@3 N ?x"0`$?H-"F! (#O53`(FF"IpF(" I6("IR(|JJJSJWJiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Ff(#hsC;`hci`"hSh + 1`ӊjKCB##aiD h(`#h[h ++OsOcBKiFa [ ;0ix+;ai 3a-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F=#41CFF+#{@F#z.#>F;"0F#{!0Fl#;q7F;x6":p,1+Aх,!<1+A }iF& F  6. Ui6 .! 1) & &  ?RAF}kF2FF@F(F"F(?@ZFa+#,1<-MF FFz+x.FF5/+\+0F8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(<xXE8XF<FF0FP<1SEBFQF0F(iz!F F皜JTJpF Fv F@(F< ix p<1B1F(F(-EF'F!}Q 2CWPB߲OlFEF "! F#`F3iBFApp!2+Qp3+" F3q"Dss!ZC*< #F 2 * 2 x"wӹ"!"DwQw3"C3B#5%prE@gs#p(F- 5w#*%prgs 4pp2qZq!F "ii= FF( F(JJSJJ@JJJJJ0"-MFذ!  FF( ?8FFFP9FF@9FHU%o.F@ }IhF( cFwK`QF"0FSFFQFrH2@F 0F(F FX0FF8fH%Fosi+:9F0F|!F0F6(@,8i5h "! Fkh +OѣO0 "ca F FpD @ WC?!?Fȹo DI(CI(o9F0FrF(Ќ:F!A "8I(F "7I  +riʱ# *#kO{"#QF{  'H] sh * 0 * QFC k "#{ (Hfo00FF+FFO4&F}J@JJgJJTJ{JJJJ-MFFj ?!?@1 Y9`A DB 7F>H $h 1B 2XJtJpFH>F0F F$E4BAO p8F. F%iu: M(F8<0+#<0/ Fm<0+%M-EF FF9 Kh+ L L F'U'PF(@,tњ<0PF2{E #U# <Q!<nFFB:3`JF)(!K`%@J-AFFFFF+i+.O31bBr SOX@1@@As+H # Hc<08FO0FOpFFF\2F+F FFlFpHJhFBh BpGJFFFT_BH "1FJ=` -hH7FFXiB #S```D`I F0LF FF&HqJhFBhЌB")FF(#3`HT BАJ```C`)F F(i3` OF0 FwM(F#aOS#`K`]RFQF(FYF`(F%F*F0FIFX"F0F IF @>`MH0FH F? J ^J^J.J-AFFFFFP(F(9F F8HWBhB hB #$S`F` `L` FAFHpFFF3F*F FFFp-EF FN3hFBh@q 2[O3B(jCR! FEнFR9FB?hЎF^FEE"F 01}J-AF#FFF #`+` KB*F !X+hBF9F0F#`HsFFF>*F F3FFLFp-MF FF(4(L< F)h(:F.!F" F ,&FFREN+h3D+`IP*O iFBFҀE (h8/FQ 9`  L ]J-MFFFF*D.# `#FF[/ ZEhѰ+;2HihBѼаB-H! #"F iEh2`! (<+j(bC``0hz3``.) )+#iE"i* "hhqFh)#$hhBhREiB Fi0H -EFF FF?񱞹- FQFF@JKBFD F- ---L -0-@F(8F(DECF:F1F3F-MF@FFF(60FF(𥀏(F2F9Fټ `\` F hL FL8FFg*F FFhhB#S`` ``` Fi(F8-EF(H&ULԱ"AF FUS I FF+Ix+L F6"SF!F8FF5,6>FRZh8hL ]JQ ]pGQK FFF@pGF&UU, F56>FRZhF". HhB# FS``!`a` pQ ]pGQK FFF@pG02KhFk F(|+IF0i*k+n%Ij#$IFG)abaPbFhKh2K`D KM`#a;)FjGF1k"Fo#FGFJ^JJ J0F(FF##I(FF!#i++IF0k{(FkGF) F!I^J#O>Khn]ȅJ-MF#F+7+2PFH(,0+',@!F"FIF@F(tKB@@r !F CS0F V( XF` GFg *JAF(Fh,&J;FAF(Fh `!J3FAF(FhOJ3FAF(Fh/%FK2F)FhF\@sD6 (F!FFR/P J` O^J ^J]JȅJ J-A FF!e#F(F+FIF@ܹUBF9F0F3hGF4LIBF9F0FshGF)#*F(FI) FP]J-MFF@FFF(z#" ;IFD7L+Eձ+x+>'F3S/O &7FO E$/S$ FR*hB !B*h*F@Fw7  !EP*)*F@Ff7  FZE,F[_E;i 1F#*Fh~F!F F?hLP]JFFF"F(FFF:F1F(FFH"F#!F(FRl F-AFFFaw## F F'I FR&#i++ !N F\0FKhBѥifj` + FG0F!HC#ji`9F "j(#j:FAFhoifj`##b^JJ_J8LOq"F F J KDh LBb Jb 2bbc H F(F8<JJȅJJJ`Jp#"IHp !0J 02F I HF pF2F (F!F]]JJ)JFFQa!1!F@ix`aH"K`aSJJKp稅J8F44 (` 8B  FX,h!l!HKue MJJ-AFO FF~h= #sC JIhBXBa Hj FLLJJlJ%  F K` JR1 [hH| HuJbJUJaJ F JhBH !K3h+T`B JJ "KH`;% JaJHF4$ FLF3L Fgh.[-YO1(F0iF(PO2)F1F 0F #!"J="5(Ft F (#i,( (#hhB(#iPh$3#a#i(`B+;#a So(h3h+;`3`#a`LLJJ 8F F5, JhFBh M"(F8B%# FS``%`e`6JF FFFܱձϱƱ! FKgaZh\`#`b``4`$ FLLJ p FFF KhB Hp #cC Hh*X3`% #Ch+` JJx1H!$+-Hp@F([+ &(;+,$R+ 0; +U$ 3E$0,VHO.K1-!J\a`h*ZhBhBZi*iBhB"b"aaK`"Z`pJ+JJJOC `8 L ` hB  ` hC ` *+( hC `A;(F~( I%F(F3%FF& '9, /, 0<F&F%;,0FI-%F砅JM+x3Kh@([&(VL?`` r?#++S+؈Ich@CCc` +BpcHO([(+(@Ӏ F(O(!08XE8("chCCc`#lO >hb+pB@+x+1+R#aJJ'JWJ/J7JWJWJWJWJWJWJWJWJWJWJJJJJWJJWJJ(H(:0(s1+?nR#JJJJJJJJJWJWJWJWJWJWJWJJJJJWJJWJJ~(8 l j&8g'8@84(2( ܠ0+?!8~( P8 J F BKc`#Ch"hB hbhBsiHG6h2稅JJJJ 8F F M+x F$" IK,ph<@ F8LLJJJm@pF Fa-B,@!M~)xA F "`Lg FpJ0F+ + + +Y)Vhz &&B@3 )`3SȄ$K,ph<@L稅JJJ 1@#𵅰%O&K&N'J'I'H(KFWF(6#H*F"I!HF`F!OpJF(H^ FhM`!FJHFH2"#!(hF(HHJ0^JJJP^JȅJ@^JJ ]JJ^JJJJJJFF SF0"F 8F%$#h F>(('( иid(v(C(Ѥii%5i#j[h[hC+5i 58-MFFFjF9F@F0_+SO.OLO`,!!p!ap!"q0Fp!arAr!%r#t-atApr"sbssstt"ubuuuO!bpO O*q `r@r %r#t`t-@ppr!sassstt!uauuu0+##(0d0+ +"0F)*"0F)0RF0Fh"1F)0(9FH7JpF F) hF>(d(='(Аid(v(XC(ѩi FF(F)4 F"9I4 Fpi FF(F##p #!cp%#F&pp "0Fx"0F)#%4 lv([XFF lmF(Q/@XF(X&e%F(F F%=FXF[o8F 9FB(FWx.+0F 1FB(FJ.FCEF)/*@F AFB8F6  XFb l( FW"#XF#o&#XFI#e J\JJ J JSJ8F(lh$d(n(F F8$8Fl FH8)Fh(-AFFFF"0F0I (Yh/!0F AFQ/K2BOAD1"m CsR BL FPO1@F0zF AFO21F8F 8F8F FF(BBLLL\J p FFFHA:m;m& hl:Hp+h1F0h#(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpF##f ep??iF~(eHpFFFL2F+F FF\ Fp-MFFHP(FhGF1=  FFd#x+cx+&'O O #x+cx+ H%hGxxE%-=(FF(*F!T gBFhGF@F- FFhGvJ"# F#F# ` 8F F)F FF F8-pLF F !FO:O J`Faaap?9JJhFBh pGB pG8JxBxxC#C@pG8F FH8JhFBhСBѣh+` 8Jg}Hp FFZoHp-,gH, 8FFAUH8QH-AFFF*/9h.L, `L `bEр8`( F . iCE0B$tFE+hij 8J-MFF;C>X@FOEFLO@<SE-=5E 0F"Fh< 0J-EFFF3+'H\@<SEH"AF FXc|"|B"3B2 Hh8F(F0JpF%iBp#S```E`pF%hBp#S``hh`E`S````oF& ,jB F# FS``&`f`Y-MFJ| |C#|CC|CcB$x + [; + & + FgD~L F! F(Հ"!F0?ia#` FH'cz%zE%zEEzEe%DE8! F(|9F ha(\Д,0- .C#+ U`(NO /aczJ*zJJzJjDE3FS/U`#h5aB`+x[+hO1@75EF0+++ji FRB+jiR+ O1Fz @   O 2Lhhi (FX*L*L ;P+&L -FHO`@```by#y C#Esj ubE B* ( F8(F(FKLRFYF0hh J`;`x``PhS````#  0JpF F X)FFF0F 0(];(а@ p  FFF F1 H;h# HT_BH0Fh(-h -EFFF 0F $HhBظHFZ_UE8FhxhB+iB٧9FhiFH*ihi?!8Dvna@FGF(kiD -h -AFFF FF HT_B@Fh+iBjiC;R#P-(F3hFB0`HF)F4` -h-E FFF F H+h#H'FOWE+hEH 0D%iO;4FB%%p(FBh F th -hD-AF',iDEѽ&#S``'`g`#i`iB|hy FvP&q6F F F#S``##`c` F@Y F Fz+H F$  FFF&M(F( KFZhX``#B```aCaaa bCb M)FF( F`4`8J HFF0F (L F&Lc|%|E%|EE|Ee%DB!F0F{Fx +; +R#CJeCJCJCJeCJeCJeCJeCJCJeCJ+8FD0F0F0F0 )F )"# # +H "#"#J-MFttPpEEѽhB-h"QF AiXF j9j:H D T9jBӻj DB Ha 9iH H 6hJ^J>JIJVJ`J!J?)EM#BkB XDPSB `H-MFF!FFF8JR;SHH I$@FBѪD("JCFBH 0"0 :FB@ #)BX+kPF\7\00F,0!k0 FnH R RR DB8F(:jD(000#DrD F>Z? F!?_# @,0(`0 PK*F@ BkkPF\\00F,0!k0 F(ЫjD(000=HsW ,W\JBW ! D*FWW  DDb8(?DB_h/? cF<+h D  *  bZBbR?bZ*DbX*DbPbXR@bPH J@r!A FBRgJJ2JFJJ fJJ7 FFIU(iE0H^J-AhF+F HJx xC#xCCxCc`+h;+`Jy yC#+h;+``)h FI9|hC2p/*h3B*`BEDAF F`(+hDD+`8F4aBBЈBA pG pGO0pGO;hBHpEqF6FV$EBqқhHKBKAB cF@J-MD0,F FXFCMJ0!h 3`,F1,O2# ##u1bu`qbKhKB!CBB@'J ShIV`#J`p$Kh ,""OCCCS$ J#CS @Ez𓀤Eph)@Ez<Bs'FAF<FFEz-ӢBs#S``#(F+`k`O7aGWC3xh$ DT qqC0! 7F Ǽ0000O4hDT Ckh0P c O3C SO22(-h(,?O2O<BRB]EQE+ѥhhB'jjjjBBH k e#S``#`C`F8FKhBM,hB jX" I 0 F $hHHąJ@JAHJXJ]J7@u RCOC `BR n0-MFDKFBF~.|(O2@(i(tO>;HhFBh9Hh)E-EU$ AE~ #c# FeE hШh(E-EU$ @B~ <FuFeTEuE * F)F(HHo@J sF"F FpT N"F+F I H J Hp#2FF)F FK(FJJ-M@vFHF,## - DTEU-O8H x=J:8@F Bzӷ_"F (*F(CA;K {Bl 6aA K6 FV V22Fy*j j R O1AQ$Ke8FFF  )`@s@1@ FVkF2F9F$ (JKdL@r@c@#@1Hʑd}F"!@ TeTK@E@uEBBE"F I H l H"#D#!2F@ʑd}ĉJJFH$th bE("TC`` #+`B")(<E(џ rF4(ĕKh;`H@JąJ&``3F F2F hFKFB9h*F(1 9`5F`FF)h8FF(hW.` F-MF x@s"d e$%A Bz9"O f O;K[. ZF(FQF,Bx  "'(F'QFZF BxOOf BR8FAF H7 d$! 0klm EA07@s$!LM8 @(@:D BR!F#F#H J(@*@!F#F F0JJ! F(4'%#&Gpp"Ipp8D##u#cuKuu KO K"FK8FKIK KKKKKK;ha H^JcJ]JȅJcJ]JcJ ]J`^J J`]JcJ@]JcJ0]J NFOP4hB j"9F bp F'- -#FFFH$h#FFF]XJ]J'=H3H! `"H"ZOsK`(]^J pG-MFF FF.MM(F'-)F F"GKF`GKF`FK9F`FB-* @DE,;FOE3#B_F:hD*j%<@:i<Dh7Ka=W5H6Kb6Kb9F Fh3(2)Di;1 FG$hBiBR$dH "Hh OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33JJJXJxJ`JJJJ J(0?K`O0LJ9M,h,iF(aF(\1O#0J1I1HF(LF+I,H+KB*"####J#I#&HFFF`F@F FFF;!8F 0p H 7#" IC HF( H C,` FLJJ]J~J*~JD~JJFO1FFFZ0@O2!F+F!J O2p uJFF&u%DBH (.(I`_#&;+p0Fp))H (yJ/J$FFF? KB 8](@83%0#%0@B4yJ F"<4@2 pFF>=65OC FpF(B$O4 F<4@ @~7+"C  FhF?([(*(7(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-B%hFB8F F)F FF F8FFFFv#(F"F;F1FF#h#`|(FFFFFY,#"F1F;F(FFb FLpF FF<2F)F FMFL Fp FFFF+< L F,82L;F2F)F FF'#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI HzF Fp H -̅J]Jr~J~J~J~J~JJ-AMFF$FO20F)hOX"8Fih ( #h4,  liJ-AOFFBFFFqKB(hGFh+FBF9F0Fa( F#+`$ FDF8M:,h4+hiDBch[  3+*"h2D# F8@4J0"! F M!FOB(`"+ha!#FE@ JF@F!J HF F0UbEfiVaJIZJ J`L#h3 H Y H#z ! Jch  h"I(HPJJJJ#-M`OA F(qFDF'K EJ٫:F 0F"F 1F)JFB0@(FF0F "nF(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa p"kF;Fe"#e Hc(#BBLH 3 F pJ*J-M2CFF1H l0H/I/KBB"i)F :fi9B#iDB  O18FFF+hS "9FPFa##QF28FI9FH $ QF8F@"YFPF kh+h3D&JUbEfiVa_JJOA mF(H HOB#!F#H"#F(#*s H F iBBH FO(J JJJ-MFL FF PN0F *)*"FPF@F&@㱵OXQF8F pF ,5qah)m۸ѩBOOahi@1A-0Ѹ+ FehQ>-A$Kh+=:*<Ѹ9( 0 !" ! ф* 2k.##h*FQF8FAF F.k (&bN`N^LJ8FFCr##vCr## 8HKcKCcKcKd3`JJJJJ70@?EH #FFFL@PuJFKh)K#!"#ЅJK!#JHFH FЅJ5`JKJ  -MFFv! FF(1F(F/hF(\XFNIF(V#F#FF(KAFPF g@F{h;;l>K#"fg7K"o8IF8.3+z+0 "!@F1Kcb1Kb1Kb1K#cck{D0#E0#djid"e@"b` ( FXF!D g+i;7;F1F(F9((e1F"o(FIFg F(F0"b`Kh2l*h`jhrZ`Hp\J^J ]J`JibJ=cJ`J ^JPJ-AFxFF(SЄh#hBKcy+J"i:Fh 3C0D  BBA2ikL<@&8F,FU eM(CF:F1FU Ff KBF FU 9CF:F1FLLLL -AFxFF(XЂhy+NhBMSy+Li9HhC 3C0B  "BA4ikL<@&8FFU M(CF:F1FU FKBF FU CF:F1FLLLLL  I Xi(hy8 ] p\J%F '"F!FF, FI(i^J-MLh F(  Ffh%+- F`iFCh!ah8H !FFP2JahBF0H qO0!F(FE0(o(F%FU4O<<<B F3!( F*F FAFFo(i;iahH6:FSF(!F0F 0o0Fk<<JJ ]JJ7Mh(F(!(FDF(Fh%+ob!(FM F0M( !(F'F(O4$ ] HpGHpGHpGHpGHpGHpGHpGHpGHpGHpG )p FٱoN4h,K FhFDcBX\B KhS$]KhC$P3h33`pJJJJ F#lh+ M/h K N3` +h7`C"clCcdKh< @JfJЯJԅJHF FFF'3x+;lh;+ "!F(F#+p^#lppsxpx+qxkq FLLLHuHkH8F`u+lhl"Kldh<@+l`j F8LLԅJpFFF@#lh+cl3`#cdK h*`$`C FpLLLJ-MFFF-t+q.o+lh+m+m0+i7O܀9h R! {J{D$,)"d +"F> #"FD6 %L9h"h0hR! B "L2` F "d0S!;h"hR# 32`ZBXSB;`0;03"Kh< $kl#kd L L L LJJJJԅJ-MFFFF(p-D,Bжo?+lhB9ﱻ7к4кB2Ѹ x"YF F"AF0[#s#cs+lh۱+O!F2F8h1F8h Z K`$klCkdD FLLLLJJ8F+lh+$ "Kldh<@+l` F8LLLԅJ8Fm+lhc$ K`+l` F8LLJ8F+lh;+ $  K` w kB +l` L F8"Kldh<@+l`LLJԅJF#lh*"`" FFF FLLLHpGHpGpLF#hFOb! hjo2F)FOb h Kh@pO`: `(Ob!h$J܅J-M FF(B( )NOM0`0Oa 8`$0hW8h4`S+h3+hY4L,(hGwKwLhBvH ?0 ?8`! (`($O`+hHY+4,! cK`(0h0hbIrF(@4hS]IF FfF(@0hYI;`cJp^J JK7SF  F0F8H F H*h(FG F#KJIK H p^J JcJJ ]J]JJ7L% h@KJIKK%`0JcJJ ]J]J!FF(H Q F" I0" H\ppppF(H 7J\J\JGJhIChB Bi*قi*o pG IB BjRoBB4FopGopGopG /(((( $ pG pG pG@i$JhFB$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUpJ-AF FF8#x/+6BF/! F (FF!F8FF88F(DFFBBРF04/+/!@F (F4F)FBF8FL(F%o8FF F !FF(F8@8FF F !FF(F8@-MFFFFۻo F$E?o=I]/):BۚBȿ"DB!FPFFFS[Ex^/"6]TE B$-ȿ5|U!FPFa ۠E2F{%F&Fb#o -AF FFF-(-O0 Bo BFB3`B@FF8F&(ۄBoBo "(o ]pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FwB"!Fo-AFF FF FB BF!F8F jh*F! F  4-D s6FF%B(Fp F1 0DB5o-EFF (F@F %G&DBO5 F1 0 E ظBTF5:FAF F (oFF0 +`$ FDB-O3 F1 oC#DB-o-(`F?FJ"FQ@ J-A#)F Fo F4F(shB0FA(O'F%F0FAF+E' (o 8(>S ~J'~J3~J}JO~JO~JO~JO~J}J-o 5$-AF0Fx++筱= ''kFAF0F(FFo o  FC*B*F  po-AFFFF F B(F s"F9F*F0Fo#F CF F`F(  K@BS K(FpGHpGHpGHpGdJ]J<JRJi'+لhD$Bh"DB jBh XB   8F(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ w oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(F 5O S#ah2F )D6? )`fbh*j )D `+j#b-M0FF[-@Fho?!j'DBFF 8FF'.Nۡh )D3!D#" F 3FpG@FK#j;#b(F!jsh QD F!D8Fp"jD"b FAFVF'FO@r06`0` S`5F-MF FFFع(FD.i"F6#(F FXQ#?O` F-AFFiF(FB 6#F(F)DA"O4 F-AFFFFp:F1F(FF B:F#F1F(F)0 #(F @$@ 3 `CF3FF(&2F)Fl FpFFFXFH:F1F(FFF F2"#F(F 2F-MF FFF7(;CFRF)F F(6C1)F F FYF8(٥h-]Df'"1F FhOscQ4F:F FBFQF F OsXF>Ds`opFFFF"FF1F(Fp@pFF1F F( ۣh F!Dp@#(p-MF FFGh(0(Fki+OkjAFZF(F2F!F(FAOSca6cbf` #(FE ((+j ( DDE  B ?/DB Bo'F[FBF9F(FRF9F FK6#`OScaOSf`ai a 8FUF FcjB!F Fh"jDc`(F8F;(h(o ]o JC o 1JJC mJ𵅰FFFFF(hco$:F1F(FopFFJF FC+3F!F(FJC+!F(F.(F p2F!F(F(!F(F1JJ-MFFFF(F F(FO )F F F  р 1F F 8FX AoZ(0"   :D F# 1FF F( CE)F FM")F F1FF F'C(F;F*F F()F F-AFF$FFAF8FJ`+ohZЫkFAF8FJFXF0Fn( 3o0F3-,` J J-AFFFFFF(F AF(FI(F !F(F[FA1(9F0Fd(!F(F"!F(F89FFF0FBF9F0FC(F#F*F0F(!F(Fo -MF FB(F;XF lF(FF (F(@(FI -g4(FIFF4!(FFD.Հ!(FJ>!XFJ6CF!XFJcF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFhx# #h02(!F? =O07 F F`0(=7 F$ F0n(4=(ݰo4?447FFh# #hp0G(!F? =O0(ܠA+ 0pGBXpG3*pGK\J(ܠa+ 8pGBpG3Z*pGK\JpF$B 5`104.pO180@pF0FF$ Fp2F)Fj$?&: F5;,\Go#Wsw3 ap1aAp?acpp0$)F Fk+;o F g??{cCpFXAoӣ\Ao?# ap?acApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4 F0M\B0K$5@`@zJF FF @" F FK +h$ FphF F"!0FK#3p#p$spp+h 3+`phFF F "! F4 ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a 0Fi#Z`8F1F F3,a FU0D73JFhEF F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`C3J3JhFF"!F F"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(<JLBJ 3JuJhFF"!F FB##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`C3J3J!3J)3JLBJ93J-AF0HFF4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF(FII`v(Fvhh3bx3hD3`(F Iq0JC3J3J!3J)3JLBJ3J3J҈JhFF2"F F!x##p0#pcp'p``#+a#cq#Oq9F(F@9Fq(F;##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`3J-MO6m #*IlF%FF"4$! F.3#0F)F[;GoEF/D$" FIN%#"0FIeqA!a0F=)F`u F8 q=F縩JoJJĩJsF p$%F0F(-@$ x.*@$5&-0F$^7 FP px+4B p4B0#!DB Dx#@ @C0K#DOsB  -AFFFFlF5F2F)F8FG(%`-h$h-&`6h$h.%`-M hFB FFk% T"!PFEch`#hcFB0VTl%F.EFEhF"F`[+B.%.F#HFT<AF8F"FK,65FZ& "AF8FF6F1F8FG(.`u`6h-h.ѽ+`]`-hh+.`*h8FFG+h]`-h+h+,`e` J-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N>DD@k@3DNjsc N8>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ K`3C`)Cc`3`#aCapG#Eg-EFia(CiF$3CaCiTsFCa@ TE"FE8RF59F(F]@ CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@OIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3;3~߯-EhF?`(ChF(3F(C`@ ERF@<"AF(F,CC=,Cc;,<DFE@  aE5҃I!O1T@\ @B2 @B)s%4308< >dEADqD5FDD qEcDY'aE:>F9DADBqD4DDDF oo BDBdyBqF;FF,3F!FFo0F&(o;OG   D՜Yp3<.#F#F>F>.?GKN %9D I LO4%1DI ! J J J-M ! %FF%1)%k!B&$4>h$`OqVh`V$ `N 5P1E5@l6%@l%F!51)ѽ2P>'7/3.5%RP%745D-$B&ѶEtF(4FBO8 F 2 **@𻀺o  0 <EO0 5PUE5 | % @4"O2O  FbF5{=F5B=FBP5P%o,uD /popo ED%O`} /DA <@\=,@\5B] 5B1  E+%*"F%D BB3%@D-Ѻo\h ,hlphPFs"&J&Jd@$J$J%~%`%8P-0OE@'O@O _R 8@B"!F' &EFpH 8BF>@h` }J|JJ~Ji۱$"aBcOBDa`aZab`\``bbbcccfedH Fo8F F*<x1*9<+7o8#ajJbbcj Kcb!B0R#jjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo)J1J8FiCjkk3"cjikjGj"cjiG a8o-M*FFOE xDOsBD<%DB٥E=D@)*DBOsBDOq(F<D@;D%DVS>< #D DDYD D!D !D [D!D D!D!DD!DLDDDDDDDDaDDSDCDsDcD D D#DD2B FOq,(F FOq& FW7ASB.?g:F1F)&D>DBP FOq(F FOq FK < DL @ dD+D D#D LDD #D D LDD #D DLDD #D DLDD #D DLDD \ D#DLDD+D,D9;D%D -MF(Fi,ChCh+>#hk + ##` 00k0#"($&0FL1 %ftxo1o hZ ##`/#;?@D5-ٓH3B"FF"a ,`#^F]Fa#`##a#jO2ch0! &!K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ɀ;?@D5-+&a`O@#j"`#i"i ,`da%#.F#`-@Ԁ#j^`#i"i Pa%#.F#`-@ɀ#j#`#j2 `#i"i ,`7a%#.F#`#icр-@#j&d^a#i%.F##`#iX-@FgE(F!"jzihQii D[DBbDRZFQF#iZFQFia#l  D#d#l+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFiaDf 0p0jccK"h0*BPkk+@b"ij 0(Ghc(@U##`oK/;?@D5/;?@D5*/;?@D5?"i ,`faA_J+JvJFJ"j*?8a5"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFi'aDe##`#i- "BгKh"j*Sb/?Q+?@D5%.F"j*@#b"#jc"FFa4 # /?3;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`M+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZFK  D[D#l #d3/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?b+?@D5-Zf7J=2083$ nB!0Jn+cfd#cecmloJxBF#0+/?-;?@D5 0p0@Fcc 00pkk#+"ؚO3@C3@@cD #0 E /?;?@D5F@m@@;?Y:K#d##`lC##`O>m moJxBF#0/?;?@D5/?+?@D5BO2!l@&D!d@+"ؚO3@C3@@cD #0 E /?v;?@D5F@m@Z Ku J% JA J J Jd#D#`l[BO2al@&Dad@jDblB ١KJ/?7+?@D5##`+?*clB!l1D0E?j cDsD( B( F`kDB(F!d9˃B#l ##`D F+?"l+:""`h##`h#i+J##`#/?Ϋ;?@D5-0D0iDabiYD#ija4#i{3iB WK0##`D3F%.F/?;?@D5-iBGK%.Fj+"ij+c@bbpjBhk IӉ#+cjbP]0 *D  2D i2Dahzv D#i2Fi+Fa4#h ;ZBZAch;#k.CD,0++o+k E(FD9DRF  WD2Fhk9D.c+kjSDB#+cjBSDc JW Jl JJC -Ft8xF+x,HO08`Czz 3 H #xF3-DDxF0-H0BHJJ-IF&K %KF FF<#o"JdFHFHpO4 F 3h ! F+ 1cK ! F)+ HCO43`=JKJJJAJFFFhFFe(#"F+F9F0FFHBo #`O3x KS"pGdJJ#m0I@  hJJ-MFFFFFAF(F#I(FF(F(Fo.!F(F FB'x/.$D,9F|й1FPF0hFQF(F@E C0F!F(FRJ-AFFFnIF(FF(F2O7F,8FjF!F(Fx/+D<[BF1F,(BF!F(FFJp FFPIq*FF# Fp@pžJl :lH9O0l l>(J#F0h F@ O00F#FP0Q"0D"02BFm8 ]-MFF_F(o(F%'DB +T;{ B%YF@F!oYF@FO3RF@FCB BѻN%O1 O1XF(( 1`FBT;F?5l+ F FF:FT -MF TFF 4 *zC#DBӻQF@FF&!F8F0`F)FFO3-AFFFFO0AF F(۝00 :F1F F -M(FFFF!F(F!FF(FZF9FF(FrF F F"!3D BO4BEZF9F(F!FF X8D$0F2 pG! J Hl x "lx x(@lJ J)-MFF;*9$JHRD4BtCF a(FG(Fp E)B ٲDWEI*OT F hh hhhhp(h FFF а@((F@ h(F8 (F!#F)F0FhFH1 J-MFFFF%} UE$ W%F@H F } ѳ0FW% X50FW% ($ 0J-A&FFF4FDE0FU$18F&E$4pFFhFph~"#UCO2`#hZQhD`p0 FFFF(FF0`G0pGp F h@&1F FB 46)#!l```(`0 # J`p# JFȹ" K`X+ph(h%5B##`%'J-M FFFFAO F4khB"K`#F +h S 0+ :F@FIh 0 F+hSD33`4J-MFFE%QF|)8!MC#hFZ[Ys+@'hE@ #V-XAЙB%O ah0F9X5FKBchB##h S 0YMѻF@FQh( h+7/5  (D"9F0G# F#h:FXAFh#@# eJ``#h+DhZ#h8F#h+Dh+#h+D30F`B=@FQhK(7 h++WhF;PD"9F0G(#h:F AFh#(#hSDh#h8FSD`#hSDh+?N#hSD3`k(F#hS 0+U+_ѢhchB?8]FO #h@FC `#h Up`#h8F N` hPDCh+?h+?h03` hPD0Rh h"PD9F0GH!h*FQD F11@ F#hAF :Fh#9!hQD(*F F191 `:#3J-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(FJ-M`BhF2" Fk`+f(d%O h}a;`shSE")FTK8izi2,XДBW!FOHi #H# 2hX+,{`k;lh(k+;h#0x.+k{`;iC% #}iD D}h{a  0;/*ZE\*55#O0(J`7FFhh"F!0F!O= O\;iB # F3p!F phF`(ьChh:sцP/Rh:oFFF1F^E\.уCFxkJJJ-M`;mF# FF` "K` ?PF "KQF"F{#+Ul  ;m2Fymhm0@0AFOpع(F80+@F(<(F$ (7Fl+F.F+{`3x +E +C#+D4F;hB{hB#x+5(FѻhSMTN;mETHAFlY!h(v0F9  ) уB ^x .23Ex)Ѥ1p`+F"(Dt&FF0\F=+  OhBO#p;m[AF0Fl4O#p\F0Fh9m (\)Yx)#F3;mӹlk#({i+{ZF1FHt0Fh9m(?m(Fcx+h=*КB#ZF#p[FFhB#p3x+"K`JJ_J.JFF$'khB *hX+40G(FFKJKF(F)F0FJCFGB);F J09DBؿ$p)J0D-0FJSJ>JJJF F!ǿ"iF iFHA 3]0J-MF FF&o 6.< 2#%CC%C BFF9HM &<$ # %CCO2  " @ @@ #%S9F#HBFQF"HO ! ! ,KO  0b   @@ +C C +F  o &DaFH,!FHPJ*J (J'*J (J-MFF@+FFFF@ .F$)F (F3ZRF0F.IRB('FO FDjE)I #D0B4}C# F.'#NB/!P3kDH I0XF-0@*00F!DD  - 00۲ 0 0; x$p31o OJJJ?J-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FD8`h ;hDD8o 7F , F-A FFFB(F7GE(GF!F:F(F6ЮE]$O  D i E DEB   )iaE8 `` GEќB<ЬE $ D`E 8GE5B iB $D`EEO0$,AhB !t,Q\ 9BMahE(O2RE  *F!F ( #*F"($ F "poBdp FFF 2F)FH Fpd J#FF F "chh{ DB DFO (FbEOF F!!QF<2 F !bQF)F +hZ*`x)+!K2! FQF/+`9F F+K**Yx ?) "3+`1F F?)3 "+` " ""XF(+h FZ*`xGJ JJ J3J7% RRRRR x!^SBSA 2)FFxx+! Fm F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pڱLC+B &\\D 0D 2ҲBѩBFpFJO2ڿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFzFFB5*F9F0F#lsU F8F F+F)BНB 8FDBFx2,8F00@F$ F8)FVF 0\oF(D@&=F66.G ѽ0"[ CC[00)F?C F0|0 FFhF*F!FhF0FhC3SCC`pGHlJK`pGlJ H#FFF砆Q PHJF &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '8M9N FEO | ӽMO @ H@1L L  A AA %H"  O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@Fк ! &+RBcC)𞀺O -'< !q+'<)>R>O  '4-'< x <!x_ @K1   #B B@RR40#!0 B FFOEE8/p5EE<0#+pDјECX<k &0&"F+F:1$s<DF+F0&1Rк кz-'<  XF CE83:$s<D"F+FO FCE8p3CE8p3:B@(D FF; )@"FF !:,BE8^]8lCE8p3)J-AF*K*FFF / F'B<"pB "B0Bp;2B+Bȿ#D#F !!F(CD? B $B"p7Bp<3JF%KF*FFF0F'F("FB)+ &"F`B*B DB82B۫BԿF!ȿ"= DD"FO `B88B8p2DJ-M FF(CF(O:(;xkBVE83psE<# <%+VE3pt$F-*A0*Y0: *JFO F+0 (Ox.*hZx_0 )\9F# F+0 L#s9xh)X7:xx*b*r%*X*VE<%#3p;xt+EspDFzx{+* г * #* **O8DDD@D #"0UD"0**џU;FO3#z)k) L)zFZ)O1Dl@l)xxl(L!7c:*P"5JJJJJJJJJJJJJJJJJJJJJJBF3F !SE8p3:*ܸ3̿F"ODDVE8U;83p !#FFD* ܸ3ؿ#D&F7SE8p3l)U+QF40FCFFg)FQ+yxU)I)M)RD) и? OD D! i)pm)@a)O hDa#QF0F#B4QFCF0FFFF(FQFCF0FF(F_vI{x\;FRFD@!O:oM @ @\O (\Pp) 1F1)А!$@p4 CFPD@x$@4){O F  F <9 һ FO.   "*Txl*B*L* "" s*  F"4CFQF0FU"".I o  F+h4F`5VE82pD  D L)5%Fih[+0F FQF]FF? l) Z) h)*ht)z)!*h*h-h*E1JJDJ FjB ` F S+[]pGF FoAPR]pGmF FhFOaFhF0 F mQ ]pG#F M Oku5 F !D#F$01 +.FO0F Jx0+ Cx J\D 3۲x+#0 ` h # `pG h+# `J Jò\D D 3۲9+Կ0WpGOppGJ F!F&F0xB.`F" "#`FFFbFo:F FBx*3B *(` x-,н@0@B F"hIx\D 3۲k+m+g+рS#`Sxi+2"`#hxB*3#`J-A FS!F FFfB FC1A8 F"hMx\D 3۲k+ m+g+щAQAQS#`Sxi+2"`#hAQxB*3#`8JpFF)KB J \@Fl;]v `!p@8B!`O0pJ"տ!-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0QhJ-EF&O8 jD# uB ci+#kHh#CЩh@F!D #BB!@Dj(??1!?6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@DVii(??1!?6yF+*ѽ@,j,DDhhbich+!2hci!?D?1!? 6+Bۨi!i)Dm&('KhFBH +H ELFJ'J#J`J`J`J`KJ#?`pGtJ|JxJpJaJdJ-M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FKhMdJJJp N MI2h+h hS@ B L Kh H/3h#`"h(hp@I"`|JJJxJJJJKhP 2A1JhB  L#h3+#` H#"#`K``|JlJhJՍJ̯J-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQFa B ѣyyC#г6@0FQ#q#qFBFF4::F!FPF5BFF&I/:FYF F*F51F*F")F8FMO;h+"KhEN0h"AF#MFFRF FLG"AF(h!h(h#;`#`3`JJJ|JxJtJLJpJKh8 pG|J-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H~(b"!9H(\^##p#'cp#5Hpp'qiF(Z(Ra#cq#qq:F0F4)HS)K'F(FF@F<#;FFAF`p8Fh7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH]4;FJ/*JfJ9JQJ-AFFB!x)ѽ)ex1)^С3ڲ*SH6U+R#u*J}*J*J*Jc)Jc)Jc)J*J*Jc)Jc)Jc)Jc)Jc)Jc)J*J*J)S!*J *Jc)J*Jc)Jc)J%*Jc)Jc)Jc)Jc)Jc)J-*Jc)Jc)J*Jc)JY*J")H5,D"&H"%H- #*F"I#H':F@F#0/F?- @#*FIH?'d/F"HxKp"HKO*F8FnO5JJJJJJԌJJJJJJJJ"sF1F BKB#MEq+p+x1Fl +xl,p@pcScJ-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDlKx l4 F@hKx+Ob!FfHeI xdH?QF"cH#3`aKh^IF_H!F+M 3Zx2DWHMپ"TI:F( "QFs+?yLN7h/?}/?q/ FAFO FA0BI@)F@R F=IOb F#D#wcw#0JwFwh5J R$ "% 4BF'#&IF8 "I"BF BFQF!J9Fhp7D# FC"O1i)D J$JcScJܯJJJJJJJJpJJJJLJ/JJMbJ K`K`;"K`K` JJJJ-M$aH@(!FF\Kt`\K]Hh%1`@@R! F@VIOb FZO#SJDwwFhNJ R$ "% ("i",b"0["4T#;OF9F8L"8IN+F*FAFpoxxFC#:y(FCCzy.OCc*K-h*1 "8F9%Kh;G#P" C" FD#O1xKIh#H0)DF`POG"P2`JJJLJJJJJMbJJ$J JJ/JM+JKhBKhB H@̼ K Ih@o(O``H@JJJJ/J' (] 8FnF#h FkiG"!(5 8 !F@h~( F@IahHoJcJFCl hki㱀lA F7yByCyCyCzCBzC#h FkiG&ah@He(ah@H]J<JFF(F#3`3qEIF"l:F(OAI"l2F(G+hki+V;OjFl;H 0C yC C C C#yyO  Fp+hkh+"F(FG,$oo-A' i4$H F"HF(7F(2$Ol[l@F8FZhl.BHB[lH4G+H d% J/J8JJBJ2#` FFFFF1F(j FhBa}#}}C#}8A! H[IhGܯJدJЯJzJxJJJ`JKOsB @s@ B  pG pGzJpKFOsBFd"(F!"I@s rBӲ" +sjsp@to~)s!ds$ iss+tjtzJJ8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuJE"Fp"[p#p0ICr Bp[#q#cq@#q#h#r0`qiFrr "" ! Fr rԯJFFB"w"JFh!4{rd+uu#",v$kuulvvvJ-MFpFFF/>)2"J?FOb)F8F F*0 ZF1F8SFI"(F 4$K`K`K`K`K`A FO6M O0oLJJJ|JtJpJhJlJ$$) x"+219:*K? "+#ppG;:!H8 J(())+ #@O_ O KhcH  Kh#HKh H"IH\(CF(H H H 甸JJJJJJ9JJ=JJJHHISh (H"K @{ H" K` ~H @VJ_JcJ̯J}J("bK-M`#"||00]N^KF`7h u`#03`(F@h(o7` F#0JK`- 5-=@ V#DL0,( `?K`0" --$$ho?甸JįJJ̯JHJDJJXJTJ|J]JJPJeJJJ|J)J-AHF FF:!@FJF@Fop8`*Fq F# ,D<(*FIJFCF#IҲ(]x Jhx0; +!@@pOpFK xJFK zJmFhFJhB2CC KB 3B J` mJo{O0猸JJJm FFhFJhBCCC" K H` " F mo{O0JJhJm FFhFJhBCC K "!FH` F mo{O0猸JJhJm F FFhFS!JhB,71 CCKx"7,) "H9 @ oJx#p m Hy HvO0 K@*(@"`o{J|J(J'J!J$JM F FFhF%JhB>@2CCC5I x* ##3]#@$B& 0M/+(hI(hF(h"F9F0D+h3D" U M"F9F+hO0o{猸J|JJJFC#DBFF)/*0pmObFFhF.JhBPR#+L F mp+&M(h# $Kx)$BJ+hh"FD`KhB`+$dBIHOQ(h)+ ##3]#@ $ O4o{JJ|J|JJLJ FF$JFhM0`"OpJBb`J`BJxO@p-ea a*FDK-h0*F!F8DKB3B KKhKIh h H Mo"猸J|JLJJJJJJ]lFFOrOS##F333#bbb ИBF2F"RjDr`*F9F .& 3D"F!Ha ]0]lFOSOr##333#bKx "I ^"F! H6 ]0 MI*h cbJ+h #D|J(J$J-E]lFOSOr%#KUxUU%b "I uD"F!H ]8 (F Icb0#P``|J(J$J-M]FOSOr'#7KFxwww 'b. ".I D оB3F+F#S3kDs`2FAF"F!-%+DH} ]ORIbb "H6&(*F"S3 r`2FAFv-%+D"F!|JhJK]h3KhOrOS##jF333! #H% ]]JJ0Kh;+ 7>CJS+K+Jx$#Or33OR!##H#jF]KJx#3Or33O@r3Kh]5]Kh]KhKh]]_J|JJJJJp Fo9KJhB5JL#h;+0%6oW FFEH|0###`D FFAH|0#|0;H##|05L##`p4H3Kh!|C/H0.Kx+##`3##"#`)K`Ob(K`p@$X|0#H#M(h"K.h`0F#.`<|FO`I-Jh+D`+#-"K`JJJ̯JJ JJ|JJJJJJqMJL#h3+#` HT@ HMO`#hI@ JTJ{JqMJ"-A=K=M`=K>Ih>LOb(F+`!`{;O:h:IC h#Ҳ!h5H h3N0`@F #<F,H#I&J+H*I hS*Kh:;h(hC@B'H!h&L2h&H!hII$H h!"J@t!K"Hh!IO`H!"KH`K`OzrK`"A* JJJJJJPJnJJJJJJJJ JJSJ|J3JqMJKJ JJJJ"K`̯J$MF$HHBp"I"L*h"K"I` hOb'$hJD)hF# Fh5%!J!ueu[v#vuu%vevK6`uK u(F`[ K`@JJ!OJLJ|JJJJpJhJlJ-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! Fr r%uuuu u(FFD9F2Fn1F(FM.J̯JJKKKNh2h:*S]jSSwOrRAI F?HP0D F=I=IJTJXJ\JJ̯JLJOJ^JqJ-EJFh(B3ыO:h*ЊI hBБ)(غ%!ooб@.~M`.h@q`EbzL#BxJ+#DwJ"o:`nJ qL`BlKlKE澥 iIPFFx(FfJeJBFdHZ#;`bIPFFx(F_Kh2\HD#;`ZIPFF LK5牲*P)`:*!":`AJ)`ONJ0`MJ`(LHG)hKHKH@E7J7JB?z>JhaX3`K2h`>K>I(h`Q=H"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0iR1=C.)D![NYd9ir;5<̬t@).'F%6L% A5J3J0J7J2Je.J!8J93J11J2J4J}7J2J).JnW ?m9ir;nW ?m9ir;aʓ +8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b3Dh&P]`FC=݋#1--'?M(s*K>;4J4J4J4J4J4J4J4J4J4J4J5J5J5J5J 5J(5J05J75J>5JE5JL5JS5JZ5Ja5Jh5Jo5Jv5J}5J5J5J5JžJ!J)J 6J^JJJԇJهJJ#9J5J8JJ<JJJJJJJJJJJJJJJ9JJJJJJJJJ:J~J~J~J~J~JJJ2JsJJsJJsJJ @ @@JJJ@JJJXJJ JٌJYJcJmJڍJWJJJJJgJ_J_JcJJ(", *$.)#-!+%/JJH>Jl>J>Jp\Jp\JJJJJ*J*J+J+J+J+J+Ju+J]+J=+JBJBJECJa:J9:J:J9J:Jy;J1CJ9J1@J@Jq?JmAJ?JoJVJWJVJyVJ9VJUJ2~JRJ8(H+J@ @ '@BJJJ#J5JEJXJiJ{JJJJƐJאJJJ J JkJ{MJMJMJMJLBJMJMJMJMJCJLJ5JPJQJ@x}uu@x}e @JSJ^J>JJJ)JJJJJJJJJ5JJ MJ=JiJEJJkJJJJJU JQJJ;J\J=JIJJaJJJJYJJIJY"JJJJ/JeJJJJyJJ!JJMJJJJcJJJJuJJJJJ JJJjJ5J5JJ5J 5J 5J5JY>J5J '6J 5J 5J5JJ5J5J5J6J6J%6J.6J96J8lJ [JmJ[JmJ[JmJ[JnJ [JnJ "\J oJM\J lJi\JmJJJcJǃJ`ppp@@@@@@@@@;Zx0N`JtJJJJqJ=JJ]JJ]JJ]JJ]JJ]JJ]J~J]J~J]JڂJJJJ)J;JMJ_JrJJJJJوJJJJJ>J=J>J=J5>J<J8JTJTJ'JTJ TJ TJ TJ TJ TJTJJsJJsJJsJTJ'JTJTJTJTJTJTJTJTJTJTJTJSJJJJJJJJJJJJJJˁJ JׁJցJ܁JuJJJJJJJ JJ%`J .`J >`J I`J T`J \`JJh`J?$]J\J\J \J \J \J ]J $]J/]J]J_J +_J G_J c_J _J _J_J$]J_J_J]J_J_J`J`J^J ?^J ?^J^J]J$]J ]J $]J k^J |^J ]J^J"^J^J^Jb^J]J]J ]J $]J ]J ]J ]J^J"^J2^JL^JZ^J M]J W]J r]J ]J \J]J]J$]J @ @`00JJJ3cJIJ1J!J;JݕJeJ9J,JJ,pJ$JpJ@J qJ\JqJxJqJJqJJqJ͆JHrJJdrJJrJ JpJ<JpJYJpJ,JGJ_JwJJJJՀJJJOJ ǖJ JJ8JRJkJJmJJJJ?JJ‚JJJJ`JJ`JJ`JJ`JJJJ,JFJ^JwJJJ„J܄J J- J JjJDpJJ$qJJ$qJJ`rJJےJɕJyJϒJÒJJqJЇJqJ}4JM4JC4J14J4J,tJ}5J3J3JJJ JJ 6JpJNJxqJfJ pJAJsAJYAJBJ7\JbLJtJC؄JQJ1hJIVJ&>J%[J|eJlJJ<J<J<JjoJ<J<J<J<J<J =J=J =J=J =J%=J*=J1=J==JC=JK=JS=J[=JS=J_=Jd=J sJm=J t=Jz=J =J=J=J=J=J=J=J=J=J=J=J=J=J=Jv=J|=J=J=J=J>J >J>JSJSJ6J6Jx6J6J~6J6J6J6J6J6J6J 7J6J7JSJSJJ;J <J<JY>J4<J:<JA<JH<JL<JU<J[<Jb<Jh<J:Jn<J6J<J<J<J<J<J<J<J>J<JSJSJ6J6J6J6JJ6JSJSJ (7J17JGJC7J<J<JT7J\7Jm7Ju7J5J7J7J7J 7J7J 7J7J&8J8J%$8J/8JJE8JS8JY8J j8Jt8J8J8J8J8JxEJ8J8J8J#8J9J#9J.9J A9JJ9J\9Je9J~9J9J9J9J9J9J9J9J9J9J:J:J,:J8:JJ:JT:Jk:Jw:J:J:J:J:J:J:J :J:J!;J;J"I;JT;J$s;J};J';J;J(;J;J);J;JSJSJJ_~J~Jx~J;J:J>JrJ>JrJ>JrJ>J qJ5J 8(0 #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentu-boot*EHCI Host Controller  * +,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banks%s:%u: %s: Assertion `%s' failed.do_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_devicessunxi_set_gatedev_get_parent_privdevice_removesun8i_emac_eth_of_to_platphy_device_createsunxi_set_reset_ehci_create_int_queuemusb_host_rxallocate_instancefs_devreadefi_free_poolefi_runtime_relocatedev_get_uclass_privsun8i_emac_eth_startmusb_rx_reinitefi_free_pagesdev_get_privmusb_ep_programdev_get_uclass_platmusb_h_ep0_continuedev_get_parent_platmusb_h_ep0_irqfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue #gpio-cellsalloc space exhausted DRAM: arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Hit any key to stop autoboot: %2d  0%2d AXP-gpiogpio_axpaxp_sysreset*?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** ** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into loadablesThe given image format is not supported (corrupt?) ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': Scanning global bootmeth '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid Automatic boot of image at addr 0x%08lX ... compatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s fwupdarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] CACHE: Misaligned operation at range [%08lx, %08lx] %s: %s: error: gpio %s%d not reserved bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) clock-divclock-multclock-frequency#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesxtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...%.*scyclic function %s took too long: %lldus vs %dus max bootcmd=run distro_bootcmdbootdelay=2baudrate=115200preboot=usb startloadaddr=0x42000000arch=armcpu=armv7board=sunxiboard_name=sunxisoc=sunxistdin=serial,usbkbdstdout=serialstderr=serialbootm_size=0xa000000kernel_addr_r=0x42000000fdt_addr_r=0x43000000scriptaddr=0x43100000pxefile_addr_r=0x43200000fdtoverlay_addr_r=0x43300000ramdisk_addr_r=0x43400000dfu_alt_info_ram=kernel ram 0x42000000 0x1000000;fdt ram 0x43000000 0x100000;ramdisk ram 0x43400000 0x4000000fdtfile=sun8i-a83t-cubietruck-plus.dtbconsole=ttyS0,115200uuid_gpt_esp=c12a7328-f81f-11d2-ba4b-00a0c93ec93buuid_gpt_system=69dad710-2ce4-4e3c-b16c-21a1d49abed3partitions=name=loader1,start=8k,size=32k,uuid=${uuid_gpt_loader1};name=loader2,size=984k,uuid=${uuid_gpt_loader2};name=esp,size=128M,bootable,uuid=${uuid_gpt_esp};name=system,size=-,uuid=${uuid_gpt_system};mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=fel mmc_auto usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then run scan_dev_for_boot; fi; done; setenv devplistbootcmd_fel=if test -n ${fel_booted} && test -n ${fel_scriptaddr}; then echo '(FEL boot)'; source ${fel_scriptaddr}; fibootcmd_mmc0=devnum=0; run mmc_bootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_mmc_auto=if test ${mmc_bootdev} -eq 1; then run bootcmd_mmc1; run bootcmd_mmc0; elif test ${mmc_bootdev} -eq 0; then run bootcmd_mmc0; run bootcmd_mmc1; fibootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; done%s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available reg-namesunbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone U-Boot.armv7bootp_archInvalid pxeuuid: %s bootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list error: overflow occurs , Build: %sPXEbootefi %lx %lxefi/boot/bootarm.efipxefile_addr_rtftpextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sDriver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p Class Index Probed Driver Name ----------------------------------------------------------- uclass %d: %s %-3i %c %s @ %08lx, seq %dset_dir_flagsget_valueset_valueVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s %-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmdError: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Trying to execute a command out of order ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... List of available devices: %-8s %08x %c%c cyclic_demoRegistering of cyclic_demo failed Registered function "%s" to be executed all %dms function: %s, cpu-time: %lld us, frequency: %lld.%02d times/s data abort Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s -n## Resetting to default environment edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! New length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d '%s' is not a number %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Missing disk guid Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_nameenumerateguidsuccess! Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) CRC32 for %08lx ... %08lx ==> %04x: %02xreadingError %s the chip: %d Valid chip addresses: %02XError: Not supported by the driver Invalid bus %d: err=%d -s## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier | %-*.*s| %-*.*s| %s ParentDriverCan't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? FDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available activeeth%d : %s %pM %s not used Supported partition tables%c %s: 0x%x-bootableUnknown option %s %s%xping failed; host %s is not alive host %s is alive poweroff ... prefetch abort Invalid pxefile address: %s Config file '%s' found Config file not found The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... %llu bytes written in %lu msfmtgsubCould not set var invalid op ** Abort software interrupt ## Executing script at %08lx pin-controller device not selected %s not found -pext2fatInvalid filesystem: %s Error reading config file undefined instruction starting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)%2u %2u-%2u = %5u %sefiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed NetMemEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition %x:%xCannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout EHCI fail timeout STS_ASS reset EHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) %s %s: Failed to get clocks (ret=%d) %s %s: Failed to enable clocks (err=%d) %s %s: Failed to get resets (err=%d) %s %s: Failed to get deassert resets (err=%d) vbus-supply%s %s: Error enabling VBUS supply (ret=%d) %s %s: failed to shutdown usb phy (ret=%d) %s %s: failed to disable VBUS supply (ret=%d) %s %s: failed to release resets (ret=%d) %s %s: failed to release clocks (ret=%d) RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}0:autoUnable to read "%s" from %s%d:%d... Unable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... .flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdev Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** ${Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. ** Unable to read file %s ** UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesethernetlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. /__local_fixups__/__fixups__/__overlay__//__overlay__/__symbols__failed on fdt_overlay_apply(): %s base fdt does did not have a /__symbols__ node make sure you've compiled with -@ fdt_root: %s serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer ///./../binmanmultiple-imagesMMC Device %d not found ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): descriptionUnsupported %s address size datadata-offsetdata-positiondata-size/imagesalgounknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... Bad Data Hash No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSignCan't get image data/sizeerror! %s in '%s' image node Corrupted or truncated treeUnsupported hash algorithmCan't get hash value propertyCan't get hash algo propertyBad hash valueBad hash value lenuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Jump offset is too bigError: writing directory entry outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to write file %s ** %s %s: PHY: Failed to exit %s: %d. #phy-cellsphy-names%s %s: PHY: Failed to init %s: %d. %s %s: PHY: Failed to power off %s: %d. %s %s: PHY: Failed to power on %s: %d. Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %upxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sBase path too long (%s%s) Retrieving file: %s SPLsunxi SPL version mismatch: expected %u, got %u AXP0-Bank %s: %s%d: %s: %d [%c]%s%s%s.%s%dError insufficient memory gpt_partition_listMore partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> ERROR: %s device removed! ERROR: OHCI Unrecoverable Error, controller usb-%s disabled ERROR: USB-error: %s (%x) ERROR: USB-error: %s (%x) ERROR: USB HC TakeOver failed! ERROR: USB HC reset timed out! 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drvNo I2C bus selected u-boot,i2c-transaction-bytes+,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Could not find script subimage data Wrong image format for "source" command unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudratebinman_init failed:%d load-environmentMMC: Net: WDT: Failed to register %s for sysreset WDT: Not starting %s WDT: Failed to start %s %s=%s%d.%d.%d.%d./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rsocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' Device tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes prebootNo CLI availableunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! PHY extended status read failed, assuming no 1000BASE-X MII devices: '%s' Current device: '%s' No such device: %s PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T fel_bootedfel_scriptaddrmmc_bootdev%s%s.dtbfdtfile Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc_blkMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd mmc write failed vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modebus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! udevice *)(NULLcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vStatus Error: 0x%08x Timeout waiting card ready Error enabling VMMC supply : %d mmc %u error cannot set clock to %u MMC: no card present writing%08lx: %02lx %04lx ? %08x %0lx %04x #(-27config->num_eps <= MUSB_C_NUM_EPSUTMI-8, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%smusb_init_controller failed with status %d MUSB host is not registered %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %s: failed to get clock %s %s: failed to get reset failed to get usb PHY Allwinner mUSB OTG (Host) cell-indexu-boot,i2c-slave-addrEPTGMKautoloadNFSCannot autoload with NFS Cannot autoload with TFTPGET *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %d (%x hex) ICMP Host Redirect to %pI4 netretryyesoncerootpathdnsipdomain*** ERROR: Cannot mount done *** ERROR: File lookup fail *** ERROR: Symlink fail *** ERROR: NFS version not supported /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Retry count exceeded; starting again T <>:"/\|?*reg-offsetreg-shiftreg-io-width/configu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-typeohci: Error out of memory allocating int queue ohci: Error out of memory allocating urb ohci: Error submitting int queue job ohci: Error out of ohci_devs for interrupt endpoints USB OHCI %x.%x ERROR: submit_control_message: pipesize for pipe %lx is zero %s %s: failed to enable clock %d %s %s: failed to get clock phandle(%d) %s %s: failed to deassert reset %d %s %s: failed to get reset phandle(%d) %s %s: failed to shutdown usb phy %s %s: failed to assert all resets %s %s: failed to disable all clocks ## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdoutstderreth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,targettarget-pathExpected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%du-boot,efi-partition-entries-offsetCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfiggroupsfunctionpinctrl-namespinctrl-%d%s %s: could not find pctldev CPU: Allwinner A83T (SUN8I %04x) fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%seMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%spxeuuidError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 pre-reloc realloc() is not supported^%s$## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d %s=%s regulator-nameregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvolt#reset-cellsresetsreset-namesWaiting for PHY realtime linkHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command stdout-pathNo serial driver foundError get-and-setting cluster Error: no space left: %llu uuid_disk=name=,start=MiB,size=MiB,uuid=;uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: readonly variable%.*s.%.3s~%dWorking FDT set to %lx fdtaddrError compiling regex: %s %s: No match ## error: pattern buffer overflow: have %d, need %d ethernet%dethaddreth%daddrserial#%08x%08xmodelModel: %s Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x %-10.10s %3d [ %c ] %-20.20s | `-- |-- (effective Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s (T)reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Unknown01/01/2023skufamilyproductUnknown Productasset-tagmanufacturerERROR: sohci_submit_job: EPIPE ERROR: ep_add_ed: pending delete ERROR: sohci_submit_job: ENOMEM ERROR: need %d TDs, only have %d ERROR: sohci_submit_job: EINVAL %s: Failed to probe keyboard '%s' (ret=%d) In: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-stdbootmeth_distrou-boot,distro-syslinuxbootmeth_pxeu-boot,distro-pxebootmeth_efiu-boot,distro-efiaslr-moveaslr-randefi-runtime-randrandom-randvbe_simplefwupd,vbe-simplepoweroffPerform POWEROFF of the devicePerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowssourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryconinfoprint console devices and informationdmDriver model low level accesscompatdevresdriversstaticuclasscyclicCyclicecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsI2C sub-systemcrc32loopmmmwnmprobeolenitestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsrNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoldisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part types - list supported partition table typespinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] commands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r default-arm-sunxi-sunxidefault-arm-sunxidefault-armsetexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagegptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable read - read GPT into a data structure for manipulation gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageusb_kbdusb-keyboardmd5sha1sha256crc16-ccittBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsisatanvmeefiloadervirtiopvblockfixed_rate_raw_clockfixed_clockfixed-clockfixed_factor_clockfixed-factor-clocksunxi_clkallwinner,sun8i-a83t-ccuallwinner,sun8i-a83t-r-ccuallwinner,sun8i-h3-r-ccuallwinner,sun50i-a64-r-ccuclk_sun6i_rtcallwinner,sun6i-a31-rtcallwinner,sun8i-a23-rtcallwinner,sun8i-h3-rtcallwinner,sun8i-r40-rtcallwinner,sun8i-v3-rtcallwinner,sun50i-h5-rtcallwinner,sun50i-h6-rtcallwinner,sun50i-h616-rtcallwinner,sun50i-r329-rtc/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfi25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiunusedfuncgpio_sunxiwdt_rebootwdt-rebooti2c-chipi2c_generici2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2csun8i_rsballwinner,sun8i-a23-rsbMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcsunxi_mmcallwinner,sun4i-a10-mmcallwinner,sun5i-a13-mmcallwinner,sun7i-a20-mmcallwinner,sun8i-a83t-emmcallwinner,sun9i-a80-mmcallwinner,sun50i-a64-mmcallwinner,sun50i-a64-emmcallwinner,sun50i-h6-mmcallwinner,sun50i-h6-emmcallwinner,sun50i-a100-mmcallwinner,sun50i-a100-emmceth_sun8i_emacallwinner,sun8i-h3-emacallwinner,sun50i-a64-emacallwinner,sun8i-a83t-emacallwinner,sun8i-r40-gmacallwinner,sun50i-h6-emacGeneric PHYRealTek RTL8201F 10/100Mbps EthernetRealTek RTL8211FRealTek RTL8211DNRealTek RTL8211ERealTek RTL8211Bsun4i_usb_phyallwinner,sun4i-a10-usb-phyallwinner,sun5i-a13-usb-phyallwinner,sun6i-a31-usb-phyallwinner,sun7i-a20-usb-phyallwinner,sun8i-a23-usb-phyallwinner,sun8i-a33-usb-phyallwinner,sun8i-a83t-usb-phyallwinner,sun8i-h3-usb-phyallwinner,sun8i-r40-usb-phyallwinner,sun8i-v3s-usb-phyallwinner,sun20i-d1-usb-phyallwinner,sun50i-a64-usb-phyallwinner,sun50i-h6-usb-phyAXP0-VBUS-ENABLEAXP0-VBUS-DETECTPH11PD29PL6sunxi-pinctrlallwinner,sun8i-a83t-pinctrlallwinner,sun8i-a83t-r-pinctrlbias-disablebias-pull-downbias-pull-updrive-strengthaxp_pmicx-powers,axp152x-powers,axp202x-powers,axp209x-powers,axp221x-powers,axp223x-powers,axp803x-powers,axp806x-powers,axp809x-powers,axp813regulatorns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartwatchdogsunxi_wdtallwinner,sun4i-a10-wdtallwinner,sun6i-a31-wdtallwinner,sun20i-d1-wdtsunxi_resetusb_dev_genericu-boot,bootdev-usbNo ErrorCRC: Last data packet from endpoint contained a CRC error.BITSTUFFING: Last data packet from endpoint contained a bit stuffing violationDATATOGGLEMISMATCH: Last packet from endpoint had data toggle PID that did not match the expected value.STALL: TD was moved to the Done Queue because the endpoint returned a STALL PIDDEVICENOTRESPONDING: Device did not respond to token (IN) or did not provide a handshake (OUT)PIDCHECKFAILURE: Check bits on PID from endpoint failed on data PID (IN) or handshake (OUT)UNEXPECTEDPID: Receive PID was not valid when encountered or PID value is not defined.DATAOVERRUN: The amount of data returned by the endpoint exceeded either the size of the maximum data packet allowed from the endpoint (found in MaximumPacketSize field of ED) or the remaining buffer size.DATAUNDERRUN: The endpoint returned less than MaximumPacketSize and that amount was not sufficient to fill the specified bufferreserved1reserved2BUFFEROVERRUN: During an IN, HC received data from endpoint faster than it could be written to system memoryBUFFERUNDERRUN: During an OUT, HC could not retrieve data from system memory fast enough to keep up with data USB data rate.NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(1)NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(2)ohci_genericgeneric-ohciehci_genericgeneric-ehcisunxi-musballwinner,sun4i-a10-musballwinner,sun6i-a31-musballwinner,sun8i-a33-musballwinner,sun8i-h3-musbext4unsupportedEFI block driver1.5FDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbaseboardchassisseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlanERROR: submit_common_message: pipesize for pipe %lx is zero ERROR: sohci_submit_job failed ERROR: CTL:TIMEOUT ## error: substitution buffer overflow %s %s: failed to disable usb_%ldphy clock %s %s: failed to assert usb_%ldreset reset %s %s: failed to enable usb_%ldphy clock %s %s: failed to deassert usb_%ldreset reset phy_ctrlusb0_vbus_power-supplyusb_vbususb_vbus_detusb_id_detusb%d_phy%s %s: failed to get usb%d_phy clock phandle usb%d_reset%s %s: failed to get usb%d_reset reset phandle pmu%dgmacgpio_ingpio_outi2c0i2c1mmc0mmc1mmc2spi0uart0uart1uart2gpio_ingpio_outs_i2cs_rsbs_uart%s: Missing variant stmmaceth%s %s: failed to get TX clock %s %s: failed to get TX reset sysconallwinner,sun8i-h3-mdio-internal%s %s: failed to get EPHY TX clock %s %s: failed to get EPHY TX reset allwinner,tx-delay-ps%s: Invalid TX delay value %d allwinner,rx-delay-ps%s: Invalid RX delay value %d snps,reset-active-lowsnps,reset-gpiosnps,reset-delays-us%s %s: failed to enable TX clock %s %s: failed to deassert TX reset %s %s: failed to enable EPHY TX clock %s %s: failed to deassert EPHY TX clock %s: Timeout eGON.BT0TOC0.GLHUnknown boot source %d ahbcd-gpiosNo host cable detected: failed to enable clock failed to deassert reset gpio inputgpio outputdisabledfunction %dP%c%dapb%s: (CLK#%ld) unhandled %s: (RST#%ld) unhandled syntax error System reset not supported on this platform ERROR: index > length FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed HUSH_VERSION0.01( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?USB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusbkbdnulldev%s: warning, ret=%dlun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s 2H53F6CDBA Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx vbecur-versioncur-vernumU-Boot bootloader-versionVersion: %s Vernum: %x/%xU-Boot 2023.01+dfsg-2 (Jan 18 2023 - 01:57:16 +0000) Allwinner Technologytimeout-sechw_margin_msu-boot,noautostartu-boot,autostartunable to find wdt device cyclic_register for %s failed every %ldmsWDT: Started %s with%s servicing %s (%ds timeout)  smbios_SM__DMI_ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d BqRJiSJSJPJuRJUJaTJSJqSJuUJ}UJPJ1UJtJrJrJ[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OSJxJSJSJHAJxJSJSJ8JxJSJSJJxJ SJSJOAJxJ@SJSJWAJxJSJSJ[AJxJSJSJ`AJxJSJSJJxJSJSJ<JxJzJSJSJscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr:NCJ!xJ-JSJSJSCJ!xJ~JSJSJ[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead CJxJJSJSJDJxJхJSJSJ DJxJJSJSJDJxJJSJSJJxJJSJSJDJxJJSJSJcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree Dump tree of driver model devices ('*' = activated) dm uclass Dump list of instances for each uclassJxJهJSJSJ4JxJJSJSJcyclic demo - register cyclic demo function cyclic list - list cyclic functions /addr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedZJxJ}JSJSJ from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] 5J!xJQJSJSJ9}J!xJJSJSJ@}J!xJ JSJSJE}J!xJJSJSJL}J!xJJSJSJS}JxJJSJSJzJxJMqJSJSJPJ!xJYJSJSJS J!xJJSJSJY}J!xJJSJSJ:J0~J85~J:~J >J?~JC~J I~J J O~J R~J JJkJ%JJ3JJJ?J7JJ"JPJJ;J!pJ;JGJeJ}@JJ/JJJCJJITJMJ JJJJ5pJJ)]J"JJJq#JJJJ`J`JtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJ~JJ~JJlJlJulJ~J J_lJOlJ-lJ~JJlJlJkJnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@}6J HJWJxJűJ"WJ>WJBJxJa}JBJSJBJ!xJ~JBJBJ6JxJ wJAJSJ@JxJ wJAJSJ]CJ!xJJeCJȱJDJ!xJJDJEJTBJY{J1xJ]BJJzJ JxJevJ%AJЪJiJxJJiJhJDJ!xJAJDJDJCJxJJCJٲJXJxJJXJXJCJxJIJCJSJ+iJxJ=J9XJEXJJ!xJ!J>JSJ*|JxJJ3|JO|JsJz>JxJaJnJnJOJxJQxJeAJSJQVJ!xJJXVJxVJJ!xJJ?J+?JzJxJMqJ{J*{JsJPJ!xJ٘JPJ0PJ`}J!xJYJh}JSJKJ!xJJp{J{JsJnoJ!xJJvoJoJ}JxJJ}J}JJ!xJJFJGJrbJxJJxbJbJhBJ!xJ|JoBJJrJxJJrJrJ\TJxJ!JsJsJ^iJxJJgiJhJ|sJxJJsJJxJ J/tJ>tJtJxJJtJtJLBJxJxJ)BJSJ'JU`J6JJCJn J"JM$aJ8>J4cJRJJ~>JTcJaUJJ_>JDcJUJJ+JaJ'QJ9QJQJ$J8bJձJ(HbJtJbJ9J(qJbJNJtcJޏJ%dcJEJt dJuJwJJ J,dJm6JpJJ'qJuJJ,$rJ JlbJJ(|bJ:J.J|eJJ.JeJJ4DeJUJ2,iJJ%JJTiJ^J9JhJJhJJ(JʈJcjJ#?J<J0jJ+JtTjJ`JO`J4J S'JS8JHJdTeJJRHpJe'JJJ2|rJJ;JrJJrJiJ?JJ0JڃJCrJ J J88DsJJTsJ4J4JsJ~J^J,J\tJ5BJ|tJJXyJkLJ0J$JuW~JvhyJ ~J:xyJJJaJJg~J>yJBJ8_JtlsJaJJJJyJ>JleJsJrJ J*JnyJuJJ J;JJJ>DJXJu0Ju2J|JJ> J8J. J8J>JYAJH J8J>JyCJ5 J9J?JCJSJJ JqJauJ J8JJJDJōJeJՋJHJ@IJJՑJbJAJJFJeJJ >J#JyJJ)J>J%JJJ'}0JE3J%1JY0J5J.{JJJJ2JiJuJJIJ4~J:J ؄JCDJG"JMJR*J*JS'JS.JJT.J+JU5JJ\)8J6J8J^3J҈Jc :J9JHJdJ GJnWJJtyJEJKJ@ $JuJwW~JvyJ6JKJD@ $g~J>#J{?J?J(JeJlJfJJgJxJ|JJJJJJJJJJJJJJ0JXJ\JTJ\J`JJ J$JJJ JJJJ J J$J(J,J0J4J8JJJJJJpJtJxJ|JJJJJJJJJJxJ|JJJJJJJ,J0JJJJJJJJJJTJXJ\J`JdJhJlJpJtJxJ|JJJJJJJJJ J4J\JJJJhJlJpJJ4J8J<JPJpJ J J!J!J!J!J!JL#JP#JT#JX#J\#J`#Jd#Jh#Jl#Jd$Jh$Jl$Jp$Jt$Jx$J|$J<'J@'JD'JH'JP'JT'JX'J\'J`'Jd'Jh'Jl'Jp'Jt'Jx'J|'J'J'J'J'J'J'J4*J8*J<*J@*JD*JH*JL*JT*JX*J\*J`*Jd*Jh*J*J*J*JH+J+J+J+J ,J,J,J,J-J-J.J.J.J .J.J.J.JD.J.J.JH/JL/JP/J80J0J1J`1J1J1J1J1J,4J04J44J84J<4J@4JD4JH4JL4JP4JT4JX4J\4J`4Jd4Jh4Jl4Jp4Jt4J7J7J7J7J 7J$7J(7J,7J07J47J87J<7J@7JD7JH7JL7JP7JT7JX7J\7J`7J7J7J8J8J9J9J9J 9J9J9J9J9J 9J$9J(9J,9J09J49J89J<9J@9JD9JH9JL9J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:J:JD;J;J;J;J0=J4=J8=J<=J@=J=J=J>J>J>J>J>J>J?J?J?J?J?J?J?J@J@J@J@J@J@J@J@J@J@J@JAJAJAJAJ(AJ,AJJ|>J>J>J>J?J?J?J`@Jd@Jh@Jl@Jp@Jt@Jx@JBJBJBJBJCJCJCJCJ EJEJEJEJEJDGJHGJLGJPJJTJJXJJ\JJJJJJJJJJ LJ$LJ(LJ,LJ0LJ4LJ8LJMJMJOJOJOJJ?J?J?J?Jh@Jl@Jp@Jt@Jx@J@J@J@JBJBJBJ CJCJJ(CJCJCJCJCJCJCJCJCJCJCJJ>JT?JX?J\?J`?Jd?Jh?Jl?Jp?J?Jl@Jp@Jt@Jx@J|@J@J@J@J@J@J@J@J@J@J@J@JBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJBJ$CJLCJCJCJDJDJ DJdDJhDJlDJDJDJDJ`EJdEJhEJlEJpEJtEJ FJ$FJ(FJ,FJ GJ(GJ,GJ0GJ4GJ=[ahbmmcoutputsamplegahb <#okay defaultVmmc@1c1000012allwinner,sun8i-a83t-mmcallwinner,sun7i-a20-mmc I?A@[ahbmmcoutputsampleg ahb =default#okay Wmmc@1c110002allwinner,sun8i-a83t-emmc IBDC[ahbmmcoutputsampleg ahb >#okay defaultXeeprom@1c140002allwinner,sun8i-a83t-sid@ Ythermal-sensor-calibration@344=crypto@1c150002allwinner,sun8i-a83t-cryptoP PgIE[busmodZmailbox@1c1700072allwinner,sun8i-a83t-msgboxallwinner,sun6i-a31-msgboxpI*g 1[usb@1c1900032allwinner,sun8i-a83t-musballwinner,sun8i-a33-musbIg G+mc;@usbJQotg#okay\phy@1c194002allwinner,sun8i-a83t-usb-phyYphy_ctrlpmu1pmu2 IMNOP)[usb0_phyusb1_phyusb2_phyusb2_hsic_12Mg!usb0_resetusb1_resetusb2_reset#okaycn  !usb@1c1a000'2allwinner,sun8i-a83t-ehcigeneric-ehci HI g;@usb#okay]usb@1c1a400'2allwinner,sun8i-a83t-ohcigeneric-ohci II"Qg;@usb #disabled^usb@1c1b000'2allwinner,sun8i-a83t-ehcigeneric-ehci JI!g;@usb#okay_clock@1c200002allwinner,sun8i-a83t-ccuI"# [hoscloscnpinctrl@1c208002allwinner,sun8i-a83t-pinctrl$dI-"#[apbhoscloscemac-rgmii-pinsE PD2PD3PD4PD5PD6PD7PD11PD12PD13PD14PD18PD19PD21PD22PD23gmac(/hdmi-pins  PH6PH7PH8hdmi3i2c0-pins PH0PH1i2c0,i2c1-pins PH2PH3i2c1-i2c2-ph-pins PH4PH5i2c2`i2s1-pins PG10PG11PG12PG13i2s1&lcd-lvds-pins2 PD18PD19PD20PD21PD22PD23PD24PD25PD26PD27lvds0ammc0-pins PF0PF1PF2PF3PF4PF5mmc0)mmc1-pins PG0PG1PG2PG3PG4PG5mmc1)mmc2-8bit-emmc-pins3 PC5PC6PC8PC9PC10PC11PC12PC13PC14PC15PC16mmc2)pwm-pin PD28pwmbspdif-tx-pin PE18spdif%uart0-pb-pins  PB9PB10uart0'uart0-pf-pins PF2PF4uart0cuart1-pins PG6PG7uart1(uart1-rts-cts-pins PG8PG9uart1)timer@1c20c002allwinner,sun8i-a23-timer I"watchdog@1c20ca02allwinner,sun6i-a31-wdt  I"spdif@1c21000642allwinner,sun8i-a83t-spdifallwinner,sun8i-h3-spdif I,Lg  [apbspdifG$Ltxdefault%#okayJi2s@1c2200062allwinner,sun8i-a83t-i2s  I.H[apbmodG$$g!Lrxtx #disableddi2s@1c2240062allwinner,sun8i-a83t-i2s$ I/I[apbmodG$$g"Lrxtxdefault& #disabledei2s@1c2280062allwinner,sun8i-a83t-i2s( cI0J[apbmodG$g#Ltx #disabledfpwm@1c2140002allwinner,sun8i-a83t-pwmallwinner,sun8i-h3-pwmI"V #disabledgserial@1c280002snps,dw-apb-uart€ akI5g(#okaydefault'hserial@1c284002snps,dw-apb-uart„ akI6g)#okaydefault()xibluetooth2brcm,bcm4330-btI*[lpo+ ++serial@1c288002snps,dw-apb-uartˆ akI7g* #disabledjserial@1c28c002snps,dw-apb-uartŒ akI8g+ #disabledkserial@1c290002snps,dw-apb-uart akI9g, #disabledli2c@1c2ac0012allwinner,sun8i-a83t-i2callwinner,sun6i-a31-i2c¬ I2g%default, #disabled mi2c@1c2b00012allwinner,sun8i-a83t-i2callwinner,sun6i-a31-i2c° I3g&default- #disabled ni2c@1c2b40012allwinner,sun8i-a83t-i2callwinner,sun6i-a31-i2c´ I4g' #disabled oethernet@1c300002allwinner,sun8i-a83t-emac. R+macirqI [stmmacethg  stmmaceth#okaydefault/01 rgmii-idpmdio2snps,dwmac-mdio qethernet-phy@12ethernet-phy-ieee802.3-c221interrupt-controller@1c81000 2arm,gic-400  @ `   camera@1cb00002allwinner,sun8i-a83t-csi TI&ZT [busmodramg #disabledrhdmi@1ee00002allwinner,sun8i-a83t-dw-hdmik XI'^][iahbisfrtmdsgctrl;2@phydefault3#okaysports port@0tendpoint{4port@1uendpoint{5Ihdmi-phy@1ef00002allwinner,sun8i-a83t-hdmi-phyI'^[busmodgphyc2interrupt-controller@1f00c0072allwinner,sun8i-a83t-r-intcallwinner,sun6i-a31-r-intc  9clock@1f014002allwinner,sun8i-a83t-r-ccuI"# [hoscloscioscpll-periphn6r_cpucfg@1f01c002allwinner,sun8i-a83t-r-cpucfgir@1f02000/2allwinner,sun8i-a83t-irallwinner,sun6i-a31-irI66 [apbirg6 % default7 #disabledvlradc@1f03c002allwinner,sun8i-a83t-r-lradc< * #disabledwpinctrl@1f02c002allwinner,sun8i-a83t-r-pinctrl, -I6"#[apbhosclosc+r-cir-pin PL12 s_cir_rx7r-rsb-pins PL0PL1s_rsb)8rsb@1f0340012allwinner,sun8i-a83t-rsballwinner,sun8i-a23-rsb4 'I6-g6default8#okay xpmic@3a3 2x-powers,axp818x-powers,axp8139 yac-power 2x-powers,axp813-ac-power-supply#okayzadc2x-powers,axp813-adc-{gpio2x-powers,axp813-gpio|gpio0-ldo-pin GPIO0ldo:gpio1-ldo-pin GPIO1ldo;battery-power%2x-powers,axp813-battery-power-supply#okay}regulators? dcdc1Rf-~-vcc-3vdcdc2Rf `~ vdd-cpuadcdc3Rf `~ vdd-cpubdcdc4f `~vdd-gpu~dcdc5Rf`~` vcc-dramdcdc6Rf ~ vdd-sysdcdc7aldo1Rfw@~w@vcc-1v8aldo2Rfw@~w@ dram-pllaldo3Rf-~-avccdldo1dldo2f2Z~2Zdp-pwrdldo3Rf&%~&%ephy-iodldo4f2Z~2Zephy0eldo1fO~O dp-bridge-1eldo2fO~O dp-bridge-2eldo3fldo1Rfz~$@ vdd12-hsicfldo2Rf `~ vdd-cpusfldo3ldo-io0default: #disabledldo-io1default; #disabledrtc-ldoRfw@~w@vcc-rtcsw vcc-wifi-iodrivevbus#okay usb0-vbususb-power!2x-powers,axp813-usb-power-supply#okaycodec@e892x-powers,ac100codec2x-powers,ac100-codec+ 4M_adda<rtc2x-powers,ac100-rtc9I<cko1_rtccko2_rtccko3_rtc*thermal-sensor@1f040002allwinner,sun8i-a83t-ths@ )= calibration>thermal-zonescpu0-thermal >tripscpu-hot(84Dpassive?cpu-very-hot(4 Dcriticalcooling-mapscpu-hot-limit??0D@ABCcpu1-thermal >tripscpu-hot(84DpassiveDcpu-very-hot(4 Dcriticalcooling-mapscpu-hot-limit?D0DEFGHgpu-thermal >aliasesS/soc/ethernet@1c30000]/soc/serial@1c28000e/soc/mmc@1c0f000j/soc/mmc@1c11000chosenoserial0:115200n8hdmi-connector2hdmi-connectorDaportendpoint{I5leds 2gpio-ledsled-0{cubietruck-plus:blue:usrled-1{cubietruck-plus:orange:usrled-2{cubietruck-plus:white:usrled-3{cubietruck-plus:green:usrusb-hub 2smsc,usb3503$reg-usb1-vbus2regulator-fixed usb1-vbusfLK@~LK@ reg-usb2-vbus2regulator-fixed usb2-vbusfLK@~LK@+!sound2simple-audio-cardOn-board SPDIFsimple-audio-card,cpuJsimple-audio-card,codecKspdif-out62linux,spdif-ditKwifi_pwrseq2mmc-pwrseq-simpleI* [ext_clock*.+binmanCu-boot-sunxi-with-splSu-boot-sunxi-with-spl.bin\blobSspl/sunxi-spl.binu-boot-imge__symbols__ l/cpus/cpu@0 q/cpus/cpu@1 v/cpus/cpu@2 {/cpus/cpu@3/cpus/cpu@100/cpus/cpu@101/cpus/cpu@102/cpus/cpu@103/clocks/osc24M_clk/clocks/osc16M_clk/clocks/osc16Md512_clkV/display-engine/opp-table-cluster0/opp-table-cluster1/soc/clock@1000000/soc/rotate@1020000/soc/mixer@1100000 /soc/mixer@1100000/ports/port@1+/soc/mixer@1100000/ports/port@1/endpoint@0+ /soc/mixer@1100000/ports/port@1/endpoint@1/soc/mixer@1200000 $/soc/mixer@1200000/ports/port@1+//soc/mixer@1200000/ports/port@1/endpoint@0+@/soc/mixer@1200000/ports/port@1/endpoint@1Q/soc/cci@1790000/slave-if@4000^/soc/cci@1790000/slave-if@5000/soc/syscon@1c00000k/soc/dma-controller@1c02000/soc/lcd-controller@1c0c000)o/soc/lcd-controller@1c0c000/ports/port@04x/soc/lcd-controller@1c0c000/ports/port@0/endpoint@04/soc/lcd-controller@1c0c000/ports/port@0/endpoint@1)/soc/lcd-controller@1c0c000/ports/port@1/soc/lcd-controller@1c0d000)/soc/lcd-controller@1c0d000/ports/port@04/soc/lcd-controller@1c0d000/ports/port@0/endpoint@04/soc/lcd-controller@1c0d000/ports/port@0/endpoint@1)/soc/lcd-controller@1c0d000/ports/port@14/soc/lcd-controller@1c0d000/ports/port@1/endpoint@1e/soc/mmc@1c0f000j/soc/mmc@1c10000/soc/mmc@1c11000/soc/eeprom@1c140002/soc/eeprom@1c14000/thermal-sensor-calibration@34/soc/crypto@1c15000/soc/mailbox@1c17000 /soc/usb@1c19000/soc/phy@1c19400/soc/usb@1c1a000 /soc/usb@1c1a400&/soc/usb@1c1b000,/soc/clock@1c20000/soc/pinctrl@1c20800%0/soc/pinctrl@1c20800/emac-rgmii-pins@/soc/pinctrl@1c20800/hdmi-pinsJ/soc/pinctrl@1c20800/i2c0-pinsT/soc/pinctrl@1c20800/i2c1-pins"^/soc/pinctrl@1c20800/i2c2-ph-pinsk/soc/pinctrl@1c20800/i2s1-pins#u/soc/pinctrl@1c20800/lcd-lvds-pins/soc/pinctrl@1c20800/mmc0-pins/soc/pinctrl@1c20800/mmc1-pins)/soc/pinctrl@1c20800/mmc2-8bit-emmc-pins/soc/pinctrl@1c20800/pwm-pin"/soc/pinctrl@1c20800/spdif-tx-pin#/soc/pinctrl@1c20800/uart0-pb-pins#/soc/pinctrl@1c20800/uart0-pf-pins /soc/pinctrl@1c20800/uart1-pins(/soc/pinctrl@1c20800/uart1-rts-cts-pins/soc/spdif@1c21000 /soc/i2s@1c22000 /soc/i2s@1c22400 /soc/i2s@1c22800 /soc/pwm@1c21400 /soc/serial@1c28000 /soc/serial@1c28400 /soc/serial@1c28800 %/soc/serial@1c28c00 +/soc/serial@1c29000 1/soc/i2c@1c2ac00 6/soc/i2c@1c2b000 ;/soc/i2c@1c2b400 @/soc/ethernet@1c30000 E/soc/ethernet@1c30000/mdio* J/soc/ethernet@1c30000/mdio/ethernet-phy@1" T/soc/interrupt-controller@1c81000 X/soc/camera@1cb0000/soc/hdmi@1ee0000 \/soc/hdmi@1ee0000/ports/port@0( d/soc/hdmi@1ee0000/ports/port@0/endpoint r/soc/hdmi@1ee0000/ports/port@1( {/soc/hdmi@1ee0000/ports/port@1/endpoint /soc/hdmi-phy@1ef0000" /soc/interrupt-controller@1f00c00 /soc/clock@1f01400 /soc/ir@1f02000 /soc/lradc@1f03c00 /soc/pinctrl@1f02c00 /soc/pinctrl@1f02c00/r-cir-pin /soc/pinctrl@1f02c00/r-rsb-pins /soc/rsb@1f03400 /soc/rsb@1f03400/pmic@3a3# /soc/rsb@1f03400/pmic@3a3/ac-power /soc/rsb@1f03400/pmic@3a3/adc /soc/rsb@1f03400/pmic@3a3/gpio- /soc/rsb@1f03400/pmic@3a3/gpio/gpio0-ldo-pin- /soc/rsb@1f03400/pmic@3a3/gpio/gpio1-ldo-pin( /soc/rsb@1f03400/pmic@3a3/battery-power+ /soc/rsb@1f03400/pmic@3a3/regulators/dcdc1+ (/soc/rsb@1f03400/pmic@3a3/regulators/dcdc2+ 2/soc/rsb@1f03400/pmic@3a3/regulators/dcdc3+