>E>  9U @w,w www@ST0SX0@S`0Sd0@Sh0@Sp0St0Sx0S|0@S0@S0S0S0@S0S0SSSS0S0S 0S$S(0S,0c5455cMDLDc|78c;-Q> w////////00S+ Q \& /A-P@ ` pV: \ : "& \*000C0@0//www@-@ @ Q/000@00000wwwwM-`@qQ41U:1`M(8"ÌŌT 0 W00X03S0 RS  R 0 0T0F0 C 0??"0ttE4P S :!  Q *  /4wwweww`w w w@-@T000Ѝpp@-`@PEo^U P@o^ S    P0pw@-# 0 wwE-P@0 `R` T 0S0:00P긠pP  0P T 0S0#0%P ЍPPV0 0S%P T00PUTwwRQ00P0SA- ЍP@`@pP  P0SX: 0@T CR  SQA-p  P RP`  @rP W00V  0 R U @T:P/p@-p0p@Q#% PU00C B0@  BpwwM-ࠟ`PA@0040p C@ Q&"     r n 0j4 8f P    B  BQЍw00 ` /w//e.0@P/ R/0@- R 0 R0#s01 # @0 PUS0 B0` 00#s01R #0 p .~. p .~. 8 w@-%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHw# wDas U-BootwwRUNTSERVdP$wwwwwwwtwwwwwwwww0??Oo////@-e@/@-@@-0???Oo/p@-@P?0 00#0b0UOp@>?0/p@-@Po0P  0``&UOp@6?0_00;0 0Q@o0  CA_ov^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovVY@T S@No/N-N//@-@n `fVQYO{0//tРO@РP@=JHРP L8s((0 SII 8 ww@w _/_ РP/8 /0Od@P TP  Q:< 80QR:/4vv;0- $M<0 @ 0DH ! 0 L$Ѝ/s@-0`40P@0凳P  v0Pl0L`0T\\ 0F y yq0S 00 8 T6/Ѝplwlwlwօwmw/@-@4Y0S $P@+qw-mwBmwp@-`` @P p  @-@P (PڠP ^@$imwqmw0/@-%$0 4& 8' <|S S@@ h^)(0 4* 8+ <0-,0 4. 8/ <0 /(oboxaqwuqw0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l  0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0<44,D$H@)L.cwcwcwcwcwH D H  BH /9 4 #D0 00/@w//@-:*dwp@-@M t8 <d@P!. b L8L <0 @C4.,00 4$. 0$ ( .0 00 .00 0 -VNnZ z C0c0vV-@0 @01 0|-xTBT>c@3?c0PPf t%Ap/2# 0AVDЍ0_ _@ .ظl$00 0_  0 /$Bw(Bw6nP P 0P0(Bw@-4@0_P 0$0_!0!@$Bwp@-d0 _0$0_P P PEIR RSXS[!@p R $Bw$0 0550$0==$0/$BwP0 p02>p0/$BwQ  000!lP  l //$Bw0 030/$BwP0 x0;5x0/$BwP0 x0:6x0/$Bw@-$00@_00n@$Bw(Bwd0  _T0 00_S6S S S 00H/$Bw(Bw@-d@00_ @_00_ 500_S#!0!5@$Bw@-0000_SK@ %@$Bw` 00_S5S S @-S0@ _T@_$Bwp@-P@!*!*!* |! *t *l@h!*X!)H!)8!)p(BwCw&w:wNw1مwMbbwvwwwP-/w/w/w/w/w/w40w<0wD0wL0w/w/wT0wX0wX0w/w8`@-`0 _08@_P@U@>\1@!P@0@DFt@:@@0H0_S7   P0 _0́ 0_ _2_   B"_  _  B_  B"_  _$  B_ _ _R (Y(@Bs҅w$Bw(Bw҅w^w҅w@- 7007c  $ @0 000P)00xphl@p@t@@xP|L @ 8 ,(HQ HQ I $? $hlptx| ` b/2Swwwwc@S0ccTQE@cETacc\@-\< \< <@-0<\ @ 0D\0H@- 3w/@- 08 6 p2w@-HzPEP<J@P 006^ . @P < k <  3P Y'Ѝ/b (P<b !P P A' x @d@ \4'zPP8@P ,P6 ) ? 0  P  ? 4  P   ,, ԗP     ǗP\  志P@ _hwkhwyhwhwhwhw6niwiwhwhwiw#iwCiwiiwiw@-UdrwE-`0QM@00000 0p) P0S S *0SS*000C0 0 P`P U S:0T*St&`ЍP P:0P:00S: S*  Zꈌw5pw,wpwZpwpw@-B@ᒠM-8M\@Xp00 $0 Ve/t6t `} 0 00;P= [  &U 000407U000401P  00 B0# P倩} "?o-R20S`# U a T&U [00404 0W 0 U`00] Pp%0 04RP(T0S` D P[000000 @02/0003?00SS0Ld$40B 00?J D>f0S ,TP%TQ#V 0S S S@00 03?0S3 C3@ 8 3`0D0 0% 0phT#D0S0P3?0 0S 0 00|6"0A0SQ10SS-0 $0P% 8Ѝ|0儠(00`,00 04005 00@0P0 P4 ( `A( &rU V :$5% 3%U 0 $ '%0A???0A04 ZS ,0S(0R D0S "0STT B` VP@  U 0 @6/P $~0 6/P0  6/P0+ `ZU z z`ꈌw"wUwbwmw)w'V8wMw݄ww w[wewvwzwwwwwwJwnwwwԅwww/M-PM@ `PB  $ U-0Q0Q Pu PPAH!ZpP(PP; `000 @P.` e$ЍpQ=pGorpW p aHPZ   K$0 ЍMfXfQ $ p 45$NS|$7SqwΆwwwC_wwwwJwA-`Q@pPB@p#V PA-x@pPwP c$T` 0 @8#4/$cP /ᝃwwqw PE-#P"0`Sp V$@V@LU 0 @P`#0 L 5/ Ѝ0  0S $P@@Twօwqw P0@-@MP X#0(P 0 zЍ0 0 q/~wp@-P`@sPܦp03/w P@-@x#4//w/A-@`pP.0 `6/ TP@0/:w0 R R/00 R J#ȅwA-p0@/SP"M 0S00,B`?` V l+##"ލH"# @#P0 5/PW00彅ww~ws@-@P`ɦP  b#P0 Ѝp@-@S SSSSS S$S@SM-p@P0S R R`JFTPPV 0000X0   r  6awA-@0P0 Q Q ^#Q 0S S^0 Q  Q 0 000ЍR0 0 `,p熁Q TP00 `@ws@- P @`P00  AY"Ѝpمw@-` Pp@T  8AF" ЍP "!Sp؅w@-QMl2"Ѝ@) L +P 0 00 00 0000"ꚹwf3wwM-P@MM6 h408P傤PpU`PPPrt Pd2(0 QP/\( `(,`,,,`  ``XRP  Qꀡ p (0 p0 0!  P0 T!`QV0@00S D $0800SH0<0@0@@S@$@0PS @<0S0<0P 40  P @@0S ƅwƅwqwƅwDžwDžwJDžwQDžw_DžwDžwDžwDžwDžwDžwDžwօwDžwDžwDžwMȅwȅwȅw%ȅw#/w>whwƅwϋw)ȅwEȅwRȅwzȅwȅw@-0@P 0 çЍM-P`p(@P \ AI ЍP @P(< 0 (ЍMowwM-8MPX0S $ p8Ѝ ) @0`a40S S S  ,A  X0 0 00 Pp pD`dQ@PH D byP A|p <00<@ 0 (`,0S񟗈Ww0Zw0ZwdXw0Zw0Zw0ZwXwXw8YwYwZw0Zw0Zw0ZwYwYwYw0ZwZw0Zw$Zw 0`40S S0S P p{1A AT %pPj< J`P PP 500p[3P ` p@P !W>0Sp0S 0S ~$0Sz$0400(080m` @$0S.4Zw[w([wVw[w`WwtWw[w[w[w[w[wZwDWwZw[w[w[wZw@pT P O@W X0 0 00  Ap؅w؅w؅w{w؅w؅wp@-@POO`Pp@O<@`s@-P`ZP@P  X0000 00P@ЍpM-@P 0(M 0!1@0@@a0 I`P\ x p W"0S T@@Z;$I@IT>$P; @[8 0S<Dw@wlw'V8wMw[wewvwRlwmlwlwM-@P` ppP \p0T 0@  01T000T S* PPJ0 (8 Jmwmwmwvw/s@-`0P@0 P R 0-Ѝp@-@@ 缅w1مwp@-`P`@`0 SH0H@p@-`s@-`'PP@L@P P @ .0  00  P `0@ @Ѝpp@-0M @\ `P08 P @  0c@P (c 000ЍpnwA-PM@p`0SkЍp0`Sp8  p<0 lP$  0 0PX $X0Sp0(0 _p 0P(0000S 層P0(00(0  3ownw;ow7@-P @abP p 0~ Ѝ0Bow0@-@0DM00| P 2b @ubPDЍ0p  P  0_cPbBownws@-@Pfb`kbP Ѝp0m P 0 B,bP00AowM-XM pAdp`XЍtPP>Pvd`P0@  `w H0W ,@0,@D, 0R aP  ]P b bPH0200< $/ $aP 0000nwowBownwA-0P8 ]p400 Ѝ~w~w%~wnw.w@-@"E E@E̲wԲwM-p0M@PP U h!@PPP!0Ѝ 0 `P0 0$0 00w P D0 00`P(000 `P#nP  P, ( B0 ` $`G P0D 0$`Jjwiw*jwZjw^jwM-0St P`P vЍ00zP+ p0  UHhDS* @P@ @P 0-?  j bPhD1@u0 101 0 Q :S0!* 00Q P Z 0!01 0R@T V`@7?00-? @ /@0@p mwmwnw#nw|nwnwvwOnwA-$p(`X @%|P5D0SL "0SI0 0S> @P0 3?R[ PHXP A@?P PB @C(tCP  P C0S Ѝ0S@PT P 5_UT 2/0S00T0#St>@XP@03?0kwkwmwlwEkwejw[wjwjwvwjwjwjw kwkwzkw/@-`M@pB0P\0PHoP@lI/P,HPU n000 /m1h0T T@ `  IPP FW  2/ 1PP0S 0S 2?0 W   0PP ЍZ…wy…w…w…w…ww…w0/Rp@-@@`fP0C F@P@pbwwE-BXP`M0@pG00S:S#SQ :JP 0 S SlЍ8 00 GOP000 0?0 0Eww*w@-@ @Iꭁw@-@Pt pB h0RdPPB0<BP, (Bwsww'V5wJw[wbwvwRD0A-Pp`@@P`U8Bws@-@PIP `(0(`Z 0 \Ѝp8Bwpw@-,, L0 L I Ѝ}w$twm۶$twR@-Fօw-M 27B5BЍ-wLwM-@P`TXp> )X\t Pt p  l h@0 $0 NV2T" PTX  P6H@]UP@  P&UЍ h P 4UP H 8 P TP    P @TP   P    @0 l0 U 0TP < ewewwewewFowYewewewa!w7ewtew1wew fw@- 0 @IЍFwp@-M`@PP%V0  -RRPЍp@ @@ `cT00p0S|@P 85P|0S@@@wçwA-`0BSpP@X vHP 0 DRU(0^p0A/Fw乁wp@-@֕PWP# 0RP| U Pd 0SX@0@S3@@p Rp@G"w'VÅw.Åw>ÅwLÅw\ÅwjÅwR@-rD @@w0 dw@-   Ѝdw@-@|8M@P`U pPT0< H0@ <U` @0pSP 8L ws $  ڔP  hҔchlph R  h  dMЍÀwπwـw wꀅwww w!w+w5w;wJw\wwdwDžwowwwwwRA-@PD`B pGP 0 A//GwR p@-@X PS@V p/gw-$M V0 000$Ѝgwp@-0P0@0.0 00 00p$w(w ww0s@-`P00.K@P AP lЍp  ߿@T ,Q ^5wwZwzw000 000/ wwE-@РM00p SP` 0T Px0@  0%P @H0 T    0 Ѝz ww$w(wA-`Me/ V, r `@0V*PD  @PD  04 8< 嬓P 娓P8:Aލ`P7  P20<0@Q 0H DR S0!/p@64OJ@ $FJ6 0 HPV  DD 0 <P &AAp 2/0JH%L%T\@@@  aPT6ú@P ,8w1wzȅwȅwwww%w᥅w;waw0A-M 0|1`pP hAQ@ 0@p0P 4 k@P 0  孾`TЍP00p0 E@ִT pP c@@wBP`&A  @P O@`@$w(w 1w/wh̆w 00PEꈌw8BwLwM->DP=눠@TЍH lI0.0O.@DH`HpHD  R Vp =@刅w1sww†w^w/@- 0 @EЍJw@-^]@-K]@- ^@-]@-]A-`0BSpP@X DP 0 DRU(0^p0A/Jw乁wRA-`Pp@P@`U` T=`4=UT K=ws@-PBU`:@-Q@sQpQ-PR`  mpPE`000P@ T 0pSߑ@P P  =03/@P0@ Ѝp@@8Bwwтw@-R2ՄMP`@.VP dPP @ <<8+P, Ѝ`@PD@Pd  ^@ R[  @ P  pP@N 0/r @ P pj @h P Xb @P P @Z @8ېpP. @wP ! 3oP!3 Y =P PO h<b5/P<F + ' Fp=<8BwawfwẇwՇwqwBow&w/wDžwFwDžwKwDžwRwDžwXw^wgwnwzwwJww8wՅwwRr /@- Ѝ@- Ѝ@-Ԙ Ѝ@- Ѝ@-Ș Ѝ@-җ Ѝ@- Ѝ@-嶘 Ѝp@-RMl Ѝp@00 0QJPP `P 0  Rw}w@-岘 Ѝ@-! Ѝ@-- Ѝ0Q/  RR Rd /P/ R @ RPRP /QP6awM-PX@Pp  p`P $;`qTMx;Vt;r;v``rPT MY W T00pCAᘠ`DXMK X t1D T\> DpDTL0DV  42 `"݅w2݅w/݅w4݅wD݅wՅwօw wF݅wO݅w!wQ݅w@-@ 0@ @nkw,wwM-RHM@Mp P@PZ`pGPW 0-S$ X V8)P X 0 h  W( D  2/P'*V cS qS`0SPpG)Pn X  P  HЍP] `&P``V ` Xm0SL :G @@P.W V)P7  W003?    02/P* ! xP p v N@ t[PWV @PY<  8PP  @@PW; PW@d 0&  R Q 0000 pG<R.00t;P>QF W\ Q@!   0_  0?R 0      0 BR     Q [R0100Z: ]R  R R@!   D0]Q0 0 4:LPb( Z,  :  W 0Pu 0  @ W 0gS0W0W0sS  @P ;n[ Ws[4# T0pnS P0 RS PnRU W 04pP 00sSⲍlb 0D RL PR@0vS3W   `PPV 2/( V0VSw [ DPP@KVP0  PVaS ` sST  <l@C@lS W W@ @ ZPPT9  0PP  z00U00S  Q T h X PX& P6Q HHA @T4a@DXP 0@S<www0wDwDwDwDwwA T tP1 P1O0 3PX\hA X@PA Q 4 (A| X bPPW @P[H@PT0hSTW00gS@xd-P @ T 1敌<1P: 0, 5O2/3 01. 0 1) 01$ ! 01 T01 U 0 1 T0$1 | !t PV 00 H@P   p   0%O PH00pSPrXW0 {@P0000 0aS  V  @pP 0 @P. dS @P  zP@G@tWP@ PPE$ c$h ^P[W %X 0h0000S0@ewwwwwыww,w*wwwЌwӌww ww,w^w=w6awywwօw@҅wwˍwwЍwMwww1مwwϋwMwꍅwwwwww#w0w"~wDw_w@P0SpdQ.c5 0U0C0P!V`1@@Dm0 t@%\t P HR0 F?P?ލDTw,wɅwɅwwp@-@PnP01@oU@ r@ldd@P^5P 4)@Tu0p 0PpmwDTwxwww8BwM-,P`9PrD $@U U@PPPX P 4PpwP 4 PpP  xp@\6\p@X DP 4MwP 4PЍ b`P  yxp@g5`m5%@5 5% 5 # 555 5 *0 05% M4P P`!F4pb B4_ p 0J00 0S+ 64S w0 pGp`0SppC+4G '4pC #40? {{w[ ?s0 Sw 4 pB_ Aqwpq' `x0 040p" DZ`pG=0S1 ` 4@R0  ?R@3/00W3 V30?0p 0P3p P) 0cp0#000p 00N00*x3 00p/xd30S0 <303/SZ@0 <R0100SZ cr r000#20S0C000CSpI~SpD !Sp? pŸ Aq Sp5 `@P ?P@0S@p& $Sp A- S# p  NS p  1S p S p  "0 0 00~0p0000 00Y0000 0 0p0o00#0p0Y0 0p0 0pBZ1`00`Fdp3P 3bpWV d0  bt 0@@owؒw ww8BwOwBwtwzwwޓwPwXwhwdw\wwwwwLw0w4wlwHwGwXwwYʅwwwRM-,`0尰尠@0Pp 0k<@P )p X P !p0 y0PPp@Ѝ蜒wwHTwwR@-$@ 萒wꔅwR@-0 B0 0 8 ЍkwA-`0BS,pPW@ Ptxpr``T``T Hks`^ [X眅wᆳwR>p@-`;PP9@P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pE-R@M4`;@P<0DS qp\ܠ0PV0 Q` HP @ T0S PBP0 @dP@ PЍT T00 `@9wwww8wM-p@P `P;PP+ 10@xU`Ed`\0PW @P< -RW `e 6 R@`ЍUW@UW@v`UW@xl`W X`cUP^@,`XU,$ꘒwww8҅w?҅wW҅wwE҅wQ҅wK҅wR }/R v/A-p0BS,:PP(0 @ X` y0P:U``r U @` UP`*萒wR M-@:`PR\PLp PG P,0 /ᐒwZw7@-P@20p -R(p Ѝ0p@-P @Q(0 Up@ 꽠w̠wĠwM-RXMD@L7P 0`=087< 060,7070$70807090703 7p0<0P0ӅU= 7 6U 9 8U Uw0 070S0 t<[P di XЍp0 <0iS4U`@6@`vTZ;00:0@ I P@ :0$ 0;a P P ş,P   0$ |)@t@rS6@' wSa6@De08PSS*!0 3>0P0   PuP 90R`S`S* @t@08pS!*l4< =  6 X4 T4 8 H4 9 @4 #84 44 t`  @8P P  PuP9 3R*@t@mS16@sc08PS#*0 4@0kP4 0# 0 4oP @PuP90S*@t@ <sP80 S090 S$0y06(00 Sz:@R@`0 (P  b0(0`@$0t R(0S0T0s@b 0$R  Q 3R㰀  0CX 0AS 0;p0W:51`S 0PW% 0q"%X 0"R@Q!T3 t Qp!  `pR >04T3,1(XT2R,0,,0S SXR  D<PuUI꼒wwwwwwwwww5wqwuw㕅wxw*w1مwYwrw˖wwwNw䖅w疅whBw0wBwZwgwyw}wmwwwwwwws@-P`@ (QЍp 0-R  R  00 R RM-P0`M`5p0(050,0408040<0400040404004@`vP00xSP 80@(0,00S ( RwV $0SrV0PT.`Ѝ0rV0pH wV'W Hpp00W= .\P, J @`00< 8@ 0KsP4 0lPpGW 0GSW@P , (ZPlVP0<080P 80@,0(0T, (@P80 0S4p0SZ0 000;/P~P 0S 0 ( 0 ;/Pn 0PU 0S  0iP` 0PUP$p$p0SO80 P0S-pZ0 ,;/0S   ZiP P.0 $0 U |{ x 0SP/Ts P(0rV$0,0080 0<0000040 0 wV t0$ `L0 H0 @0 80 00 (0 0 9ԒwВw̒wȒwĒwwؒwܒwrwwwwԔw۔wߔwp@-@`9T)P?.$0P d 0xQR@!P :p0Aq ^1#!0-PdDppM-p`@ Q4PP 0@DSV l0Rd0S\P00D, 0 M/LTw乁wUwwRp@-@ l`@\PPT@pt3[@P44 @W@P@Uw{wwwew@-pPp@M`zP*?`?`TP0 48 P0   5b 00 4;0A0 Rߍ Q 00C>w @-\M-@0%MlXWdU0TSQLNX Dr00R40TR8",D A@S<(V,Vt3ŸPP4 P(*Q %# 2R!, "2Q" ,|h" x20t"SYfPhP`g`O`,"<+ 42V " h0?R +V + !+ !+ 1Ua` +  `|尠Ugp `Wvpp WX! h R& @+VS@PP4a %ލQX _00r00R40TR8",Q + +@0S S ST%Q ݅w݅w݅w݅w݅w݅wޅwޅw+ޅwwt݅w=ޅwJޅw1مw݅w݅wNޅwޅwօw݅waޅwvޅw?ޅwޅw݅wޅw0wGwޅw݅wޅwwޅw݅wޅw߅wޅw%߅wp@-`PX[@PHL@p"ZPPU0 0VPi[A{wR@-@0oR0UwM-@M , `40P0 0Sl+@@Ѝ0S@p,@<PQ0@P CPn Z 1 0P  ZB = PP @0T*0S *x#l*\#0 D3DD8c8P 0@S @01$0S 3" @0A$0T 2"  ZP S@PW}*z Z0  P _P 8YPo   { (YPXtPT0 1B{0SN0 0 00@B0CA00 0S PG @0@(L %P A  @0!$R$B0Z 0 @Z P0 S$@0$ Q@ $ AP P@0∁$ X!$ HpP@2 Pp@+ Pp@#l*6SXUw★www ww/w1مwFw;w1wywww݅wřw♅wwŅwŅww\ww BA-PRWw\wtwwP1@`PU&  C=pP8!1@i0S4@ @P`pcP@P` 5@ 0Y $pUww"w@wwewYw@-L@6P CJ=0P 0S "7 h)Uw#wR,A-@`p@PP 0 lFXPX@hY =P40T, , 1T/Uw{wwwew̘wR1A-@{pw` s딀@PP 0 p WP\-Y0 ]=P40T, , T/Uwwwwew⚅wp@-Pt0`@P 0SP@pV 2RP@QUw˗w嗅wR)A-@pP |@x`P 0 XX0 <P80T0 0 T/Uw8wwewgw@-L@0SXP00,(FP UwwA-p`P@d /P 0 DS U40Q 0A/Uw乁w@-M P'?CP  0h`@dp,@D 0, 0RЍH T,00H 004,@,@Df3wwօwwR/@-@<0P P,w֛wwE-@2pM `Pn| P Z1UT Ud UPl_|+.PPa1P }  1P t pl0S `\0S PL1P _ 401P V 1P M 0S U! ЍE> P0PS\0 0+000+00PЍTwUww8Bw&wwDžwwDžwpӆw^w0ӆwoԅw|wDžwxwDžwwxԅwӆw~ԅw]ZWT//RM-p@`BP0ಟ0S P0+P0"" 0[@oЍ C R񟗄wwwwww,w`wwww$wXw4OoBWOoBX{ @@@0pp%@P@OP@@ { @v@DOoB n @i@T@ b @]T@@ U @PT@@Ө H @CT = @8T@@0韃@S S S0pg `V Qg MXZT@@DDw P0 P w`w(w0wXwXwXw8w@wHwPwT/P SL/D/@/</8/4/0/ /$/9wօw9w9w9w9w9w9w9w:wPp@-P@ P P p@YWU U OT T Tp@DPEAUPwwwwww64Tx PTp Td`\XTP 9wՠw6w7w7w7w7w6w7w.7w+7wn7w7w{7w37wE7wT7wX7wa7w1S/A-@Q!g 0 #4pP(H`% 0 1S& !|10 S0#!!C/0 !B ! #4XЍPP!'8w8w8w1مw8w9w8wE-@MP`, i>p, ]>>P, > PB,9R>tPC , g>VxX 0 C` W | 0 0`0!00CS ! !!10uPp(H` 0 `he, = PЍ>P p=U _P[PD0 <@ =P =P 00 =Ԡw>w>w9w>w>w>wwՅw@-@ M  k Ѝ@-@ t@PЍD0 @n=P D0 <4/Q/@-M?@?@< 2PݍG9wM-P1@!  100101S p`@1SDЍM4 !($#!"!X$1S $`ܰJ%1 S@*0  +10S S S0+10S.h, ` p7w7w7wօw7w7wK8w1مw7w8w;8wI8w7w7wQ8wv7wt8wwh8w~8w8w@-@bv, <PЍD0 =P =P ;<7@-P v>?P0@ Ѝ0D0,@0,@D, 0R;0S <P D0<;0S .w@-\pP0Uw|wR/p@-\P M@P <30S0Ѝp Po PU $o20S{  P# PU)@lp@P\v H PnUӳP\`P   9PP0SSESF0C Swwww$wwwwwwwwwwf0Cs Rpl@U) X{0h #0dTuP$   p eb@^@Z@V@R0h 0JF 3PЍp@t |0Ѝp@܀w0ww܅wŝwםwܝw㝅ww|w$wewlw6wLw7 wiww+wwwܟwwŞwٞww ww(wUwR[M-RpP`rDӐMiU@ 0 1PP0D00$0 000 =7 P  ЍAP"P { 0?3?   @p0 7 P x00@Y"/Vswswswsw8BwM-`2p@wW&W@ WP `Pc  1R~PtЍP`00SH20[0W0S()Z nrP  gyU%* 0xW ?? vv[ [ GCdE"l: 0P L8"8Bw"w4ww'V8wMww䐅w[wewvw$wwwwUwmwwA-pQ` -R Pl @0d00`FV fSp 0S 0A PPPlYwlbw@-,xPRA-@PD`B p@)P 0 A//TXw00@-PP,M 0 0  0P  (0e@T \@,Ѝ0 <PPP0@P!#@lbw`wgwRA-@P0 -R0aS@DP p`lV@ TP /<@Pwp`6wwM- M0 ` 0 P HX= @ -RF S4Z [ZXpG 1PB X@eUPQ T\ @Dp 㝿0PY 7! ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @T@ X`&0 0 0@PPx0xU`&0PC0 0U`&000(꾉w>wuww剅wwMwlbw̆ww抅w@- L\@-T ^  u@T aT fT @:( \^ u wR-0,M00< 0  00 (0-o,Ѝ/lbwE-`,MVP0-S =u@PX(T!V0000Sp ($0,Ѝ`F0S fS9^pV@"pPE0   BQ PWCh0P0000p0 (0 "0S(0 6bwlYwlbwlbw̆wbwR+0@-@0Mߍ0rt0PP0 l `P0L Q  k0 P 0/ՠwEwLwR X/0/lYw@-P000 00 Q, 0S  =ЍLwM-@ p P@M` BR'-Q. U  W`F@A P `t@0 P0`1`@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍM& @P  I pX0@O0 0`P P@ 0N`PX U  E s lbw̆wSwwww @@/@- @L@@-&HsP &!K&P U&Gp& ʅwʅw?Q/ /@- @!xx0h!h x `x Xx P x Hx @x 8x0! x x$x(x,x0x4x8x<x@xDxHxLxPxT xX x\ x` xd xh xl x px |tx txx l|x0d w,wwwēwPww4ׄww̚w<ĄwdÄwքw!wwwP؄w؄w,لwwPلw4ڄwww w0 0R00/0 P/0/ @0S/wvw3w@- PosAw@-    @-"P]AwM-R020P@T OP Q@Ѝ@0PU zt9@pW0P80+0PP`@pw`w_w6w0P D /   _P R=@o//6awp@-P0@S` d00e/"P0S  P0 00ppM-0@S R<q圁+000QS)p0t!000 ` `aP@1```41V# Q R R`d00P P 000S, P M`0 S P`p` V* 0L0@8 R @0 (0 000轰wȸwww wޒwp@-0@SP R0Sp000`f! 0    0 pp@-@P0 P0  000p@A-0`S@P0S 0S 0SU0R hrLPG  ;  PU UPP  0 0y @oPP PPP0 000 P0  0S 0S2^ pX0SEP Pp0pq0 P \R00 R P 0G pG0 0 00S00 0SYD\R0  RpYwM-@TP0 `R \ XVT PUL0P00F@ P Rp@-@Pp@J PP \CP pdw0/p@-@Pp0$S`0P  0P@?S D0 <pPU Ppwߔww⽅wM-x!00 V=pPP 0S@0(0@T x`P? =P 7P' @X!0S@X0S00@ @ 0Z`@P 0S @6awwGwM-@P` pPX B@V ` PTЍU G , @E`p  :P+ oPP82PP40S { xP X 0 J A C PX:  U!0P0000-S =S0 +S00IP [X:   0pS <``@-)P&`@`lƅwA-PP@M" @T p P㠀@ 0S `t0@0 0`@Ѝ0@0 0P@$ww1مwM-0P8MS `p0,0 0(00$0 00: R Q R Q 0R RS6 87 p8Ѝ00CS !>0P 00 S000000@X``V `@`V` 0SPPU0D0D $0ST TR0S 0S"000S 0M 000(0t, 0 0C00P0= 0 00 0( ,000 0`0V0k.,,0( 0 ` 0 @`0 D/o0"S RM?o2TQIT00S|0$0 T T[0SH @<a`0S0 0S  S`  0PC0 00,0  0H( 0D 0 0,00 000` 0  00S #S 0  `V p T0 S000 00 00Sp*0 pP0XZXD `=P0v00S t`0P0W0"0 Rp T?o20 T   W` 0S @M01S 00C0Hp0140>0P040 RV p P0 0S0S0000H pZL0 *d1pw0P!pCpp0 o404p 0`S00 0S  40p0S 0Z 000;P  p;0<0P A"Sr0$0 @ $ `Qw w wwwՅwwwM-p8M@ I `P4p$PPW $(P0P,PO,(mP$60 ,0.00-+(%0S 00 03/pP? 50So U 03/[ ! KQ\R[XDPZ U+ X0S(0S[  0KS R  [ X X9R7(0S4P,0S  w` v `( T4`R` D:u  ,4Rg00ScV8Ѝ'U#!UU 3P ,0S0S000 000"PEUh5wT3w3w2w5w 5w\U |U ;UX 00#03/ PpN  03/z   03/ u03/Rp00  00003/p0000_P0S 03/ ?P {P $ G 000$  03/ 000 03/ 03/}Pp}Pc00 03/'PpqS0SQ m/o0"0 -&ZB 03/g#|Z8 03/]00 03/Pp 0S( D x0 ,0S 0& v H0 0003مw/مwww7مw<مwAمw"wFمw$wwoمw6aw@-000(0000 000@Ѝ"wwp@-080/ 0 @8  B8 8 . 8 8 H /H0 6C:C0H0//@-0  80 "35L0P 00   l R @-lhh0 2/l h /@-Fcw@-@: =Jƅwхw(@-   @jAƅw0//////////////Q @-H L B H H L u/h R h  2/  p pH  B H H pl /H00C0H0H0P0////M- @ HPP<!@<0\ \ 3 # 81S41 B2s2 Bs00BQ0CL0C?B!c 0 B `b~0vp07 P T!00U U3 #81S41L2s2Lsࠁ 0᠑0L^0C0C?L1c  C `c1t' p17 Q  0RP 0o$ e օwgfffwN|w4 r4//"p@-0 0P堾P4P@ @44 8 p@H00C0H0 00 p@-DP `0Sp@@L@3/0P  B/a@w.hw///0<00/ @-@- ƅw@-@6P j0@h,^i iiƅw8Bwȅww@-xCƅw@- /$ ЍA~w`~w1مwT X T/@-8 @ @| @-4404 0C0L  s8JwXQw w@-骹////////@-0DP80`0S @@L@3/0P   BYw.hw0@-h uP @賾ww0@-P @\*  0S*0P*SP: S*S0@ 2/ <Ͽ03?0M-@p`P  0\@0U7?>3?001qpP373?p0 @M-@ pP0 `0S* ᖵ@ `X P6o4O`@`@4OA-PR`p@ sT0 P003?0봅wM-HMPp`0@P(0$ $ 0BS(0S  HЍ!8ℵh0P0 $08 0S:000, ,0HS00S 0 (00 40$`P 4@T08 0@4OZ*!80 08gP 0@$(0@pp0  1Gq0[4p 08Qp@0 pG`! 8^wawM- P`p$@PZ 0  M 0 P@A-`pPp P@5 0  9`ww7@-P%@P&\,Tg@P@ Ѝ0/0 @P lwzwwwM-Q M@ Ѝp`x!P@P X 0  SR0F 0P @GP7 0pBpP6o` 07P@hH 0p'pP6o`@wܳw쳅ww?ww gqws@-P@P A@P`P 0p `Pv\|@ЍpH400 @P@bFwwqwVw{www7@-@PP M 0 Ѝ0@O Ѝ0wE-SpLM0 00B@LЍP`-@P. 3 @P000 P0H  @\  ! \ 0 D 0t@P( @ _wMwwwwwZjw@- 0 ЍM-(M@=P\`tql6"PU<QN0  P P- P/t*fP!  P-  R& [0 0 0@00 0t 8`P p P 4q X(Ѝw(w\wAw;w1w@-`PM% PE@pT 0  SV A<Ͽ2/ @V0@@N@@D4?P0Ѝ@0 @0RP0Jwp@-@T;pP)`P*h0 v1Q H'03?S ,1$00pw)wGw_w1مwp@-PP<`@ 4 @pP @T(w0̅w 0000 /(w$w@-i@P g@@p@-@P ,0S 00S PP 8p,0 @00 @ R@p˅w(w$wP 0 0 00Q0/$wM-|`|@TpPd4pX   0S 0P U@ (wj˅we˅w1مwr˅w@-@yP 0 $wm̅wp@-@P@P YPpP p$w0/$wA-`ppPU`^@40S 0S 4P@@ TP(w|˅w 0P/$wA-P`@P0 ,p7/Ps@-@P`P `0 0`6/Ѝpp@-PPPL`@T @<0Qp0p@ @(wC̅wQ̅w1مw$wW̅wA-`P 0pP Ѝ?@T  0P0!50Q20 07@- 0@PP 0   0P d` 0P <0 0 d Ѝ0 ̅w̅w̅w̅w7@- 0@PfP0   0[P` 0SP @<0 0 , Ѝ0 ˅w˅w˅w ̅w/0!!" -1,*+10 1|/1 R/|0S|/Z0@-MPU: G? ) )0 !) @ZP 9SPU9S Ѝ0@-h00Čd00$r  Ѝ@-MGP?P`0 pPP@<ߍ $@  ⳰@\ww@- @R010h01 S|00# S" S0 0R00@Sh|  P@S0h000Q_w>wE-@`pPXM0h d0080s0 00 QPPUЍ@-r` qP  p@P0 00P0 00P0S0S0d R0 R  S00SP Ѝ6awSp@-ɀ@FYPPp9PESU)0  Pp/7|/@-w0@h`K?M000 0 ```PP o t07t0l07l0Ѝp@- `MG@?@q 0`PPP  Ѝp :w.:w@-@00q P40Ѝp@-0PGAMTʄ `V &1S00hqČ}?00r 00 0 qЍp=wQRA-P  pS00S M0(?@R`?@ 0 P"0S08090 P0pG@ ݍ0@S?00T00 QS1:   M- M@b`P\pP?@?PP 0 lpP !B? hL` ЍP p`Qf Rpa a `pE?0 SQ  R7 0Rc R' Q4 Rd0 S! aV 3 P1Ui`aF 0 1Gˮ0F+%10&10pv 0F#&! &! A 8S(-v * 0 %Z%J!  0嗮0 K?0 $ "$ Q S 0Z  n w D`0VP0hd000 000! N`P )`=l`p`(p HP   Q 0 Q 0 Q 0 ;w wP>w/A-@p`,Y#0S00$9$vP $000#P@o9w@-d0h00Čqr 00 #0 Ѝd0@-M\*)@h00Čr 0 0Ѝ@-d0h00Čqr 00 #0 tЍ/@-$vPp@-0hMČd0 0@0 q 0 0PW`P, P 1S 0 $ 0< <0#40ЍpM-M??`p P@PI@ j@>TPp㿀? i@P,  P@pWȰ@|c {< S   S   S  , 0V@P gt܍:wM-P.M, "@P `?` P9Pp W p 0P ج 040#40 ◬  ⓬0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs S45n 0h d000 00` PU&00?~, `P0,980pY ` pp 9Vq3_P @Wp1dWd` 9Vb`Ts 9VbH0S00,3@T 0 0C#0 0S 0Ps:_0?` PU0Pe:0 0 0[`Sh:@01S27p`P 8`1SV0hv`d000 000 0`P.ލ` C`}FPE PP0  p0` 0Რ0 000< 0P:   00 0@ 0{  7  1S .p  %00SP ^0  h   q   R $V00a:wtZw4wq:w:w@-N!@9 R  /@-@M0h}?00 00  0 !0\P09h 0h0b8 0h0W ЍIp@-(MP@ 410hP}?0 0P 00 0!0PX 0h0<`* 0h0!(Ѝp`M- 0@Ph!!0R30MD 0G@A@0`04 0G@ApWM   2 0 0 W00}?0,00 0$ `$ 9S< 1 00 9,0Z`09 00S0 0h}?00 000 !0`PI 0h0I0Ѝ,0Z [0K ,0Z 0pW6w0s@-00@0%0 0$0` o_0S  PU0S dP 0S 0SS P`Ѝp1S S >wM-@Pp MG`?`; 0Sip 1#4L01M01SPB [ 09,03/ݍ 0S/ 00020000@00僠 0S[09 B0S$R W "M  L @ 0SSS S X M D L @ 6$t  pP?w>wp@-\@P `囩00020000@00 00003/`p@wM-pRMM `@L yRR0A `S(< UzP& 0X80%40000  `[ 0* 00 00 0 0" 0/ 0 lP2/P    00S0 pGXR_RЍ Z`@wM-pRMM `@S DR8R0A `S(< UzP& 0X80%40000  ` 0( 00 00 0 0" 0/ 0 lP2/P    @00S0 pGQRЍ Z`@w@-}? h00Č 00 0ЍM-<"0@ᣁ 0RMX'0 pwh0tp`1?`000003 00 0 PШ}?0 00q0 PCX0O?I `0gd0h 00`aS ` X}/  P 9 X  Pp} 00 0 op' 9 wPpP P0R0 0CS 0S Q03ލ6wP ?0W00 S ا  1# aP5  P P4 0Ph00S!S 80|(0S00S0h(000 L8 (Ѝ<@00 0X P :U\www4wwЉwOP[P !=10@SKwwww䉁w䉁www䉁w䉁w䉁w䉁w䉁w䉁w䉁w䉁www4wXw䉁w w䉁w$w!0[S0(00CP0P ~P"010CS $wwtw www$w w"02S #00@S$ͅ <@00 PU*PY~P %"(00CP0@S $wXwwtw w4wDww䍁wDwwDwDwwDwwDwDwDwDw\wDwDw\wDwDww0SQ 0APK00  0> 0  75UPEK0P 0PE(PPUP0U*PPPU PEPQ*PEU 0  0 0   [*PyPUu*$A00CU0:iPQ 0E0c*4(PEPPUQT #00CS0IP3 R BqQ3 Q2`#0SLS 800S000Q #QU [Q"yPP  RK"[}00CS0P U:00X0 P P 000C 00<0@0 P0 ;2P %pp W WꐎwwwwwwwwwwxwwwxwW8 WD W- 1 RO WD00\ 0 PPP 0<0 000 0p00000E!00 00C 0 0S0P00 k0PS0 S0 ]P 00 00p0@www|ZwwXwDw3twօwrwww3wrw  u괿wM-M@Pp0$ PUPUiPDh\QS`@'V \K`PE/\V \ [@N \`S S# \Q'V00S0'`$VQ`PE( 0 {V(V000 UP `@PE@ p}V)V  0HCQ S0<0CTP$ @0pp0PE0S U00܍-@-M? "0@/Cߍ@Ѝ/040/†wp@-@ P<03/P p@@0/†wP/0 B0Y/ R/0 C080S//†w0Y/ R/0/0Y/ R/0 000/B†w(0S @-3//p@-PQ P@Pph0TQ Tpx P x Hx @x08  px ,x0$  pp†wēwPww4ׄw,wwP0<0//†wP/0 BP/mP00S /0S @-P oP0ww 0 /w0/w 0 /w@-@P0p@-@P0PP p@0pA-p@P`P xP dP 0 U 0 ؅w؅w؅w w 0 0/@-@Qt p Q `\Q @H@0$@†wsw{wwwwwȅwp@- x x xx p x hx0`! :S`T7S@L4SP9P 8f,`b@^TP&U3V 000pK`G@CVP=`T Up5PP-U@ P Lw ؅w`wtwww؅w؅wܝwp@-P`P@P `000S$00S:Pppwww ʟwwwp@-`0PPN@@DN@JD T00Pdp 0@SH00@8p0$ PEPP00C0pZwZww!PQ/p@-@ Ÿ 0@P`U@T 0C   010^p81p@T 0C Q  Q DP00  p Q p R*    A 1 0p R"182:Q[ TQ"nUQwTQ~"|^ @ A! 0^ R: ZwZwwZw  @%  /P 0SM-U`~V*  BP1 R00 0 0 0   8`4?0 S&380S[0 TS&6n0US7w0T%S~0&9|0 !BP   B\0C0P3 N\00 0  0\ 0 00\000 ^*!B L  C\ :00. Ap Pp000 0BP HR434#@0@sJ@N@@Upp ["Z000q G2p00cp@0CN@N@@5p "@00Zp0z X 0  0 H000X0  iof ^$.#18 2:R[ TR.&n UR'w TER~ .)| @AqW B!Œ p@ i@W   R p0  fLX00 0 00  0 "X 000 0 0 I0CPK O0  ;0000h0@@@l d00S0X S00   BR0000wwZwZwwZwwwwA-0`p@r?o2?P& P # @ pGo Rrp#W  B$RR R00 $R0 0 0 00000EZwM-@QpTM50  0SP` VD3 ^pQ+ A 0p0 00 [ 0 0 0 HQ0 00000bp vPRPJk ^ 7 Rdp   F$R'R R @ $R   @  @ H  00 00u1[- 0 0  0 0  F$RR0R00 0@ 0$R0 000@00 0@000000ḜwU [vpP7 0 G00Sf  F$R!R0 0R00 00 0$R0 0  0000 0   ~<000FwZwA-pQ+0 AxP`A+P `!`3X!PP@PQ @FPP FT*x@Q@E pF0fpppG0GS0p@G00C  0   00@@W@000CS000000H@ ) /0 00C 0a0@ Q*@-J   /cw00@-RMP0@PEPT0P@ 0R @03/P Ѝ0  Q 0@U 2/P twtwtw A-p`P @tP p `P0@@0 /M- $pX"@X@@T5`18 PϾ 00 BXwA-M 0p@!QP  R 1`U 03 UЍC!! R` 1C1U 3!`0/<<<<P @P///T†wA-`P8pH@@T @DFPHPD †wp@-PP PT@P@pP @-@P 00H LTL H0H0L  †w0H H L / †w-TMxP  ᥚL00<0 0040400080,0@0(0<0;TЍܝw8w0w$w,w(w qp@-` P|@PP p@ ᪚00PpRA-`p@PPMP@0PpV/6w@-@ |0P0iP譁wvrw@-PTP?0P0 @ 04/ rw6wrw@-~M-pP`@.PPPEP0`J*ZX rPU `@` 00C C1$tw}w$twm۶@-@ 8f0cP eb } sw*sw5swM-MSP@S100 M`A 0SS""VpP0 ( $0 P( $0 0pZW P`U 00 `K!0`FqPZ 0  P  eP `0Z ``bwbw@-  \ P<00<0sM ЍP00<]ĆwօwM-0#,p(W0`0\0R0P@0pG 00R0S [$ P ^@@Ѝ   R @TP 010 (`ЍM/.P@@PpG !@P 0ER  P (PW0 !@@/twM-M00P000$ 0@pP Ѝc`0P00|Sl3,  R R0 R `0 R R R  V  01V C 00 $R0S: X8 0020p w$fwfwfw gwfwfw̪&wHgw'gwM-p`]PP@ 0S@ %@ LP @0S  03/P @0M-PQp! #PP ዻ 0K ` uP @PЍ @1(0 0 0@P "مwمw@-0bS\  CSP  L SD  87S 0a0( Ѝ tSw#ۅw)ۅwۅw,ۅwۅwA-p@P0<0S `50S  SPC0 0A/%M-p@P0<0S `0S  SPC0 0M/%M-p@Pc0<0S `0S  SPC0 0M/%@-@MMPA@A-MP`>P&@p圀0 P@ 0Rⷺ 0 P x 0@ FP @TЍ|مwمwM-`@PP* 0<0S% MP ppp0 00P0 ;/T`0 00@Ѝ%@A-@P`pP 0<0S 0 A/%1US)p@-1PS&0s/ R R0PS @S@QPp D6ڹPp (RҹP dp/p3w3wH-0?0?0@0M?P?P0 @P K`Pd0S1Sd`h0M-p`ᾡM@0 V?0?0@0M?0?0奿K $0  P $0  啿!UPR Q!  P2No\^) Q  \^% <0 0800 080 C,0 0C?o20R0L0 0P:0u0Q \  \^ `PUP \UPP0 Q80 RPP0(0`P0@0,@D, 0R 40PSPP ,@JwJw@-@`P cp P p0S U@ PT Ѝ@- K@P 0S@ qЍ@-P@Pp 8p P` 0S ួ@ Ѝgw7@- P"@P厽 Ѝ0gw7@-@P\僽 pp<z@ Ѝ0P@P{ 0S@gwgw0<0S 0S /%//xp@-@Pp@ p@-@Pp@A-`p0PP0@ Ѝ0S0S@ ,@0,@D, 0RP@-@P@@- P Ѝ^ Ѝ@-@ PЍ@ЍE-@p`H0<0S% 0P0 0>P0 :/V@0 00g ЍA-@pP`0<0S 0 A/%A-@P`0 `D0 B00D0 $00(0 0S 3/P 0S 3/P 4ٹ3/P P P P{w|{w@-PMp@`P W @0 000`0 Ѝ@-Ѝ@-0Ѝ@-@P@  喹`wyw@-@P$@  勹%`wyw@-@P(@  倹f_wywp@-@PP D0 P`,0S P@,P  P.PPD0  Pp 004PU P 00DeP $0S 4PU 00PP8vPP4D0 ogD0 fbD0 ]W_PP0S @0< 0 4P>,0QPP $Ѝ=P}㘡DPEPPp0Pl00Q0 PPh0 P00 10S10 00 0P0Sh10sXX70 000 P%)00000 0 R0 0 1 0P0SpW/ @00S?00 6Q(B PnpPpUoP00SPdP00mVХ^Pnͅwͅwͅw@-@002,0P $廥z1P00"҅wM-@bM@ P Pbߍ诠0SG P0PSG030800 4<0zPP @T=v036 8<00480ZPP0 S@0#86ı 03080648<0HPP@0DPHL QD0HPLP /SAQ(@EwHEwPEwXEwPP 00PSW`PP00SLPd~1000S?00640 ( 01p0l00USR+ UR8x 8?8.8 P0`N%n&3.5"1 0 0 **++,,<Qtt0Px0\ 40s  # 84<08 036 848<0PPZ0|i01PPR PPK R7056Pp (8TX0PP93000` 00?` XPT`$PP'03/< 0S71 S7 700(0 2(07@R7(,0g>7V5値W0 0GEC|A?1.?\Qo`X?`X 060p0@0000$ lt$`,0(03PP03? (02/0(0 03`0 Q0 U U U70B/00&(!B 1 PJoB?0㪢አB 1PURE_oPRP%0Q0S1p l0q7086 8⌠0P 08@0x00Q_Pt0p00?Pl ⌠lP_P0E< 2/S Q6 S$P$1q0 P%  ?70U  oࡹUXP110S<t0x000 0t t4 l4000TP1QR 3 #1200 10tn10605W mX0_  s  S$ S( T #w@υwpCw0CwЅwTP  Ѝ7@-CP P0@,@D0, 0R Ѝ0s0P Q0S ,@,@DE-PC'@`pP垠 ЍYTᕠ U  @T  X0RT@@0  8偠T (|@УwՅw1مwws݅wx݅w݅w0<0S' @-M0 0@0 H0p0t C0pPwPX`pP[P 04008 000 0P1Ѝ%/=ͅw9ͅwAͅws@-P`@Y_pk P0 Ѝp@-r 00M-(Mpi`P%@PP(ЍC P|PG`C` 0G0 e000C PU*`GQ0S V`!0 Sx0B Q# $0!0  0 P0 t|0 0 P&000  0PPP P̅w'ͅwM-8M`pP@P C Px/P0P`XP1 `V0  原U/ p8ЍU) U  !x Q$00   P0M P doU 010$ 0>P0Px0X*MͅwͅwyͅwM-0pS0000P0 1W`0 EP[P. @ 9P T % 0.,, @D , , 0BD<0@,@*d@$0%DP$0,0 0,0(`Ѝ苰@Pp@-@2P` < (0R 1R@ 40S,00 0,0(00(080S(00 S(00(0pp@-P @:0 40Sd0PSO p@dj $0@TTpp@-MP@h`Lpp`> 0P!,000P'00!H!0!L0 !PXL P040 LP`8 d0` p0`0<0 P `Ѝ \ `P U0 L LLa <0P0<0ww'wCwхwlw~wwͅwЅwЅww@w@-@z @A-`@0<0Mp0X0$PT%U\U V BGP$04#S<Um` `0<04dP$0/EP$0M-@`PCq0p@00$0$0$00U^ 0 80S $0pЍp0S pP "1z DR0#D 0D00 0??n l| 0800<0  Q(103 0#R$10C2r"0Cr!0CR0C 0C?S0, (8,00 0C0s00S0R 6"00 76888 8 R,5?$ 00 00C0s0S 00 00 Ep,04,0,0U,03,0_0 SiR0#D (8Ol jPmpU00 0p000Wd㋘XEP $0 00 0  , $0 !,$ #,$4U 0 00C0s0S  000 | 0??k,0w>wwp/M-Pn/@]pP0@0HHsP U0  (`"Wy `,04,0,04_,  , H0<0h0<0S000140@0    (  & 0x!00 D 000\1 0 T1R 0?00`0@0(0(S 0L 00H 88400`P Q @@,04,0唗P,0",0 0,0 (400040 0(0,088,0 }dPdmm`U0 0 0Dd~`kPm`v괻wЅwЅw;w ջww_ 0 _ 0  R80 R00 ,R(00 R0_ 0/d$$Q @-/p@-@P00P  Up@p@-x 9+7  2(@8_@0P0_ _50pP p wp@-(@_%9 $7028_@0P0_ _50@_ppP؛pw@-@4@p@-P.@ _0_0_0 _0$048<3?_0 08<";0_ 0pp@-@P@ o0  0 0 0 0 0 pp@-0@0_0__ 000_㺖PU0$0_0_ $00 00ps@-P`@LP # 0  0 0t40P `L.P@LD0@0 <L#PD(90D0Ѝpcwnw~ww¶w׶w@-@($_$:0P u A-P`z5 ER(??p@?iuP_0 1P_ 01p 010s0_:#;_ !0P@pi<0__$0 30S0?o20  _c`V i 010s0_ зw@-@qP@@徚< <0 8340,: B04_D0صw;U?KLk_kM-`@pP@ k*0P0@ Pki0,0 k `i)00 0嵀P U *0~?  Oi"0S $0(_|"0 _ 0D!_P0 Q_0$QDnPdP @nPeP  ,0`00 0  _  1   /  00p z Pu0  d   0`kk0 V d  ? 0@ X 0@0P40?  d00@-@[P@@-P 0@T 00 84/Ѝ@- @.0P;<@ s0p@-40@S 0<0@00S = dS"<< p@R< s0(`,0 `(`Pp> 0@00< ; ;@0 0P+  s0PPp Pp  Pp, <0 < <P s0PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0hpp@-L@@ p9 P;P  za@  `V,p l@Pʐۅws@-@P` 0SS   08 u P$`ЍpVۅwE-`QPLpP  $@P  DZ 00 1@P 00  Ѝ3ۅwZZp@-P`@q0 v0 9p@ s0 QRp@-,PU 0p@/P@0 ^ p@ p QRA-`0pW A/P2`@0 0S0 A0 p@-@PP    0d0 0000p@-0,($ `w`w8awx`w8`w_wL00L0/0 @ <   0000//A-PpU 0MLPU$  `P 0 P ` 噔Ѝ VdV 9VV'00V00S 冔@P   dX@` XPD 000 0̅wDօw︅wwLw_wXw@-%xawE-PL`PMЍ@p嬀`TV  0SP pr P 0DP  P\@ȅwۅwۅw <D Q)D  40S //@-@L,MP PhH0P[ 0 R7 8!ΓL e`P- P0q#100U,Ѝ S14P@00P T0  ͓P   TR0<0403/T P0<080S%T P 3/ۅw ܅w܅wЅwЅwM- M`@PLp [ 0{ R  K8sQC4 C2 C1  B0 h"0`|P T0"pp ЍZ  ᥩQ T0 XD"D) `P p 0C1h"00ᅀpP T0 !A0=0p Rv 00  qpT0 (!(4 ^0 (  "Q"R _RAr _  R        _\ Q_ _ ÅwЅwЅwąw*ąwWąwwąwA-P@`M!UL T0 !崒0`p` `Ѝ p P P0 h h P 0h0p 0``P T0 4 4@h8 0╀p PЅwЅwÅwÅwÅwÅwZjw@-@-@@p@-P@PX < `L> < PL9< @L4< 0L/< L*L$L% L L&LHPP020ĵ  24 P 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0ppwwwww*w>wPwew~www@-@:PLP(L)P( Ѝ(`P\d0P D/o"S R fp(؋U(婋Pw@-@p0P 0S @/%@-@c0P 0S @/%A-PU@P* 0S' Up$0S @ `V `03/@P 0S VPPU P 0AY뻌%@0 \@-@PL`PLp pPp0 p``  PL9  @L4P  ЍL*Cw>wVwnwgw0S /A-0`SR%@ Pp@P  (#V P ]@~wp@-P@E p@@-@=@@-M0P 0S@-B0P  0Sp@-@ P30P  p@ rp)w@-@Pp@-P`8@0U00C00 P pp@-P@ p@@-@@wp@-`@0S%P (0S @ ,0SP $@@T@JPP  嚐p~wp@-P0S @ 0R( 0S(,p%ppp@-MP@P% 0` `00xLyPP a0XL PV 0V(0 0 00,00$0 Ѝp聻www R@-D/ rw@-@8@P,,6 808 0<0_w6܅wawp@-P8`@8@D80S@pP 8@awRA-Ѝ|pPPdbd @\R\r8@D80S0! 0 8@8@DW @PY ɉ`PQq0S P ؾ̏ɏ`ᧉPW  PP H弾 <屏0吉`PW p s|PW (0S叏z mP( 0003/ bP}xz$0S 3/(00Sr 3/o;waw w3ww*݅w/w9wVw1مwLwew`w|w1wwwwww@-@0P<<S 0  H   @b`w_܅w҅w@-@0P<<: 0 @    @ s`w_܅w҅w@-0P`@ 0P#3 R R R @ T8\Tt0 0 @  0q0SOЍp}`w|܅w@-0`P@0 0P,00 0>PP" R R R0 0 4P8800   0|_  0R?s0PЍp_w|܅wD00/D00/D0$0/D0(0/D00/D0 0/0@-,P婊0P/Gwʆw/ 0 , /ʆwp@-|0|P@x`PMTPЍpP  ^200@0 0080D@4000(P@0(0,`<04,@ʆwHwTw`wpwwwp@-P40@Tp>P,@0@pʆwʆw@-@-0<0@0/@-@0/Rp@-3  pPዎ @P 0 PK P   P  P P Rhp PP O@P K PP Cօwؒwօw@-P@0/@-K@ 0/@-@E$0@/@-@>(0@/p@-@7P@DPp$03/0K/_ _p/S0K_ /S P@-@ _0OK/_@ S@-d R`  _:P@o?_0[?兣_W_'0{?w?_0_w?_0?S@-_ d0/_{/{/_ _'w/_w/_)s/_+ c/_@_O_KO=Saw/aw_ 0 _ _ Sp@-@`0P0"! #! !R0S/ 0S, 0S) @`P$ KPPp+! R* ^ +! R*!  .! 0 Q p p/@-0S@P0ǠČh0`}?0 000 㠭@P 0Ѝp 0S@S @0 @T9w 0Q0 0 S/00/0P/  0@//@-@p`eMMx0OP?P8#0 0] {]0h0 30 000SeލЍp@-@P p@@-p` P @P  Ѝ| p @T A]0#8 S0SP@DP000@-@@~@-hMČ$B @ 0 @TЍ-MG0?00000 Ѝ@-hMČB$ @ @ @0TЍ0@- 0 0@P uЍIA-@M@@Pp0 0G`?`0`x0w @@0 ЍA-@MG`?`0@@Pp0 0`0w x0@@0 ЍM-MPpH`0@0+vPPPP0 X50G?0 0SPۥ  J/o 0""g PHu P p PZ i P D 0 J PЍMuUP10?0 0 Pڥ9 q1 l G  < a 06# P0  P00? p0 P z[ZpЍ@ @P [0@-MG@?@P [000@ Ѝ0p@-PO@}0p@%p@-@@`@m@@P0 pP`P` TP /2@P +32@T0 ЍT ܊Sdw~dwwdw/@-peMMO@?@P`|[0h0 ?0 0TeލЍp@-@P p@ @-`P0h0 ?0 00;4@P H嗊PЍp  Q(厊@Q @A0 S 1˅wH˅w@-@MW`?`pP+[0h ?000@0 P`p UЍp@-P@ 0p@-ph0@Č?MW`?`BP0 0 @U ZЍ@-@ <7@-,,  0PP @ 0P0@@T V Ѝ0m7@-P  0@P  Ѝ0@-`r@YP% 0p% 8P  P*P,Q> 0PPЉ Ѝ >DP 0 gP0 0 03 0 , 0 PP  UZ+ Ѝ@5ʅwʅw˅w7@-dP@ @a0P0 20P0ݡP DŽPUm Ѝ0/5@-ReM M"WP?P:`@p  0Z Z Z0h0 30 000eލ Ѝp@-@P p@@-p` PV@P  Ѝ  p G@T Y0  S8@DS0 C %@-@x-MW0?0 h0Č#0  q 0 @0㞨PЍp@-0`@d0P4 8,BPp AP0(0pp@-@QP`5 p@30@-MhP 00 00ČW@q?@0 0@[P00Ѝ07@-P㹃@E 0 ᯃP:m Ѝ0s@-@`PP mЍp#E%~PF @-@ ,@A-P`@pP F`#%E ZAE-@P@k` q0 0S'(㖃^P: X  4u`0V00 0 0 0 0 0 Ѝ`\0!1p0 Q0S ([# P:@BA-`@nP:0` (00P +P8pp dXmЍdX  P P0p dWdW (0SLֶb P080S!= <!   0P 8P*lP lP P ," P P P P$$"sP GmP", fP$ P,ZPy Ps ( LPk$0 :$09=  P0    <  hgPD h) P<$  $  $  $ `p wVP P2`P L32`V0V  =w0Sdw~dwwdwp@-P/@LP @p0 00 $Lp0 00p6w6wA-P@,@D,0SD0,@p4<`<`F<0S D0<0<`C00@-  P@TL P@TD P@T< P@T4: @T.  @T(@ @T",^P   \  \   \  0@o0000 0<0(0S /%/0?o 20/ʆw@-0 <@T% @0 4/ЍM-0y `< 0@ 0n[% 0P0 0@;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-t@Pp0P0,PE, 0R<0| 00 Ѝ0P0T0S` `P 0P0V0S@@,P0w@-@T [tP@M-`'MM@?@P%-0 V0 ,i0p00$Y9vP  P/G? $ 0<0$P'09LH0P000E0! 01ܱ0C0[M0!"00. P   0P] 'ݍЍ$ D |P s0@0000 P 0 0 0Z0C0 ~U QP P$ R HP R  0CP0P 0 GP0$0.$0 0hwwhw;w;wZjw7@-@MPL܄ 06P0Q Ѝ0@̈́ Ѝ0@ɄN;w:wn;w;w A-1t @P'p0P`dAd,`F ,0S@ ,@D,0S+0S4v@PU嗄0@@DЍᎄkp厳P,`,`FP0P0 |D0 0S,@@0,@D, 0R D0 0S z,@ʆw:w0w;w:w:wp@-P@`Q,Y0 00p@踥%-T,Yps@-P@`xi_pk P0 hЍp@-o(00Q / h0_00_h0/00_0S/00/P LA-`pP@_Ct @T PU@--!R @00_  0_00@P꠆݃!w@-@9T00-1@A- PpU0 0E2`@@R0 '#al w''l  0?`0 0P?RP諪0@-0000CS @ d0 ;((50 00Ѝp@-@?P`?TR0*. BV @ 0 Pp@ VF0S`Aap耫w@-0_0_ 0 0IPPm蠆}w@-0_0_)0(05P<mz~蠆wp@-0`_0P_p@00_ 0 0P` p@p!0 1 _ _00 V1P_*0P}=Pp꠆hw@-N@[M-`PP!$10C$1}}0@@ p0W 000Q$1S @}Z *,ς@岳尳᮳Ncw0, M-(M, P p iPPP宂@(Ѝ U``(?S`V@P `0 @ 0ԶPU 0 `0C03@0ƶPE  R R#0"01l0310 0X<00$80H<00S.H0??8Q0??2Q0.Q$1SrP 0 000!QQP$10$1#!`@V 0` #  $ 0آ$ P@o$  0 AQ  0h0#$ 0  0` 0P 00# 0uP_wcw@ A-@P0p  0`P@ $O|T3?@P@|T*0峁m@W@, P@Ѝ\wM-BM0, 0? (1PS0S00(A 0 0S0Sᑗ3@0@P oS 0@ 0`  Q Q0 000001l`$00ᣧ70@0000p(00pW7pSp5 8R$ 0 ,! 0=1R,9  R B/o "601p0 (1pSp606cp0(a0XQ (1?o27<000<40 0S *b/ 8 R 4<D 2@0yP@0D  ݱv3 (pp0hP`@@@080,8 忖8 @0Jp'Z`0@(1S  003P# #   `00@00倠 O0 ,0O000O00_?0_ 000_ ; {0刃#?ScFc O ,OOp00 {P:(0` @0_O00_@0_ 0 7oPv00_ w _ 0 r 0_ 0)1WPd c00_  _ 0 PX 0 R00S 0??3O0S ?FPA"0@S0 S& S S @"0 0PS S0$ l   $l Vh90C0 0 PBߍ0ꓪwɪwww檅w$w!Ϡ\ 0L/M-@M, 0p8<`$?S' T4SLS0, 0 0@4/r P S  SY R#S R S S 0909:jS>0)SDPL HP 0_ R0*0D  181 ~P_*00 $R R R R.0R R 1810000_ 0:0 0 0 8`ЍM0bw3w^wFwM-$P@p`VW00P0S@P>0U0  N2012412812<10001S20141S24181S281<1S Xp`DAP0_00_ 0 82.PP,5~@1Sr00_r@`` N0@0 :pD0@0PPpTpX0L_0` `$NpppL 1SAP N 0P !P0 S L !_0 0_1    $  "$   $  "$ 00_00_ 0 00@0_0_ @000_y0_XQ(!}r3/PP _ 0 PyƂwƂwǂwƂwBw0bwVw@-0S lP xp@-PL@0hH zfPPp4qwP00 jwP p詫wwwPPwwww  8<< <<88@ 448/ @8<<88@0@0  0 08h08\ 11 11@008008$ 11 11@008SA-pf`_@P`KRURqRvRRexAH01aa/P P Vj`P |Ѝl_10121101~>x100x 00j`꼫wȫw|CwM-`Q5 p0S1 v P0S( 0 @D T#@ 0R vP0=S P@D R !rMT: H|Ѝ@꭭w@-@|@Ջ@-@M |ˋЍ~w$0P  8tw@-0(M@ 0T 0  00 (0&lP(Ѝ |P|lbw7@-P@P |0S Ѝ0@-@W0  0 0 0 0 00@-MP@P ,|lЍ0wp@-P@P6|p۹wp@-P@P  p@p|p@-P 0YPTP1S@-@o耭w 0@-| P|8tw@-@P p{0K%`` 000@mPD0DЍ@{   ) Ѝծw8twlbw̆ww@-0+  %0 xmЍ8twlbwp@-QPM`  tL/&I0P x)Ѝp@P0/P @@@SmPP 000$0${ݭwlbw̆w孅w w@-@M`P T@@p0`lP404{Ѝ Hlbw̆w]w$QiݭwM- MD`[@p 0$SU0{S` SO`P[00@P 01 jPP  0iU [00 @001 Ѝ0Au00CS 00S0[p@0 t t pH0 K [0H 000t00p@lbww@w/twGwEwQ/@-0P 0 00 B PStw\w\wA-`Pxp@P_@,P(0 2 z03/@P$z,`*tuP`wvw@-,@P `z 0ST ( !<z@3/@P zzꪮwǮwwwvwA-`@pPP V@ tl @  $ 0S 3/@P(01(0(01(0t $0`S@8twM-Mp`@wt 00M  Kz #KsP5 (010 P pMbt 0#KsP 1V Tt⽫P s$ItⲫPP sРKP Р  %z#w(wM-PPpP ,t`P)!t0P8 ∫@P Ps:tPP 00RnPOntP  7/PPתVPPV ΪP\@P s0 0꾪RP0@-00@M PH 0@P 0S@ ts 太墪Ѝ0lwP@- 0\ X\8@0Q P D6aw0 /p@-@0P00=l $m ipwwlbw ؅wp@-@sP ,P~sP @p uypywwp@-@{sP ,PjsP @p ayptwQwp@-P@0p(hӑww&w둅wʆww;wօwPwjw4!wN|w1مwwwp@-@0BSRP PU Ppppϋw@-@ P@E-P0BS@$M@ w@P @$Ѝ Pt`KtZpPDtPn0 00p@` nVP!psU dԢ000 ?, !f$¢ gBwjw4!wN|w1مwp@-P0BS@` @P@00V ƂlpsʆwȅwR @- @P ;P/R@- @P 6P qs/ᢗwR @- @P -P/A-h]`@\P\p`VTLSHQ0S T,: ?s@DP=wbwSwYw1مw/@ˆw00_?SP/ˆw7@-PPP p@0 _P TsP _ Ѝ00 j_ˆwɰw@- o Ѝ@-@$P;,0P @-hn/ˆw ]C@-@ģ@M-P`M00` 00@$03D00 00 0 b0808 0T0(0S 0 $ 0 V00 0V 000$0 0S$0000U0S T`Ѝ 0 $ 0 0/0S L ( H032 HfH0,00HL0(0;3<000<0H0 HfHp?400 000@ , Z:s 0 pP 0 T $  {0(0 @T c<@P80C,0 C R0P  R  B  HL *< H L L H04 RQ `K B` T. s$  R@  p Q  0`E0000000400400HD0fD00 LP` p 0W3`0@s 0 ;pPN 00C 0B ES fB@@ˆwHP <P 0@-M(B@ Ѝ0/ˆwˆwE-M@`P8T3 000[$`0[S# S``408 SR00X00S'  AhP;80`40@0KS`S`` P+0`0j V V  V0S$ P 00V V V$n  n02[p0S$0K` 00,@K  0 @0Pu2[St nnp꫰wwwwwwM-0M@`0 40 h00M0,0 (@ gP gP0/S S00@q /gP0 ,0(`S PC 0/R ,0K( KPKp ,0(PS<p!00S0w0S P  @ 8 ڡp8 >W  ;R*,Jg0V0/SP0`_o,0K( KP`U @X 0S(00 0,04 0$0K 0 0pP$0 0>ˆwˆw@-@00X0 PЍ0KP TPTPˆw0@-`P0Q xp 0_0P @0S 00@ Ѝ P_ˆwˆwp@-P@F@+=T' RP` S?#RL0S0 0 5 0`0? 01P-|ARx!^P @p00pˆwp@-@PH0DP @<0 (ED0` f461 F525V(pˆwˆw@-`pP@0 Di Ѝˆwp@-@r[D`ނ0 Up@, 0S/P/ 0s006aw- 1 ^ !(0S00 00 0$000$0 00$000000000H P/@-@  ଯT4̆wˆw0t P @-@\ T R@Fl ᢯@T@P@T/4̆wˆwˆw}w0 sR A-P `QpPB`@ P,0S P00/QM-@0P S S9?QBHk2Q*0!+`@0S p0 RpC弰P3 lP`0S% S S0  PQ* Sq᠁`ADqp`@D00@wM-M`Q!@02*?P% ??F1HР?p?p!RРT'K0  0 P Р!-<1 `@DQQ p P!`@D p!? ? F !1GР?P?P P Р <РA- 10S@p@?@?`{PP  P@@ ;1 S 00@@$@0;0@ S Pe@P@@d<eP 0  $dP0@04̆wwwwE-dM `@ pP) PD00 34 0304S(0@0(0(08!S0(000+P,0开ᑃ(,0 T-0UQ1 SjpdЍQ(j Pム 0H0L0 201ᗀ0 H $0000?@?P @$000$0 000ˆw谅ww002@-0@k00 0@-PM `:c@PЍ0.SpE @Tc5TcP 2օwM-pP``A@.TT T  cP a0DS@@PU_@^wM-@p`0P R U8 c@X\R/R   \Q/Q  QP 0U@0@@00P S@ .S0S .S0S yc @UP 000 S .S @ϋwM-0PS`G S SA*pAH0!zp@0S  0 S C0P  Pp000S$ S S!\0v * \7 \ :00R A~@p@H0a0@`S000R" 600000s00r0R$ 40000000R 020A-P@T 0 S2 S0>T*`PA _@p@-P`@P@ OpM-PMQ Q, !@P〰00x0,|00000000%U U 0 S2U2#*0 S0 1 1S?U?SPЍU:?U0 o P,S0@0D H* P PZ$* 80 S S ?PP> S @0 P0D  ?PP?pP2 PR P  R2 R?0S V` Pt P6 P Z* 0S @0?D 80op80 @ D  Q )* 0 RP0  R R /PPn .Rk p8 0P P_ /pPY ",@ DP03`1:,P0` P$   ( $ W(  $p5(05$0!0S0(0 00 1 { ,v R   0 0## 00?400`pp* 0 pS40`0 `S00e0 0p1P p!8  1Ps0 S0`0A p0p 00 00X400$0HL``/}HH0? 00t0 0 0  1 PF0Xp 0`0 0` d 1P5 7  1P*p0 0p00@ 0D`0 $0(0@`0D`P006* R2 R?0UJ* P@ 06P 0\fHZ<0t3 7`3 !P0X40`0p 00 0<00 Rʜ  P R2 R?0SO0 S_ SRS_ Y?00S00000 |D`@Z`P `@Z0 S &810aV1pps'0H00L00|HH0Q0p10W 0xf HvZ0ï p S  :0!p P0 00  0 S_ SRS_  0 @RP 0& p !P 0   R p p0Upp00 S2 S?>S p`0 P R" R/.R 0pˆw wˆw+wH-0?0?0@0M`?@x ?@6 P 0P0K H`PP 46`P  R`P 4̆wˆww3w3wA-0S ` pQ 0Q@%  Q"  0BUP!m IP0100 S 0 S  1 S:00P 00 S2 S?>P@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D #0 s0Ps0/o"X R,0<1K 50410p  0 G0 .0`0 5 0 s00p0` ,1S,! S0,1<1S< `0P `VQ ` VQ  Q ` ` [o |_ 0  5E@Pc M-@PK0`SpP \S/S ^PP0S /S\S0S  ER^P0$  $0000000SR EP <^Zp1 p! <^P <1 S  ^P0 0 0S5w0twp@-@PKoP <^P0Spp<1S ^P E-`pMB 30s0Qsp @P 40D Q0  S 0S Q0   C0R06 0 R R 00 S 0 0 00S0PuPP 0@0 p0U(00PSuP0 P 0 p @    40PES @DuP ;0SP ߍ7@-P P@P=0020C0 Ѝ0M-`Q0M @0Ѝ p4.]0.S P   @P0 S_0 S000 0 0fc ^]PV P ``  Zc }]0`S0 4 Q . 000 CcP5 P# PU U U(R03: 0$Cr"Hr!HRH/_0h0# 0 c8]8@$A 3y@@u]wgw3twONM-M@S`Pp0S`Ѝ R RW 0  0pS 0 SB00 00p]0S0PS 0 S0!01 P  M3P o R" R/ R/bP0020C0P `@-@pM0S ~|b0tb夞 0G@P Lb@pЍ ;3 & @+@b4̆w跅ww?w w#wp@-\`0M@㴖@P mPP PNLo0Ѝp@A-p@0M☖PP @ Q`P@ |P00 . A@P  m@P0@H0Ѝ@M-HM@@pPf0P0 00S 0P0L H0P0C0  PA@H Z2ἂ 0UP` U P?P@0Z%0U 0PS0Z 000 00c U  00?@?0P0 00巒嵒HЍ P@ Xa Q QT*0P 0P0 a ᎒ PU  S0h 0 N2 ဒ0 00 h00h0~P@0 S2 S?>T*0S 0h P0 0 0  0Z @[ 0 h P 0 P R" R/.P* 0  h PU 0 h0/P@u0 S2 S?>Tl*0@8wKw@-M8c`P@P  aЍ虱wA-p`@dPPP @ L 1b@P 0@PP p@-@` P~P# -g1Z1   1d 1@ ! 000 0!`pp@-@嬑@詑/0@-lMP (m@P000 00`lЍ0%wM-@ZMP80 `ᐡ唱1Z0P 0 ( $(pZ@P hP `@m8kiZߍ@廔@P  8tP` 1$  P  xh`hP$ 0 00vu  R0F 001 01080P8P0 B`P`0+, PPXp 00 S011 0,  00, P bw@ˆw~www0@-M0B@RЍ0E-@lM0 q05ZP _ P@ҐАΐlЍ  6pYPY@Px_P@h@P PP0 H2  `P  $_PpJP_0 0: 80  #0@pP8凐ᅐ P 0@??ʓP8n0PT0 P 8b`U u_PP0  Rah0Pb_Pq$0S (0 0  R 7P_PP Z`@@` `V:&PPPP꺱wϋwօwԱw@ˆw~wﱅwwwM-@ZM0 8/hY0P0P@`* $ r$p(YPP h#PP _P@`@H`P 8@P ` 2  *@P  ^ڏ8؏֏ԏZߍh{PP \hP^@0S*( *@PP|T)@P E/0 S㴁0 (ẁ p/t$@??PP @hXP hXP@( Q@P  / <J/ 0 E/+ R 0< R㴃3ǿ(00 0 p P8@P {^< 0 R#(#s0< 1 R! 81#((0!80 0p P@P8'P HY^@`@\Pbw@ˆw~wmw5w0twwwwwM-MPP ??@ ML\ʂ\:Kx.^Sj? A?0 $0   0 mP 44^$0 $ BR 0( .( `p@DT 0 c  ?0?0@0M?? 0 E .Р20 8Zdh0a@ 0 `s  0&P$  .w_w(w>wYw/0@-M@"l0< 0000PP 5/@T Ѝ0 P P 0S8w 1w@-0`P 0 0<0 `@0 4/@>T RT TA@P0 0 3/@P 0  Ѝp8w@-P`0S 0<0 P@0 4/@>T RT T AЍp@0 P 8wp@-0 P@P $0 <0T03/@~p8wA-p`PuW `@P`W{Ѝw0<0@ 04/@ZT0 RS J'P P]0 @ B‘0 @P8w:w/M-`pVP# *0%S3<0S\ Q\̏@P 00000 0DPP ᥍ `9PP0S 3/PP &QD`}wwdaw}ww`wpbwP1w@-@`p͡Pp 0 0p07/PU Ѝ@-@`pᴡPp 0 0p07/PU ЍA-M`PQVP@@ A pW p工%p@ P&AЍ@KpP  1\0   0 0|%0@P &ANP ]`<P@P Aؠw⠅w0@-@< <P40( ( P \&!wꠅww|#w#w0wM-pM8娰 @@0W:a ]. P pt `P0P PP >@0  `$&VЍh̆w 1wA-HM0`" ( s*pPA  4M#@P ` [ᚌHЍ40 @P0SR0SO0 00@T>Q: 0 00P @0 @P,0000 0+@PRd2@PO<px[0S \D#VPP P&A  D, "@:A< X[U  P 00S @;P%00`  @y%TPA PqUm ,"[jD߅w1w6w2w4^wc6w1wI6w36wh̆wq6wM-0 0 00`p 00(PP@P 0S Z0 00N+@P  0S  @PЍ|Zht )PPdZ:A E⨀Zẋ @P Sw1w\w}wwSwСwP0 0 /Q Q0/w40M $0 000oЍ/(dw@̆wD̆w,0M@000oЍ/(dw@̆wM-pPpp@T 0DS` 0 0``00 3/0 S4`Hdw8dw0S/0S/@-p 00CQP 0 0 @T*   @0L8dwA-`pVQ  WPPU Q(7@P&Q  * 0 0$0 0 @0 @@,dwp@-@Pj *p@wp@-@Pa Tp@np@-P`XUQ@@V@T A h'[p@-D+ R@-;Q ! , 0 0?8̆wM-@'`P 4 aЍp̠P U0S  000 0 0 000$0S 0 P pp0吊00 P 0 pp儊,dw@-# p@-@P # ps@-`@P0 00# Ѝpp@-@P # pp@-@P`0 " pp@-@PQ#pHdw0/D̆w00S/M0Ѝ/D̆wP030 / /<0S/A- 0@S p`PUPU P  SPP P  SP<0SQ^ PR0   0Z .\ >P2 0 0 0@0P 0U000s0S 0 Z  R   VgQ 0Q QQ0&E-@M`p04PMQT ?oU20SU U U U   @P :TABЍU A U 0UP PT0  PS@M-M pPP `V @P W` @P 0SጃЍ R0 SV@ 㑅@P` &Q W ` 0 S/ Z 0S _ @000 00bPU:Z* 0VS 0 `6/Q&0 W Q UPQ `00 ;/~Q Q@ QP1wM-p`P@ TU`V  0S 0P0 LP @PP@&aV  0S  (  LP ZT :a@DC +Q`T ^ QR !@0A-`PpP'  @P"  0S  S>A ЍAL\^@@0 AЍp@-P@ PP  0R 0 PPkpE-pP AM `䀟P@T  #LP  Q  00SRAVЍ 0"@TP`0`F     1w-@- ЍЍ/-@-~  ЍЍ/@-@P ` PQ  NPP` 0`F    j0 SV   0R 0 ߁Ѝp-@- ЍЍ/-@-4 @ ЍЍ/0@-P1LM0@ 0!PP- LЍ00 R000S j0 0 Q0 P @ 00$D PP 000p0   T0\@ 000(03/<0 x@04/H̆w2w@̆w8w0@-PMe@P 0000 gQ0S S Ѝ0 80S 803/Q *2w0@- 00? Ѝh̆wM-P00M0P` T0S 00 P 0S UA P Lp`P\ pP:Ay0Ѝ$@P!?$  "&*(0GP&Ac$0( 3/@JT ?$  0#03"&*($`N 03/8T( $ h T ($04@PT 0t@U?` &f*{jTTP``l10 PF 0S P㘁 ^`V$` `@ $0 4/@T8/$00 #6:0(0 0P0!(0 0@$0 4/@T  + 0 Zꘀ 0 ($`t 0 &AGT 0 T >T0T0`;6 A42w8w2w1wh̆wA-Pp0 0|5@T ` 03/@~T 03/@t0  ЍP1wM-MPe`0P A0 o0 00x4@TT [:ATU 0S@YЍVp0F'p0Z&:4W [  X p W# P    0 0Pp Z: R Q  tPp0  0 Q @pP1wA-@Pp `@P  @P 0tA-@p000 0P w`V0S S a JЍ00SU0$`P2 S 7tfJ 0S 0SpWX00 0  jP 0 0$`P2wH̆wݤwp@-`@ VPL L0DD0D@$ @ 0(0, 004 <@$p|wLdwh̆w`cwxdwwp@-PM@0 `0 `04P  1l 0P  L0PPPЍp P ~1w4^wD߅w %@-@iP@-M 0  硅wdw@-D}P 0|`̆wp@-PHaK*N6}P |pHT*p@-@ThlM0@ ˣwdwA-pp@P`X A 0L Q 0S , M@@ PAdwdwꣅw@-@-@D0T@ 8 T21!0$qMlMdw;wӣwߣw@-@@ 0S $04#0S @vdwdw@-@- 0 DMddwߣw@-@-@T A ]@A-`PDArUV`` A %~pP&A p%|} 0 PE("P@cЍ P0 ` P P0 `00 Q0%0"0%0 `%S3#SQ0C0 ;s0 S:P 00 0S0C 0dwdwp@-P@TUT 0 Q'pQ Q0P 0 PP}pdwA-@Pp`UT VW@@ P&A 0,0p 0  Apdwp@-@P`\00Sp 0<  RV00U 0 00pdwdw@-{P XlLP0S 8Ѝp@aL^{@P0[S `@PP0;ST @ RS 00C S!2#1T `P:L1UOVÄ ń0 @R  U R  R  U V   `P0   Ѝp諨wwdwdw1P0/@ 0 R S 000/RSP000/A-z;P@ ~PlPzP@` p9T/T0@DF&z@P;T  UPX̆w@-XS0S L3 Ѝ@1{PM N#PI0CS?0S S0 0 CR 1"!! s0$F{P zOP [P& P10zFP` OP0@rzE@pP 010000$r`0Vm0S Ѝjz10@S񟗹www|ww w|w|w|w|w|w|w|w|w|w|wwwww|ww|ww]HP0P10@S񟗗ꔪwwwwwwwww|w|w|w|w|w|w|wwwww|ww|ww~P}&@p'@@@.4P2P00@S@g~P c@  0V0S S  0S  ST03/>`|`̆wLdwT̆wpdwp@-@P3UT@@ A @`0SA   0@0<@/p`̆wT̆wLdw@-@%p@-@PTU A Q 2Ap 0SS S SCqQ !Qs0^`0 @00@$0@0<@Cq Q`̆wT̆wLdw@-@@-@0P`  @00`P400@0 @P0xP000h h@P`2 0@P @UJЍp02wLdwXdwxdwP2wh̆w@2wwwP̆wwwGw@-@ ^P Ѝp@-@PT$ 0S! >P P 'P@%P P @dP vP CP@P@ 000CS@ PpM-`p@xM 0Sv0&&& P$ \ \ S0,̠S#<   0    xЍ  * \ \ S0,̠S#<   00S00(0d0S S  )* )0 hI )0PEP P Iꋠwp@-@QP" 0S 4>PW P5 'P P dP vPJ CP@&듨, l@p@኎00 00%0P`0  0%@0D 000CS@ဎ00<P0 0S0000000H0@0D@ᗏ0000 0000! 1 0 1 !0 1 @0D10D10D^wP/0S 0 40S//P/0S0S/@-0S0SPS0SSS0S/S/P/0S @-P/P 0S @-0 4P/M-M`p P@ T9 0S P @ P  0R0 0P  0W 0 U: 0CP Z001105U !CPЍ@dw 1wp@-0@ P`Pp0p@ P0/ R RC/ $0p@-PU `@P@p M-R``0 PP QM@p`P  X@  ,@  ^w 0 QA-@APp`0dPP    `0PPP 0 $0 ^wR p@-`@P~P@$D`P@p/A-`Q PAgV@pcPPP R0@0@ J F^wA-PQ00P@`P p;`P  -00SUpP/0S@o/0 4p@-P@x&U 0S*`P xU0  @0 p^wp@-0PS*`@P  +pE-PPp`@ xW@ 0S@*@∀X: ЍP U @ xW@  @0S 000X400`0l00S @0 , P?/P\^w@-+@P  80000000 0'^w^w@-MM@P M6 o^wM-p`P $m@P. 00000000W40W80V4 0V8 0U4 0U80Z40Z80X40X8*,p`'|&l P0%\(< ( p `P03^w0A-00p`.PP@&j@PP@0SXP 000000@E-@0M` 00R0V0S Ѝ\Pp'@PT rPW- @PT L@P }5T 0 0e00 0 ◃PP P T @y@P&  XE\p/@P   v0SpuwTʅwywՠwQ0  $R Q :\\/0//p@-` @PUpP0S 0S  n@Pp@m0 4PE@@-@ P0 0Ѝ0@- @}E誠wM-@PQ0M Q A QƒwƒwDƃwQl  R R. Pa0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < 3E6 /E 0`4 CR PC$EpDdHL `@0UhE E`R 04 8 <$(,"(DP000Ѝ0BSÃwÃw<ƃw<ƃwăw<ƃw<ƃw<ƃw<ƃw<ƃwăw<ƃw<ƃwÃwăw<ƃw<ƃw<Ńw<ƃw<ƃw<ƃw<ƃwlŃwŃw<ƃwƃw<ƃw<ƃwƃw 0T400 D0 4$  50 0 $ 0 ( 04,8<D `R00  RD `R00! DP0 l$0dSD 0`pP DW`$ $xD0` 0  4$fDi 0  4$  QD`P#儃s0%00FDPU `%0pLt;D0G~SP0#0G$DP.D1R  0'0BS񟗛dƃwDǃwǃw\ȃw   )0S ТaS0  `,(0l 0 $0(0, ,C,0`0 $0(00,00 4 8 < 0 0  0 0 0 4 8 < h `C 0`4 CRPCCpDdHL⤀`@0U C`0Av`PC0 $ BV0 yCPt kwwҢwR҅wN|wwwwģw3w¢wТw̢w݅wwԢw㢅ww袅w w wօw+w>w2wՠwws݅w7w|w>w^wwwçww@-@MMT /`P,p<+R0S0S 00@ۍЍp0 4@`@-@MT  @܍@-@ @~p@-@P`w \@p@-@l@zp@-@Pb@opp@-@PWO@dpp@-@PL@Ypp@-@PA@Np@-@7@E@-@.T @:s@-@!`P P  0`PBЍpw@-d0M@P0  P 8,P$ 6.pBЍ`0wh̆wwwwM-(MPq*@`T *`P)@ܠܰT(Ѝ 0 =*P00"@00 0`0pp /P 0 N+P0 _)@JjwZjw^jw@-pgM@`e/P0W AgߍVT 0ES0(0P   012/Q1 QA2 -P H B u@@P BdwBw1whwp@-@PRTU00 A X >A P 0@Spp@-P`;P@TA$ Gpp@-P@ ]0000 00000000p{M-(MP0`p 0HLw0V0  @\TW@@ h;@jtPHX\0W@0h| T  hF;/00@ y/@ \;P* @a@<@P% `q9<@P& q2<P+@PC Tp@`P<W- PAP`@(Ѝ@pc; ;0`.S X; ;`0@[ S/R`H; ;Z 0 P@UP  r 0  8`0 P0:^w0w̸wϸwҸwօwp@-PW@4P@h@P@@`tqZpp@-@@P P phPpA-`@pP1 ;PAh`/;P`QW90 W003:P H0/oL#2>0#"0R >A!ЍP,3rpP&A p?:P qq@P  0RPA0wRQ00P0S,p@-P0@SM X0> 0PS @`P Ѝp0000$hP H0L0 H0 L /p@-@PT Q  PPP Ppp@-@P` @p@-@T A X0@>A@-@|`qA-pPM@`nUW00V0Sp00S0T0Si :P,hp/2:Pp0) S5R:PP q !PP0P@S0 00@%PAЍ :P!@0Q |PQ0)S*0* D* 0 0 0 !!2| <g:PQ0Sā00Q Q0w0w2wRQ@-00P0S $(`,P00C 0@ \^600 ` P@P:Ѝp @-M8P@`pU A  @PP @)Ѝ@-P@` @Ѝp@-@P@`@$p0p 7/pWQp@P&Q 0$p, 7/PzU00p Ѝ0wQPM- q(M P0`SP@`R @>P`0ShHP`dqAd[`_P `8 00)ppV`1q3d5+:U-  df`p ! H L8\(80 SH00H0 PP P H0L 0 H0L p`)R q pPH0 L Q$00@P000$hPH0`L0H00 S L05*(Ѝp@-@PT Q  dPPP PHpp@-@P` Q@ps@-PP0@S` 0`0`0H`LPЍpur `P`Pp@-@`P 0@pM-M@PP 03/PU Ѝ/@T 0S0S`pT0S0S >y 03/cP0TUPEoP  f` 03/PKnU@U 03/?00w@- 0@  Ѝp@-@P+@8ppL-`P @p  `P@p߃w( 0Q0/Q/dw0 4/p@-P@U< 0 pQ0 Q00pdw@-:p@-P@0S pPU/oP"U&pp@-P@TU p:pA-p`@PW5 o0SP.V/o"Q(:A#1 R Vww$w$w,w$w$w$w$w8w^ S@A   AdwM-pX _o0RSPU QЍ``#@@D0 Sb`x`[Q0 0 0p@@DdwM-Pp`PU 00S0V0S X W〠@ @D0 SM: 7P 0 $0S* =@ 5dwp@-@P`Pp 0 PPmp@-@P`Pp 0 0 PP0 P PmA-P` p @T 0 ``mM-` 0@4 8 <000S@0 SS 0C S `wPw@wwPwPwPwPwdwPwS @ AЍnoPP   0 P Pp 0PT 0X 0\PX(QoPP\ LoPD ,0- .406P ; p 0 0 0 X0 P 0PS p50S SO PpPP0S S 0 0  !R 04 &A l[ll A&AK &AimPP PP 0 40 X$0 $Pt $( OmpP  l&AV  |  40 pp 0 呲+dwp@-`P5 @A5PP;PppA-@`PpT P:W R U RP  PPUM-`Pp V P: 0UWX@   E`F! p7`P 0QE9l0a@ T  P 0U0UasnpP&M-`p@$|V dP:TW00X0SP z 0 F! `P 0AD`fP U  HP @@ @0t`S@*+nPN&A-@`p4T PP >:  @6PU  P 0S:0aFQU 0@S*M-P`pU P:W @@T@V@T  4@Z0T@;pP @Vp ?4 4P@XPPA-Pp@T` 0 pp0V:Tk RkPkMk`@-@ 0 000@;k@-@T P:A-P`pVU Q(kx0P 00 00000 0@ 0$0}&QyPPp@ rdw@-\m:A-`@UV =P`:ATZ A0PpT0X0\PUJ@H0 SS 0C S w8www8w8w8w8ww8wS pK Q@- @0  Q 0# 0AS 09ꓨwM-@ᴀ崠P尰U`0VP  S4Pp 9(  Bd 9T T:(00T*8D9Q $9 9`@dw2wҧwݧw꧅ww1مw?QM:\ <0 Q:P5PR/ /M-@ M `PPX# TV9 ЍQ 0S( 0  R 2Q?00 0r5 2800 @P /9& P( BV`1(0 0(0000! 0N/ X.0T00C?? 0,00 @(`00Sj 1Q40 0/5 2800 @P (0 0(0000_ PR RU  0 H(pG@P SP PR"&p R|wpwwwwwwwwww ,( @    P P Px8/ 0"&*?;(!00p   GR:8+Aww)wçw䦅wwĦw7@-@P  kP 00A Ѝ02w0S / A-P0 @4 `8 <000C0 04000C0@As 0pW 0R: B 崀R:@ @KP0@0C0@0 SP P0*///@-p@^@:$0 `6P,: Ơ0 P0030#PP030"S @oP:ewM- M@@0D0T  00 0  8$p0P000jT`"T #0"0@ pPpP$ 003P3U 0 QS@@0@ F T  10 @0$06 $:F @00"6":& 0[#3\#QPQ Q [ 1 1Rp1p1 [$:R 0: 0 000WhpW 0 'vzp0 p!60@T0$FJ#6pp @$00Sjp0@T 0$FJ#6 @$00pP0p0 X( * $d0`P0H!`814T0 `$Pp&6p&*XW"pX(,,p(X [ $pPQ Q0$P0 0 000g@ X0PPP@T P  41P Ѝ@d̆wewxww1w@-P 0 0"&*#6 ЍM-  ASre` 0Pp&3 PR P[ll0S&ЍBV$ZF @PX@1P3@TP T3#0SP0 000 pP@ 가0S BV$ZF@PQ@1 P1@TPT 3#0S\@T 0<P : ews@-P @/P0` * U R  0<<P=6 Ѝp00 09P:`wwM-oPp0#03 F%VJZ(P0GPUU03P Ѝ W0* GP  AP0P 0wp `V ` &fj"6"&  00 U R  $Fs@-PR  QЍp?@@!fj 0 P$F 0@@$ "0# `@ʑd}A-@P  P@DPQ <@\0\p,\^8`4P .,UV  005  0#D A>ʑd}`w$w@-P `P@ Rp( S ^00 T:Q(Lp @ W(@DU (p000ewd̆w@-````P0 pP@ (a@P @0 @P {` ЍM-`?^N@PU0 #0p4*   T 0+ #6   0W 0 *     ЍW0* T0"&*#6s@-NN@ooP 0<@ b 0P 0DH  P0Ѝps@-O`HtP4  B B 0"&*0`<0< 0  B00`"&Ѝp ww@-4Mg@P&0 `P0p `0pPP00000`P(0|0|`$0x0 0p00h0h0d0,P0\00X0 0T00P00L00H0:0p4Ѝ2w;w1wh̆w;w1w 0 Ѝ2w/M-`@pJPk'T  V R QtЍ1p1@1P0S&Ŕ`V&0pW-0S ` R^P8@ 8@ t1@DDPUMdd1(0`1,0Oh0P 0S 503/` &,*  Ơ ^`PpD0P#\ 3 "R D`\ #3V3 "Z`` 0R  0wwwwwwwww8w@-PPP0 ew@-dQM@TR@PMj@PJ8a@0!,,` @@P=p  @p 0P! 0!0!00p@P(@P%p @P"@P@P @PW@P@;7-P@D=-0 040`0@P ($3@Ѝ ew;w1wSwSwSwAw@-`@P V3 : H 0 2 ? Ѝpw@-P@`APT  P .P d  P _0` 0 0S0:Ѝp Q Q,POwwp@-@`PH 0D\ P@P00p@Ow@-@@DP@c p@-`P`FPE@@pS @P T@@@-@@DP@/ @-} @) s@-P 0 S R0@ ?P [P *P9PTЍpP@ ]PP -PPD_oR TTP ]P P` P]0P0P``VP%0s0STp@-P@p@}p@-@pP`c00 0 006PT000f Ѝ@-@P`pKT A 00 0 00K@O Ѝp@-@P`5 @ApA-P`p@'VU00W0S. AT8 &A0 @00@-P!M0 0 0000 00!0 P@P3 0@0!0@P) 0@00! 00@P 0@0 d00! 0\0@P  0@0!0$4@Ѝ0 t1l̆w1w"Tw8TwLTw`TwzTwtwA-dP`p@ + P   ,P 0㓄$@T PCwA-0P `pjP@ b@P 0 ]P b00@Ѝp@-`Pt@@0 0T*0 0 R  0@p@nw0@-M 0E@P|P)|\ 0 P 00< @P00$ $z@Ѝ0UbEfiVaww\w`@-\@M0sP 0 00< 0r IP 0ЍewRwkwqw0M-(M 0 cPP& 0@p0 `0X30H $0Y 00S $:P" P |a (Ѝ$p 0H 000 0 P0 00 000 00@ 0@D <0  D 0@P0 @0UbEfiVap@-(M @Pt@P`P 00 0@`PcP"UV AA0%a(Ѝp豩wwM-0 M0 D20 Ѝ@ $$1RP P B`V0@U#* p<X`` 0S%   P !` 0 P d/ P  *P 000`PuwUbEfiVa3ww@-Mb@P/&ЍP0)00 h 0ƹP!RD/`SR tPçwwWwuwM-P M a Ѝ`QV0`` p R   @ P0@@TS`` 0 U 0' DQ Q"aVQ V!['0V& @[@5 T 00S`RQ:aP 0   @  R \ @0  `VgP@@ ewp@-P@/0 6/0 p 0000400800L0twww w w@-P$P@=@-F.0 @O w0Q0 #0p̆w@-4000( (0j@P .Ѝp̆w<wߩw@-+@-&M- MP@pD`a@P&v ,WU pPM  PH0 00.P?p0\0CX0L010 t`0@  l1p lFP"V,0S) 818$001V(0(1,0$100 0D00E0@0 L P @ 'H0 @ & p0\p0CX00PƷP p o| xP ЍF0H0 @L0 rL   ` p0w2w 1wwwww2wewA-PPp> 0S6A/0S2A+ ` R  B- >#0"P :L4@A@ACpuMP 0 mPWAH.s0 0q AA-PPpB ` 0S"A20S6A.0S2A* Q A- ƃ>#0." P :4@A@ACpbuMP 0 mPWAr0 p A@-@ P 0P P P Ѝp0w@- @P Ѝ   @T  `P02wM-@ MuP Ѝr0%S& r Q0hK-{0P S  ,;-PIP pwfP4@쀟<@D<0S t yPtdrp`r`  P00Sh0`0 0`8P`P p<<@<@Dw+w 1wUw7@-PtP Oy@P&r0%S 0p\y Ѝ0MP@ 6y@P @@-CxP ЍEx////////// Q00 Q0S/p@-\`@TpPL0 0@0t0@@cR,00> 00Q000p̆w̆w̆w̆wA-@T @00SLPpW@0@`040pS  D00D000< Ăw$whwt̆w@-A-P`p@UV00W0STA00S@000CSNA 00^0@00000000 A@-s@-n@-izp@-PcU A @0@T RA0D@0<@@0 fpt̆wp@-@`PL T A @00SNA SA VD000D0@0U @ Fp̆wM-`0P+0VS00U0S AO@00SNAJ SAG D0SL 8q8  @ DT=  Ot@,0Z S  e(0S  ]00S@@ !PA3 5:0M0 @!0 s 00bR000CS 0L0D000< D0ЍA Ot@Ăw̆w̆w̆wt̆wM-@`P p$(w?o2 V0U0S6@ QA.[ XZ00 Q0S'W   0? 0S4 0@00SNA SA Dp Y3(0@@D00D0 Ăw̆wp@-PpU A @00SNA SA@3 0D@0<@@0 mpt̆wp@-PUU A @00SNA @30@@0@Xp̆wp@-P@U A @000CSNA @42L0@J42P2@0@A;p 0D@0<@@0 ̆wt̆w@-@T A @0 RNA RA  @//p@-x@`0PS -$ U -U<0Pp-Lp \Pp̆w|̆wM-1@P (]0cP,s,S ~]P ?? u]P @ [00S @T c]2P  @P@| @P{d/.@PuPH2`@ 0@2$082@(002,0,200(240$280 2<02@02D02H02L0 2P0`0X01 0Ud002/>F12121313131 3131313131 31$33>(31Q -0pQ h!P0@P T) 0DQT 0,!40q@P 0@P Ѝ@Z@Z0S 0@ZTZ 0&AZ)|̆w̆w̆w̆w2w 1w2w&w*wP+w+w*w&w&w&w%w%w'w\)w'wH$wP$wX,wX$w`$wh$wp$wx$w$w$wP,w$w̆wt̆w,%wOwx̆wxwww7@-0  0P P@P Hl@ 0 @P  Ѝ0 o)3wwA-P@`p U AЍ0UW 0S0SV A0,`P PPA):A@P } X0 R *0sA 03/r0 3/@i00 @@0  P5 202 >@PP@ ` @Q@P>@ P *@@Q`҅ 䎀 @@A>(@CT,`DQ *!B \ L B  b S!0L0 0C 000B 08<8Ѝ0HpAQ \PpQ0C@\0A\ @\@0| R S1a:Q"*PPF\PPPP4PPP4PQP Q!0!*LQ\PpQ0L00000`CL`0TCPpF`P@0D0@0S0``0` 0ST@#4p@@T00@( 0J@   B?Ņwƅw%ƅwM-xM,8P@Q@,`Ap^@Xq^[ 㲰 Ჰ0Ux@DQ@DApWQ~pS:RZ>겠zJpW^ [P^XpⲀᲠ ^㲀PU$P. P! ` \# X$ T#  T @!T!1*  @/o" % RP# P2U xЍ^ xpr^pᰂNPP $  * B(   Ap`@Pe:Tf:@D$`@@ @@`A0 p45 @`@```4``0p`VpAFP@@@x@PDU@Dt@TDE QY ,@ Q)(@ P@T$ RP A8PlpP U*PPFUʯuP\P`PVPPUP @PQPaPHEQPP@``R ( \  p0a@A̠\ LP@`Pzp ! ]wRwXUwRw P 0S 4) S. (,08<l P L //R9 <S1R  3Pp@-@p 0 S(0 $0 S0P$0 00%(3/P U0Pe0 E20/U0$0 (3/00P0ES0$P40p@/p(Hw0Hw@-@P  R $0S 4Q (3/( $03/M-Rp M Xp@ 0@?TLD@DPU\EPE,Q) R``5V$V  Q u0p``W6@6P0@PW?TLD@D6 ЍVmFW=0`F 00RRR0 R  R0  R  R 0   R0 R RR0 RRR@R0R 000 0 000 0@00P0 S^6@Z6V}P0pR0RR0 R0 0 R0 R 0 R0 R 0 R0R 0 R0R 0 R0R 0 R@R0 0 @APT0@PWM-P0M> @T; 0S0S508` S 00 0 00 0SV$ 0   ,bP0`0U 0S`0   ,,`P0`0U 0S v  0&$ 0   ,btP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B 0  >@0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0    [pGE 0 00p0(08`S W J 0S  $\ @(0Q02@057[W0   [pG000  U!RH:P` R 4,0 00 4 05 R$0Wm  pGePWf 0pGePU6o`4`` 0P0 0S  0 00p008`l0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWr 0pGePP PzPk6c0EaPC0XWZ pGePPR6cPEF50000S& S>l0L0 0T /T0 pl0` $0 l0P0 $0$5ql `P  X X  d Z0P04a001 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hwW pGePW pGePP6c0E cPC 0 00p08`T<:1P9Q7 2/PQ3\.  2/R3#RT\# 2/PQ3P 03? 030#Q030"S\ $<Ͽ 3#Q3 "/  03?0#3@-@(>T>^($ 2/Q/0A-0 P`P 0p070G@S8qw`qwqw`qw,qw,qw,qw,qw`qw p @P 0S DP @@@ P  02/3? R@S@@-0Q Ѝ P@-0Q Ѝ P0s@-Q`P0P@@ P P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍA-@Pp`PEPT@ P @p@-`R @PPp 2/V:epp03?*03?0CQ//7@-P@ P P@T @ Ѝ0P @p@-@`PPPUp0U3?`03?0pp@-@P`I0P. 1S C0S U03?S 03?U0C0 :0tSU0e 0SR !@3P V@p 0V@00 / A-`pP@P}P 0 3?2/ 0 3?2/ @- @g0P  0  A-`@Pp0P0P07@3?@S@/.P @U   0U@0A-`Pp@P0@0#ЍS `P 0U P 0S  @P0@S  @0 ZS@p@-P`@ 0p@@-@[P@@-@bP@M-(`p,P@XP@ PP  1P 0W  3P[@Ѝ @@->^\ 00 ЍP@-Pp`@n 0p Ѝ@- @P 03?S 0 0 03?S ЍA- pP`@P X  1PV00Ѝ03?S P 03?S @-Pp`@ 0p Ѝ7@-\ 0@PP 0S 0 0P 0S0 Ѝ0Գwγws@-P0@`BP0 ЍpwA-p@PP.0`/SP  /P HPP @PT:T 0@/S / FP@@ 0DPPp@-P@ p@A-pP@`YPT Ѝ0SPV0S B0P?0Spp @- 0P Ѝp@-@P Ppp@0 B0Asp@-@`P@P p>P  P@E-p0!@P` C` T`#*JbP U P @` P Ѝ`0@-@000ZЍ P p ,0`$0P////K0SBp0@0 0 S S@ #S@@0SS@0T*0S3>80S<0LRLr@C80 SP  P 80080 QS* \  C0ZQ@DD0 @p0 @=SSSQS SP  P R =S @00 0S ]@<  P 0  @ RR0S  0 ]\R R0  0S0,p ( 000K00`00K 00Sk ,a f<  eP` ̆w鿅wwwA-P`@p0S* 0S@6/P @-P`x0x Pp0h00` WU@E0D  @0ES@EE  Ѝ@wօw຅wMȅw}w0 -M   ЍՠwM-! P <  ^<  @b024<1<2 1@T ЍM P B2 b085:< 0  p !`B!Pbf7e \,0B303RZ#twcwswswtw7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E-p M\@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@ p r RQ @B/6aw  @0S0/@ Q/0S0/ 0\ 0C R /R/- 0^A \S  0 S00\0S / P0/-P^\S0q R0/R/0 0QB/A-@R `pPTPD 0@0p@-P@t@0 SRpUp R0  \C/p@-PP 07@P@pe0\/- ^ ^\ A0 R/^^ R A-p@-@P\`@T 0PS0PpP 0S00̆wp@-PU @0P  0pP@-@0S Q sb0A S/ P/0A-@pH`P DPU@H@ PPE qP/0\/ R/0 0@s@-/0<# 0 Ѝ @- R  @-@@@-?!!@-@D0D#30 00#3Ύ 0# !4ׂCp@-`@P@P 0P:pp@-@`TP1P!@Tp耖P/0 -ddQ S0#$R0#R>2 -0A?o2 0D006aw!/M-P@`P6 V p2 0(       01   Ѝ    M- M Pp @t0 d\0T`P`-0 :5P@@U Ѝ^w^w2wR҅w 06#8##/sw0/sw @- 3<0 ꠆-@-@-!_w 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p PAa Q`*M`4`0# 8!bRR`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M† Z`P& `p@ 2 S) r0Qp Z-p@D/ -p@D Zj J ` @`r 2 .3.30+p@Dp p@DQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z-p@D % @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 7 B5S50}wA-R `(@ ,0P 0pS 3 5W T'ЍV… 0C  S U00E@0  i0P0?S0%* 0S 3 5pV 0@D00&^wRA-``Pp@0 0 CP PP  LPTDS50 APP0D 0c0@DP@0 S 40 C5R5 p3wM-P0!0!#XM`  0%0S  R V050Z030J50F%S V05p@"-R 0R1 0 B Rp$0 0B P) .R 06 0A P0 ࠓ(*Q0+ 0'@ 0+R R #R *R p@@@@@ 0'"0pBp0Wpg@#00C 0@ \?hP LQZQ zQ tQ xRbR%R( XR* V%03050pS8 Z0ƅpDlQlPLc BRфwՄwЄwЄwЄwЄwՄwЄwЄwЄwЄw`ՄwՄwl҄wЄwЄw<҄wЄwՄwЄwЄwՄw 0  S50 BRW0G Wppg`p V0405 0` FRWpGpp`2 S50lQ 0p  UQ IQf MQ? DQ wp @!@ iQZ mQ@@3 aQ p a@00 00 @pR 0cp0PP 0 0 0@Tp7 ww0 0P :P@$Ÿ0P R P R P@@00 k@@@@4Q0P, $00 , @$0EQ*[ P.  lR BR  LR  Q 0$0U$0sR $0$0 P0 400.0 pXЍ 0 Fp P( V 5n @@ LQPP 00 @  PpH lQ ZQ hQ Q tQ    Q| | 6aw9wp3w@-@P8TD -@- 00 ЍЍ/0 -@-   Ѝ Ѝ/@-M 0@P  /ߍ-@- ЍЍ/0A-@0 0 0 0 0 0 0<003/P&p@@ Eww@-@?P>000` PLIP  LIP0<00SHq 0 0 0 0 0 0Hq H</ 00 0 0 0 00&  0 0 0 0 0  P - ) & k Ѝ3/ 0 0 0 0 0  H((Aw;wzwwf3ww̯w㯅wws@-`PR 'C@P >U 0p.Ѝp W@-0@S@'RDZD0Sp@-@P PU  'C,`P '[DPP@pӆw@-@P@@D0? 0Pӆw@-@0S0@-`0 P{P Pp'uBP0@ @ ЍU*P pQ?P ,@0,@D, 0RHP 0SH0Wf3w@-P=@-0PD0>00@-yP vHA-{@{P 0T0P0S `P @[`P$@P@|pU D0 0<003/@P}>000@0@K9VP!w(w2wӅwӆwp@-.PPpe>@Pp0Sp0<003/0000p0P D00 @-O>@o/p@-P` @P P 0 <0p@0/pps@-PP@ P@ `0<0 03/@P+0<0 0S `V t Ѝp0<0 0S  3/T@A-'$C@TЍz`P- PP* @p尀0D0 T t0 HoV 0Shh0D0@ C0STY {&PӅw5w>w+7wHw@-<200@-pLM`P@P @P0<00L qP @$ (-0 (0@LЍw w@-@ ( M0Q   z Ѝww@-@ ( M0Q   z Ѝww@-@^@-(0 P$  [zPЍ^wQw@-P )w@-xHz@pEzP PT LPT@P!w(w2w@-@`#zPPTD@ 0S  0 P(wӆw`w2wp@-pP@0h`S 0S Ty@P <yP P p@ӆwӆw!w5w0 0 0 0 /wӆwӆwӆw 0 /dw/ @-0/|w @-0/w @-0/w @-0/xw@-eP  ?w@-T@0S H0H ?00@ ; 0 00@swKԆwӆwӆwp@- sy@PQ 0S m@0 pP P P -0000o 0@ R \0 d00S <0 P0P 'D0@0 <0< ]ԅwӆwdwfԅw2wjԅw\w`wXwӆwwӆwӆwӆwwP 00 0/wӆw0/ӆw@-@P<0@$0$ ?0C#30ӆwӆwӆwMb@-P00ӆwӆw@-2 Q2Q20S Ѝp@/ 2P0S2p0S?s 04?s0S0@4?s0 B\\$ S' S"Ѝp@ S@ BRPP 0\4?\s0@ B `PPQ P ЍpR`0dov`VV0 @R0SP   ,1 0SS00    0 4?S0S 0S0S0SЍp@ Ѝp@`S0pP`FV:04@ 8?Ps0q5/twpwhwswsw|w@ԅwӆw00?P ?PP//swp@-0P@?T`OOt@ T dP?T@/Tr0R$ 0 p~ O@TD @0 pswwp@-P @2 `. 04S/r0R$0 pqQ 0ą ą0ĕ ĕpw@- E @ ?0S400 00 ?0S40@0000     P Ѝlw@- @` p0  t@ X 0P s0@?/O0 S4R$@TD0 @ Ѝ|wM-耟pW0  Ar PPP`+`M, @R(0 0 0t (0@P@P0`L0PH0D0@<0ЍӆwOӅw:ԅwӆwӆw ӆwӆwӆw@-  ЍQ 0"S B BQR0"SS00/0:@- PUwP@-P( wwwd w( w w0@S00%  ! B  00S 00S  0P2p P dt\00SPDq"84k"X,wUӅw|wӅw^wwӅwxwxӅwӅwӅw@-vP t2PP\ @DwP @0 P ,: 0 @  ӅwӅwӅwdw1ӅwP @2M- p 020b00 @ppPPWЍ001T w( w( w w w w( w( w wQ`P12v"0P 1P yt!A `1 ; H1 H 0R ! @ ! P0 02/0S0S S% S0pP PPtP: R xpul0lu @D0 PJ$?P,wӆwdw\wXwPwӆwӆwӆwԅw|wӆwԅww8BwwA-|`P@:PpP V P ,P  '0@0DUw@- "<0R80R4 r D Ѝƅw0P 000C S@-pp/p/ @-0/sw @-0/sw@-M@ x 0 3?R:{ 0 0H0T 0T00 3?0ݍ0 3?$www@-M  h 0 3?R:{ 000@  (0(  ݍ$w(ww@-M  \ 0 3?R:{ 00@(0  @Aݍ$w(ww@-M @ i 0 3?R%:.0  000S00 7T O R 0ST 000ݍD @  002/@R@ #  {$wswwԅw1مww@-MM P # 0 3?R6:7 0 0 0. R000!1D4O0S0p0|P/S p T` 00  ݍЍ 0{$wswwϋw@-@60@0S80 S/Rp@-M-` @!0 3?R@3:{@0S Aݍp 0R+S0S(PP(# 00`@d4O 0-S000!D14O 0S 0 Ph0 UPS@4O@d@Q4Q$wtwsw8BwPwՅwp@- @M M0 ̌T S Q  Lx0P` CX0To  0TD0D0 @0@P04ݍЍp$wswӆwwwwwwA-M `{403000/@0 00000 0$ P P   * ?(p UPP00C  C1ڍ襆p@-M P403000 00000 0l00 \$D@@D DD1gڍp4`(@ 2?$000@swwwE-MM P4@030 @`@`@@@ @01 $DHpL@P00C \C12ڍЍH(@ 2?,$000 `p0 `swwwM-MM403 00H!0 00 0$00(00P@00p`! $jZL T   :0 0?H  YW` `00CC1ڍЍ2 t(,0FZP T000: 00/L  5W``00C C1swwp00s/d00S/0-MM0 00000 0 0ڍЍw(w-41DM00CSwlwwwww w1!00 0 $000 0 $!0 uDЍ0 00 0 0$00 0 0$00 0h0DЍDЍL0DЍ7<080DЍDЍwswww wtwp@-0 Qp! RpA00CSrwwww4www |p0p07 |pp0|ppp0d0|ppp0@A <8100p|ppp p10S 00Y00 00 +0 p@M)|ppp Pn0`i0`0@r|pPp}U\ 0000S0U $0 pwwԅwdwԅwwԅwswtw wԅwwww@-D@00S00h@T$d}0 @wօw/օww A-1Q 10A+0Plq  d"<0R80R4r @44a00@?& "0S 0 R 00# @ Q  0}WI 00 /x0  iЍAwwxwww|wՅw"ՅwwNՅw_ՅwwwՅwLwՅwՅwօw8BwՅww<wwwww@- 0 dw@-P@ 0 + p@ @p`0 IP 0P?0S40PPPP?T0``H0Pp40 Ѝ@,wNՅwwӆwӆw:ԅw|w0w ӆwӆwӆwM-0@S S Ѝ '0 0R 0 Ȱ0S +Pp  P PPP`     PH PPPPP` ЍM_,wdw|w@-1apt 0 BPRr"w#w#w#w#w#w"w$$w,@ )@1!0@2x"#p\1@p0 H0@S 410S p@D@ 1 ! 0 T 0  Ѝ+ 0@0?0, <0@, <0z@, ;p0p@@ӆww8we4wAwtwMbb݅wtwk4wtwy4wwwwwdww4w4w4wE-$( R+t@ R BPQ Z`J Q   Q  QVLTpqPQ ,D0\ =$0 00 $0 Ѝ PDd H#L䃟0@0V3 3 ЍE E P #p00# R*G00t P \3p08"Q H600< P2PqR "" "Q00"00"0"  ЍE BRQ oP t"\0 00`"82080 T2 820hF $Q(# 0$0 2q 2 1`J50 @ 0 # 3 0R  11QR S:xA b0Z0V*XQoP 4}? !0!00   0 x@0 RM\ 0 00 /r z0?s00CSdwwwwwwwMb3wtwtw3wAwtw3w4wwww3w3w4ww*w twtwww4wdwՅwPww4!wԅw8wօwuw<4wT4w@-\ 000P SDD>@18A404,00S@wtw5w6w/օwtw*wwE-LLC0HS00M0nP nP 3xnPR Q*?0hnPb tQ00u R0p0p2prpB0 0PPT L"<0R80<R4r ,   1!0S 1 R 00#  AQ ! Ah P  d1d \ЍEpL1D1D<81p,1 $1$ E @ 1 1@s00 @0p0@Ӻ,0 ЍE4wtw4w4wtw4wtw4w!5w tw55wh5wxww8w|w Յww"ՅwNՅw5w5wwwՅwLw5wՅwօw8Bwdw3w4www5wՅwwwtw*w$wwwwwwwwtw Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-@-를R1=C.)D![NYd9ir;5<̬t@).'F%6L% كw`փw҃w,݃wՃw`σw݃wփwӃw,փw8كw܃wՃwσwnW ?m9ir;nW ?m9ir;aʓ +8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b@XAXP]`FC=݋#1--'?MAx(@A w wwww&w-w4w;wBwIwQwYwawiwqwywwwwwwwwwwwwwwwww(w(w -w-w-ww6w/wЅwL^wQ^w`^w(w*(w=(wM(wW(wc(wm(w(wwwwwwwwwwwwwwwwwwwwww wwwww!wwwwww&w)wwwwwwwwwwwwwwww,w0w4ww'!w>w0!w ww' wwww w<  *w w  wW w < +w  +~誂wXw|w@www@ԁwӁwDӁw|GwwDwlHwHw4IwFww(", *$.)#-!+%/ϋw~wwwp0wp0wfwtewewdwʃw\Ƀw˃wt˃wH˃w˃wʃwʃwʃwlʃw wwwLwwwwPwww\wTwtw8ww8w;w>w:w9w:w:w9w ;w:w6w;wAwAw Iw PwVww]w w gw nwvw kwwwwwwwww2x0x0w !ȰwPwtwHwܫwwFw wFwwGwwGwwGw wpHw w Iw6w FwRw1wLXwVwRw*w`ppp@@@@@@@@@;Zx0Nw.w)w]w1w^w1w^w1w^w1w^w1w^w1wLTw1w`Tw1w*w*w0*wF*w]*wo*w*w*w*w*w*w*w*w w wD݅w w  w  w  w  w  w w@mw!w!w!ww!w wD݅w w w w w w w w w w w wօwB)wA)w5)w))w4)wf)w;)w@)wF)wO)wZ)we)wj)wu)w)w)w)w)w)w)w)w)w)w)w)w)w܅ww w 'w 2w =w Ew˅wQw? wmww w w w w  wwww w 0w Lw hw ww wwwwwwwww ?w ?www w w  w Tw ew wrw wwwKwww w  w w w ww ww5wCw 6w @w [w uw www w @ @`00>wcAw,Aww @w/w>w)/wBw2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys !"# $$%(&*,'0(48)<@*H+P,X `-h p./ 0123 @4567@89:;<=>?    #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentu-boot*EHCI Host Controller  * +,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banks%s:%u: %s: Assertion `%s' failed.do_bootvx_fdtusb_setup_descriptordev_get_parent_privdevm_kfreedevice_removei2c_init_transferfec_alloc_descsphy_device_createpmic_allocpmic_reg_read_ehci_create_int_queuefs_devreadefi_free_poolefi_runtime_relocatedev_get_uclass_privdevres_addwait_for_sr_statefecmxc_recvpmic_dialog_initpmic_initpmic_reg_writeefi_free_pagesdev_get_privdevres_freei2c_imx_stopdev_get_uclass_platdev_get_parent_platfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue #gpio-cellsalloc space exhausted DRAM: arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Waiting for Ethernet connection... done. unable to connect. Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) DIALOG_PMICimx53-qsb.dtbfdt_fileWriting to BUCKCORE_REG failed: %d Writing to SUPPLY_REG failed: %d Writing to BUCKPRO_REG failed: %d FSL_PMICimx53-qsrb.dtbWriting to REG_SW_0 failed: %d Writing to REG_SW_1 failed: %d Writing to REG_POWER_CTL2 failed: %d Writing to REG_MODE_0 failed: %d Writing to SWBST_CTRL failed: %d CPU: Switch CPU clock to 1GHZ failed CPU: Switch DDR clock to 400MHz failed ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image size## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': Scanning global bootmeth '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Automatic boot of image at addr 0x%08lX ... bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] Targeted peripheral clock should bewithin [%d - %d] CACHE: Misaligned operation at range [%08lx, %08lx] = %d is invalid. Should be less than %d %s: %s: error: gpio %s%d not reserved Board: MX53 LOCO bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...%.*sbootcmd=mmc dev ${mmcdev}; if mmc rescan; then if run loadbootscript; then run bootscript; else if run loadimage; then run mmcboot; else run netboot; fi; fi; else run netboot; fibootdelay=2baudrate=115200ethprime=FEC0loadaddr=0x72000000mtdids=mtdparts=script=boot.scrimage=zImagefdt_addr=0x71000000boot_fdt=tryip_dyn=yesmmcdev=0mmcpart=1mmcroot=/dev/mmcblk0p2 rw rootwaitmmcargs=setenv bootargs console=ttymxc0,${baudrate} root=${mmcroot}loadbootscript=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${script};bootscript=echo Running bootscript from mmc ...; sourceloadimage=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${image}loadfdt=load mmc ${mmcdev}:${mmcpart} ${fdt_addr} ${fdt_file}mmcboot=echo Booting from mmc ...; run mmcargs; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if run loadfdt; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo WARN: Cannot load the DT; fi; fi; else bootz; fi;netargs=setenv bootargs console=ttymxc0,${baudrate} root=/dev/nfs ip=dhcp nfsroot=${serverip}:${nfsroot},v3,tcpnetboot=echo Booting from net ...; run netargs; if test ${ip_dyn} = yes; then setenv get_cmd dhcp; else setenv get_cmd tftp; fi; ${get_cmd} ${image}; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if ${get_cmd} ${fdt_addr} ${fdt_file}; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo ERROR: Cannot load the DT; exit; fi; fi; else bootz; fi;%s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone !rclist_empty(&dr->entry)U-Boot.armv7bootp_archpxeuuidInvalid pxeuuid: %s bootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list error: overflow occurs , Build: %sbootefi %lx %lxefi/boot/bootarm.efiextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sDriver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p Class Index Probed Driver Name ----------------------------------------------------------- uclass %d: %s %-3i %c %s @ %08lx, seq %dset_dir_flagsget_valueset_valueVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmdError: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Trying to execute a command out of order ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... List of available devices: %-8s %08x %c%c data abort -n## Resetting to default environment edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems%c %s: ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? crc32FDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available PLL1 %8d MHz PLL2 %8d MHz PLL3 %8d MHz PLL4 %8d MHz AHB %8d kHz IPG %8d kHz IPG PERCLK %8d kHz DDR %8d kHz activeeth%d : %s %pM %s not used ping failed; host %s is not alive host %s is alive PMIC devices: name: %s bus: %s_%d PMIC: %s PMIC: Registers dump failed 0x%02x: PMIC: Register read failed 0x%02x: 0x%08x bat%s is not a battery statechargeBAT: %s charging (ctrl+c to break) prefetch abort The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... %llu bytes written in %lu ms ** Abort software interrupt ## Executing script at %08lx undefined instruction starting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)%2u %2u-%2u = %5u %sefiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed NetMemEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol ERROR: Out of memory UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition %x:%xCannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout EHCI fail timeout STS_ASS reset EHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) dr_modeperipheralvbus-supplyError enabling VBUS supply RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}${.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... !read failedWriting to %sMMC(%d)... %s=%s ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdevDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. ** Unable to read file %s ** UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2+deb12u1u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s fsl,esdhcclock-frequency/aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p FECFEC%imdio_alloc failed mdio_register failed Can't find FEC0 clk rate: %d Read MDIO failed... Write MDIO failed... WAIT for MII Gasket ready timed out Could not initialize PHY %s phy-supplyphy-reset-gpiosphy-reset-durationFEC MXC: phy reset duration should be <= 1000ms phy-reset-post-delayFEC MXC: phy reset post delay should be <= 1000ms %s: error allocating rxbuf %d %s: Error enabling phy supply FEC MXC: Timeout resetting chip Unsupported interface type %d defaulting to MII100 %s: error allocating packetp some error: 0x%08lx Payload (%d) too large No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer => ///./..MMC Device %d not found ERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseJump offset is too bigError: writing directory entry outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to write file %s ** fsl,tuning-stepfsl,tuning-start-tapfsl,strobe-dll-delay-targetfsl,signal-voltage-switch-extra-delay-msfsl,wp-controllercd-gpioswp-gpios%s %s: fail to enable vqmmc-supply %s %s: Unable to get clk for %s MMC/SD: Reset never completed. FSL_SDHC%s %s: fsl_esdhc_init failure Cannot write to locked SD card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Cannot find console unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %uBase path too long (%s%s) Retrieving file: %s statesenable-gpios%s.%s%dError: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### CRC32 for %08lx ... %08lx ==> %08lx 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! Error, wrong i2c adapter %d max %d possible %s:trigger stop failed %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx +,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: fdt fixup event failed: %d - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command %s %s: wrong pinctrl info fsl,mux_maskfsl,input-sel%s %s: iomuxc fsl,input-sel property not found fsl,pins%s %s: No fsl,pins property in node %s %s %s: Invalid fsl,pins property in node %s %s %s: Error reading pin data. %s %s: Error mux_reg or conf_reg unknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateI2C: No MMC card foundNo block deviceMMC partition switch failedMMC partition switch failed load-environmentMMC: Net: %s=%s%d.%d.%d.%d./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes prebootNo CLI availableunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x setting autoneg failed failed to set multicast hash failed to set configuration RX: failed to receive RX: got too many bytes (%d) %s: %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: %s not found PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc_blkmmc_bootdevMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd mmc write failed u-boot,mmc-env-partitionu-boot,mmc-env-offsetvmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modebus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! udevice *)(NULLcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vStatus Error: 0x%08x Timeout waiting card ready Error enabling VMMC supply : %d MMC: no card present %08lx: %08x %0lx %04x %02x ? #(-27:"/\|?*/configfixed-linku-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-type## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdinstdoutstderreth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,Expected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02xWhole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type hdusbdmmcsdxx%s%c%dCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: could not find pctldev %s: No available memory for allocation! %s: POWER allocation error! %s: invalid tx_num: %dPORCSUIPP USERWDOGJTAG HIGH-ZJTAG SWWDOG3TEMPSENSEWARM BOOTunknown resetCPU: Freescale i.MX%s rev%d.%d at %d MHz Reset cause: %s fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%seMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%sError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 pre-reloc realloc() is not supported^%s$Error compiling regex: %s enable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator-nameregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command Error get-and-setting cluster Error: no space left: %llu %s: readonly variable%.*s.%.3s~%dWorking FDT set to %lx fdtaddrmodelModel: %s %-10.10s %3d [ %c ] %-20.20s | `-- |-- (effective reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Unknown01/01/2023skufamilyproductUnknown Productasset-tagmanufacturerError: SMSC95xx: No MAC address set - set usbethaddr In: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_3251536SL6DL6SX6Q6UL6ULL6SOLO6SLL6DP6QP6D6ULZ7S7D8MQ8MD8MQLite8MMQ8MMQL8MMD8MMDL8MMS8MMSL8MNano Quad8MNano Dual8MNano Solo8MNano QuadLite8MNano DualLite8MNano SoloLite8MNano UltraLite Quad8MNano UltraLite Dual8MNano UltraLite Solo8MP[8]8MP[6]8MP Lite[4]8MP Dual[3]8MP UltraLitedisplay clocksmenutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-stdbootmeth_distrou-boot,distro-syslinuxbootmeth_efiu-boot,distro-efiPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowssourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryconinfoprint console devices and informationdmDriver model low level accesscompatdevresdriversstaticuclassecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structprotectenable or disable FLASH write protectionon start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writableeraseerase FLASH memorystart end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banksflinfoprint FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # NfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wplisthwpartitionsetdsrNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoltruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagerunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSscsisatanvmeefiloadervirtiopvblock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiinputoutputunusedunknownfuncgpio_mxcfsl,imx35-gpiomxc2mxc1mxc0MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcfsl_esdhcfsl,imx51-esdhcfsl,imx53-esdhcfsl,imx6ul-usdhcfsl,imx6sx-usdhcfsl,imx6sl-usdhcfsl,imx6q-usdhcfsl,imx7d-usdhcfsl,imx7ulp-usdhcfsl,imx8qm-usdhcfsl,imx8mm-usdhcfsl,imx8mn-usdhcfsl,imx8mp-usdhcfsl,imx8mq-usdhcfsl,imxrt-usdhcfecmxcfsl,imx28-fecfsl,imx6q-fecfsl,imx6sl-fecfsl,imx6sx-fecfsl,imx6ul-fecfsl,imx53-fecfsl,imx7d-fecfsl,mvf600-fecfsl,imx93-fecGeneric PHYSMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700Fixed PHYimx5-pinctrlfsl,imx53-iomuxcfsl,imx53-iomuxc-gprregulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedgpio regulatorregulator-gpioI2CSPI|+|-|pmiclist - list available PMICs pmic name dump - dump named PMIC registers pmic name read - read register pmic name write - write register pmic name bat state - write register pmic name bat charge - write register asix_ethmcs7830_ethsmsc95xx_ethusb_dev_genericu-boot,bootdev-usbehci_mx5fsl,imx53-usbfatext4unsupportedEFI block driver1.5baseboardchassisFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlansyntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed HUSH_VERSION0.01( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Rx: failed to receive: %d Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found lun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx U-Boot 2023.01+dfsg-2+deb12u1 (Apr 18 2024 - 22:00:21 +0000)%s: Arbitration lost sr=%x cr=%x state=%x %s: failed sr=%x cr=%x state=%x smbios_SM__DMI_ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d @Sc@cccrL{w|w8|wpxwT{wd}wl}wpxw}w[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS܀w乁wօwօwQw乁wօwօwGw乁wօwօw kw乁w օwօwXw乁w@օwօw`w乁wօwօwdw乁wօwօwiw乁wօwօwzw乁wօwօww乁wwօwօwscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be presentWww4wօwօw\ww̒wօwօw[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead w乁wwօwօww乁wwօwօww乁wxwօwօww乁whwօwօw|w乁wXwօwօw%w乁wHwօwօwcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree Dump tree of driver model devices ('*' = activated) dm uclass Dump list of instances for each uclass /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@wwwօwօwew乁wwօwօw8wwwօwօw1wwwօwօwwwwօwօww乁wPwօwօwa!w乁w\wօwօwFowwwօwօw;w乁wwօwօw@wwwօwօwLwwwօwօw;wwwօwօwaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] Aww(wօwօw&ww wօwօw&wwwօwօw&ww@wօwօw&wwh wօwօw&w乁w wօwօw$w乁wxwօwօwwwh wօwօwŅwwwօwօw&wwwօwօw1w'w8'w'w w'w'w 'w ԅw 'w 'w >w>ww0@w?wH@w?w>w`@wP@w?w9wwx@wX@wPw䝂wp@w`?w@@wh@w w@?w>w>wlwwwDw89w>w>wtZwtZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZwZw[w[w[w[w[w[w[w[w [w [w([w([w0[w0[w8[w8[w@[w@[wH[wH[wP[wP[wX[wX[w`[w`[wh[wh[wp[wp[wx[wx[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w[w\w\w\w\w\w\w\w\w \w \w(\w(\w0\w0\w8\w8\w@\w@\wH\wH\wP\wP\wX\wX\w`\w`\wh\wh\wp\wp\wx\wx\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w\w]w]w]w]w]w]w]w]w ]w ]w(]w(]w0]w0]w8]w8]w@]w@]wH]wH]wP]wP]wX]wX]w`]w`]wh]wh]wp]wp]wx]wx]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w]w^w^w^w^w^w^w^w^w ^w ^w(^w(^w0^w0^w8^w8^w@^w@^wH^wH^wP^wP^wX^wX^w`^w`^wh^wh^wp^wp^wx^wx^w^w^w ؅w؅w؅w ^w^w(wc@cS0Vwh hh_w_w,ww}wXvw,w0 ~w}wXvw,w  ~w}wXvw,w ~w}wXvw,w ~w}wXvw,w ~wpwXvw,w ~wpwXvw,wZZw`w$wXwawawmxc_serialؠwXw؟wwww@Ƃwlׂw<ׂwςwςwȂw$̂wƂwǂw)  @ @  w.w?w<w@MwMwRwWw$Tw(TwRwPSwTwnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@w Qw w乁wxȀwwww乁wwwօwwwdwww:w乁wdw wօww乁wdw wօwfwwęwnwGwwwwww]ww$wfw Gwxwƅw乁wPw.wdBwy w乁wpw wwwwwwww乁wdwwHw/w乁w.w'wօww乁wʀwwww乁w`wwօw w乁w(πww%wkw乁wȀwww w乁ww wwww$ww|Kwwsw乁w(w,wAwY&wwwa&w{&wdw&w乁w| w&wUwww춀wwwiw乁w̢wnwօwuww0w~wwKw乁wHwVw|wzwwwwwOw乁wwVw|www袀www w乁ww ww乁wwwwwwxwwwzw乁wwVwwRw乁wdw[wnww乁wLwwwGww`www.ww4w7wXw kwwئwOwMww乁wԶww4ww乁wlwwww乁wpwwօwzw乁w䆀w}www乁w쉀wwww乁w@ww1wa$w乁wXwj$wUw6 wwܹw< wa wvw乁wTwywwyww w\ w ws ww迀wy w w www w wtww迀wC w w ww迀w w w w乁wɀw w ww乁www乁w΀www +w乁w@߀ww#wwwwwwJw乁wL΀wMwaw-w乁wLwSwbww乁wwwww乁w0΀wwww乁w4w w(ww乁w|www-w乁wؖwfhw-w%w乁w w%w%wdwwwܶwwww乁w쉀wnwօw, wwȀw3 wS w܅ww!ww1w$w乁wxw$w$wdwww$www&wwh w&wօwLwww$w%wdw%'w乁ww-'wM'w倅wwwww[w乁whހwawwqwwwxw2Gw7 w乁ww w !wF w乁w|wO ww w乁ww w.w乁wwf!wu!w7!w乁ww?!wT!wUw乁wLw2wօw.w'|w$p:wمwM:ww`;w|ww^w cw<\w8>w)w.Cw w!w!w?w-w\,?w4w0w.w'w,JwB;wPOwƂwbw;wu'wv`Ow 'w>pOwt~w8.wtCwPwwwbw 2;wOwAƅwTw6ww9w0w\wHwKwwDžwwDžwwwdcwDžwwj3wwDžw0wk3wHwt݅wdwDw-w*w*wt*w'w *w-w*w*wt*w'w*w-w*w*wt*w'w)w(wځw<݁wׁw=ͅwtށwBowhwnw w~www%`wcw(w'ww(ww)w.www +wC(wGͅwMۅwSԅw -wTĆw-w\Xww8(w(wd8w .wtwXwłw@ $.wu'wvwkwłwD@ $'w>}w89wwAw wIw샆wl?w0wAwwwwwwwwwwwwwwwPwpwwwwwwXw|wwww w w w w w w$w(w,w0w4w8ww8w<w@wDwxw|wwwwwwwwwwwwTwXw\w`wdwwwwTwXwwwwww ww\wxw w w w w w w w$ w( w, w0 w4 w8 w< w@ wD w| w w w$!w\!w!w!w!w8"w$w$w$w%w%w%w%w&w&w&w &w&w&w&w&w@'w)w*w*w*w8+w+w+w,wP,wl,w,w,w,w,wl-wp-w-w$.w.wd/wl/wp/wt/wx/w|/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w/w`0w0w0w0w0w0w5w5w5w5w5w5w8w49w;w;w;w;w;w;w;w;w;w;w;w;w;w;w;w;w8=w<=w@=wD=wH=wL=w(Dw,Dw0Dw4Dw8Dww|>w>w0?w4?w8?ww>w?w?w?w?w?w?w?wxEw|EwJwJwJw(Mw,Mw0Mw4Mw8Mww>w?w@w@w@wAwAwAw Aw$Aw(Aw|BwBwBwBwBwBwBwBwBwCwDwDwDwDw$Hw`MwdMwhMw`RwdRwhRwlRwSwSw$Xw(Xw,Xw0Xw4Xw8XwwL>wT>w\>wd>wl>wt>wx>w|>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w>w ?w?w?w?w?w,?w"okaydefaultmma8450@1c !fsl,mma8450dialog@48!dlg,da9053-aadlg,da9052Hdu regulatorsbuck1 x(buck2 x(buck3H&%(buck4H&%(ldo1 'w@<(ldo2 'w@(ldo3RH2Z(ldo4RH2Z(ldo5O6(ldo6O6(ldo7)0)0?"ldo8O6(ldo96(ldo10O6(ssi@63fcc000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u0 ipgbaud rxtx! disabledaudmux@63fd0000"!fsl,imx53-audmuxfsl,imx31-audmuxc@okaydefaultnand@63fdb000!fsl,imx53-nandcu< disabledssi@63fe8000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u`2 ipgbaud ./rxtx! disabledethernet@63fec000!fsl,imx53-fecfsl,imx25-fecc@uW*** ipgahbptpokaydefaultNrmii Wtve@63ff0000!fsl,imx53-tvecu\Et tvedi_selokaydefault g!svga"portendpoint#? vpu@63ff4000!fsl,imx53-vpucnm,coda7541c@u @?perahb$okaycrypto@63ff8000!fsl,imx53-saharac@uipgahbsram@f8000000 !mmio-sram?$memory@70000000memoryp disp0!fsl,imx-parallel-displaydefault% disabledport@0endpoint&?port@1endpoint'?+gpio-keys !gpio-keyspower Power Button (tvolume-up Volume Up )svolume-down Volume Down )rleds !gpio-ledsdefault*user Heartbeat  heartbeatpanel !sii,43wvf1gportendpoint+?'regulators !simple-busregulator@0!regulator-fixed3P2V00(?regulator@1!regulator-fixed usb_vbusLK@LK@ ?sound.!fsl,imx53-qsb-sgtl5000fsl,imx-audio-sgtl5000imx53-qsb-sgtl5000,-8#MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUT1> #address-cells#size-cellsmodelcompatiblestdout-pathethernet0gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2device_typeregclocksclock-latencyvoltage-toleranceoperating-pointsportsinterrupt-controller#interrupt-cellsphandle#clock-cellsclock-frequencyinterrupt-parentinterruptsclock-names#phy-cellsstatusrangesresetsremote-endpointreg-namesinterrupt-namesbus-widthpinctrl-namespinctrl-0cd-gpiosdmasdma-names#sound-dai-cellsfsl,fifo-depthwp-gpiosfsl,usbmiscfsl,usbphydr_modevbus-supplyphy_type#index-cellsgpio-controller#gpio-cellsfsl,pinsgpr#pwm-cells#reset-cells#dma-cellsfsl,sdma-ram-script-nameVDDA-supplyVDDIO-supplyregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onphy-modephy-reset-gpiosddc-i2c-busfsl,tve-modefsl,hsync-pinfsl,vsync-pindac-supplyiramlabellinux,codewakeup-sourcelinux,default-triggerregulator-namegpioenable-active-highssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-port