eGON.BT0#`SPL,sun8i-r40-bananapi-m2-ultraᆳ1  P 1)  !/0@0   P!:0@"  Р`K N" I+((_" I O0GGCF+     HP  G" Ii_" Ii GG8 FD B8,F (4 F8KhB `pGN?2}!6 !7 !7 /!HE@ɹ_Os",_AA_,pG96 (A  #OsAnCf"C"""n"fOsZjBBZbXj_Zj "BZbpGFFFft$t;h_3@BYBHH0$P%0@#@C@%00$$F FA LC )HpF`ۿt*L!Ci@#@CCa$$F FA LC )HpF`ۿt*L!i@#@Ca$$F FA LC )HpF`ۿt*K($C($$C$pGK$"$($"($pGKh "` pGN" FF4 ]"F 4 ]7 F FX04C(F07 F FP0#B#(F0pG_OsOrenB2f"B2"pGKFB)KB)$&_OuKH+e!FpCF8FZC<S#C>CCC_ +`z_K+e$&$&F D-6n%KD$"BB'BD$D$BBD$D$"BD$_AsOtH 3_Kbj_տ_OFSce_K\1bkKCcc2Cs2#nCs#f0CC0QX᱿_OsJ"OAB K[ ;|SC_Ordl_[pGO@B^Osj_#0KXCpGOs<_CJ2R/KFOR! D pG .2Cr Dv_OsO2,_" ,pGF#OtXC<_C(,_CB*[DF!OzppG_# `_K PO h_X_XBXApGUUCyx+2LO:"CxB2C:##_< ;O<;)3y;9B"CB#_J`x+JShCS`Dz\B\ACxÈ:##_< ;O<;)3;B#z#C:CC_JS`x+C OspOsS FFF #+px D)F@eر#0Fpu#+p )F@VOS0F#eOp_ px3۲x3۲)F=( @Ot"Io\1 #C\10#C0#n#C#f2#C2#j#C#bl#Cd@0Ozp#C06!Hb0"#D#CO10H2 CC2#nCC#f0CC0\1CC\10CC0_LMOp`FAp_@$`_O30_#0_K#a_Kca_Ka_Ka_I!b_Kcb_Jb_Kb_K#c_Kcc_Kc_Kc_K#d_Kcd_d_d_"e_ce_Ke_Ke_~K#f_0#cf_{Kf_Osf_!g_vKcg_uKg_tKg_sK0_qK01#C#?11#cCc1_hKd 8Q8#c#p#C8_#d 8?D#\K@D##@#D$@D$$@42C21C11#pC11#pcC@s10;_D4_4 $* OrO@r0 #pcCJ01#c14KF F,-p_E%_@[B 4, )K*H e/_C+Bѿ_OcL<3_@TG D0 , X `  l xd @ @    @o3223_<4_412 Cc1i@!KBC@1_@"#`FH#i_~o2"LFH0 CC0B0 #C09_K 1@1CC@1_O2|K 0+Nѿ_@#MH3_50#pcCs0#0kKH$_*տ_"D$_$  _@C"\LF#`ZHr#i_~o 3_$__@3 1 0LJC@s01 #S10CC0 0 D@!CBr!h_ #i_ 0#pcCs0#0,Ld 1#c11Cc11Cs1#i#S#a1#s1NOA 0s 0D@ A30 D@0C  0 D@D#;;000` _ApB*Kc_@"Zc_"c_"cArBѿ_"b_Je_Je_Jf_D Zf_Jf_?22fAtC1FbB Fo C Jg_ K0_ Ke_ KSe_ K00   e $eF8pG/٠P-M$XЀ Р  )/N РР;000 S PР 8 /OO1F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGpGH(LP0t H8#F" I}*0B*F!FHO08.H2H! !! @! $ F! F!= F!4, F$ F! F!) F!4P,!X !X !X  @ @BO08F@@C@L@AC@L@bC C@PC C@C@0 !C *!C %!C  @C !C E!C @OaC :CHMFGc<H < Q pGF  J0KXhkG"pGO0 D; DIB @BHW 2"F KJ!ݿ8(FF*F! F8-A S @B2 ,C@78<,<Цk #cC+F-2[B 20G 23B 2BcCBs Ӕ@IOzq@Fh#@080#30bJpG-AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FHKBFًB FP FFDB  F9DB xO3OzrF33"hF{Ozs!pFNcB%F(5F(Fdp H#FFFe砆Q  #0 h]By۲C +40"W"hDL` p#q0+F `Fy-MFFFF %)(FhGFFsxO -+ x660+;O0O * ! 30 ;0 *"l+;/`i+*q %+o+лFrc+fd+T+* +`-#RB 0p;ڲ*+R## i # T;;+hZ*`0"p#+qO 0J(FW-K OѯT;3 +`0# 0O OR(F9 Oє; *` 0T"+hp+hZ*`xO0O  һ?5)?0(FhG :AF(FhGʚ;K FFhF]RK]pGx0+ Cx J\D 3۲x+#0 ` h # `pG h+# `J Jò\D D 3۲9+Կ0WpGOppGJ F!F&F0xB.`Fx-,н@߿0@B pG! $"C ZC +Ksci_#pGt*sFxP+4%x@-b-4A#a# &4 " F#xsx[B -EpOv%O0 J KF KZCB H= H(,# qHO\O.K\OpF Fh"F)FG #bEaap-AF FFF*F!F3FG-AF FFF *F!F3FGKL LcCBpGO\O.-M$FFOD &FO % jH@EӰBFD *F4,ѿ_ P0F6npF_X#@5`&i_. :=h_.@p @pF F@7h_# 3i_B$CDtD ?3i_$CDt p@&&FF_h#``_`_H#`1F Fp@pF H HK@jFFF_'aD `1F FC_%`_g` F@f8 F@jbB!ҲFF`_H#X!(F`pFh_(FG F8 F@j!F -E F@jFFb!F|OH F OH c+(F, F/60_`_(!(F #7FF;_`_(!(F F-MF@jFF UFOF0!,OH F  ,FѸ!F(FҲ F8(F F 0_`_(!(F F!տ##X!P!CH_(F`F (F4Fh_;8?(F,Fh[h[hGFpG)-!!!!"E Eo9FFE F ##$E&E1P1@]hhFO0O0pGh[hhGFOzp" F FO`x F#0#FYhkh K@ @BCCC" Fc #p0#F F&l0" F>p+`p)Fr@ ѳ* ,ds9Ld!!&CBB@r"(F|Fh>FpOtOtoOzrhF[hbCi;!(FGF&iF(FF8Rod 0F{BomT!Z#0#3 ] -MFgVFF@h`F(Fz(JBq8H  Fo(ѣhZhi-D;F2F FGFFEwF8UFO 8F-{,""i$ AFo !"  F F`-{ !$! F (Hi*FYEBo g Z _F0F"LFL#0##Or# ]0KhXQB} }0 ?$?!F(ѕ 0BoI 0Bѕ 0Bѕ 0B"(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oFe-AhpJ?C|BF}À ?%?)F_(@X1+OpsXX(Or)F0+ZJR#ZK`B@0RBR^#C3BOPpPK("bB0r00`Z*#s0 n 0q.D o [0#00[0#F0 x,#,'J` #K`݀.CR3#1aEѕ06Օ0ѯ#"F FA#0iKF [CSR"#0p0 }X1+#X1o o?@F@@-EFF'_ q0"#!(FC F(? N1F(FF(F FF(ڣh[hh F@G Bh\iiB(!FB8FAbwpG-EEiFF-@#l1# F#webh[h[i+vO`Ih F[hhGF(@oTcg#d#b Fe*F)F F FF(k F#r0h FhJK@+ #Os#*F(0+BK`@77#"0# Fh(=)#0#hhhREOCC FO(+?JOzp FG(ck#xscccsa#Jhl0B2`%(F n) F& TF)! F6Fk+ 8FEzd 5#P1omHo^FaLhFhCSCCcHh[hh+! F @#Hcaoz#Q1L-MFస%(F`@FQ1+^%P1QQ+^#",0# F F(@6"\=#,0l0*F # F F(@h"+:0 Fl0 #,0# l0  uF(@ehOd&ebe@a9)9 FeF(ЎkPQ+ FO(F}F! FaF(@Ҁk+ 0FnzAd OC`ksa#l0sI`HA\HP#0'KC!igcg0CdqTq d@-3|CC=F"3@#5CC@ZC"5*D"2Oq"#g$#&#(#*#,#.#hkZ ", " F #O ,0l0" F 0 F(F# Fq0F(= F0z FmF(3hbI+7#H0l0F!c F1F`F3#3##O '?`1F FtF( #caHIBHI@HI>HI<@sCs2W+.CHOBKFU`H#khDCS#c=KdBV!0F::K-a:KOq3bO@bOS6Jsb6K105K6H05K g<#kC(FPF F@Zjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHXJ# xJDas U-BootpJpJRUNTSERVdPUIJAIJJJIJJNJOJNJJHJJJ1OJJJ#??OopGpGpGpG@pG@#???OopG8F F0?"3@SB#@BؿO)F F8@>?DpGpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF ,   ޿/F F@!D"v KxhFF`9"KiFpH#F"FDh EJJ/ПM P-ò+H@O0 @ P`6JpG1?H@O0Ch_C_`Ch_O20BD _@+J pGFx J K F1#6 F@}`JJxР};Р};BLРT P<,,0 SAA </0EJJJ _/_ РP/< /0Od@P TP  Q:< 80QR:/h11L# FklhF#/H#iF Fp F&pGpGF H'A03 F H?H F@JJJ pG8 H'$FFm I(F?I((F$?($ F8JKJJs0F[k` H F'H!@(*H@-KIt,FH@!O@wO`s#0{PThx+F!F0FDp0k*FGJJ QJhJJpFF(Fe0Fpo!F(F(FXO6F`I5((Hg@̽JJ0G%@$0C#&@CC'@CcLBLBHA )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFH@y (oboxJJF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk H HH{ HLv@ORH?JJJJJL H L :L pGOCiF8 >2FH0J3 `pG@JpG pGH?J-EF"OI1kkMH%l?G pF PkP kYEH?6j"kakCH?0#jbjjAH?*#i@Hciii?"#h=Hhchh?.N!n!OZ"z"_C#c#_ v V 0H?#l/J0HFF@F")M )K+FP<'H?&lk $H''%%o?||Ʊ,H#E?ɽ5 <9F@F?.$j9FPF?4,U$ ؒJfJfJfJgJ+gJ[gJgJbJJfJ QJgJgJgJgJhVJF,H?k F;c-k"JF,H?uk F;ck3JF,H?ak F;ckJF,H?Mk F;ck2JF,H?9k F;ck{JF,H?%k F;ckJF,H?k F;ckJD@ FFH?  ?JOB < R< <  < < pG+ё?(["+ёO ?+ёO$+ сOoOOOB@RBbA0 c`@0 k@ #lk[ RSB "#0(8FU+cёOJU F"O0o !HF0 #DD"4CB ,!+)J)K8тP?0CAB?/OU3?+/ё?C*(с?o+!ё?C+с_o8OP?0CA? /???_OPpOP  i +ёpGRIF5OH? F!F(F4FKNKO,m(FJI5 (FHI5!F(FFJ5&FDH>01F(F@KAJ5F('>K1F(F=J5F(:K1F(F9J5F(6K1F(F5J5F(2K1F(F1J5F(.H>N01F(F+K+J5yF()H>@01F(F&K&J5kF2F!F(F4"+9F 0>PH>$0!F(F KJ5O!F(F4*Fo)J)J)J)J)J8J)J)J)J^*J_*J`*Ja*J&*J?J**JGJ)J" I>h(ɲ_)9) " I>}X  ))H>r    JJJ(A  #OsAnCf"C"""n"fOsZjBBZbXj_Zj "BZbpGFH? ^\J!0$P%0@#@C@%00$$F FA LC )HpF`ۿt*P#_@pGL!Ci@#@CCaL!i@#@CaK($C($$C$pGK$"$($"($pGL h(U JI `JEJ/J FFH#h!EJFH# h!]EJOsj_#0KXCpGOs<_CJ2R/KFOR! D pG .2Cr Dv_OsO2,_" ,pGF#OtXC<_C(,_CB*[DF!OzppG8#F" I}>0B*F!FH?WO086J7J!𵓰 "F F(X+U "f0C@(N(O1F"F ? (F 4 ` #I > &(7#C 0 0R  0 & "F9F ? &(4, H&X! J ?H $6eJIeJAeJSeJ[eJ! g!! c@! ) F (, J0c1?p// KB? HiI! F} @6nJJ &COAO@L@@ OOB@ Cj@0uXBXA!(H ^!'H Z!&H V` (6#I H N B ЁiYi*##H #< Cjc @!KJ?H 'l ]H&( IH (IHJHJ)HJJ(J QJ5HJ>HJJ pGF Fe -EFF4MFF*F#9F0F0,H&0KB0BؓB$K:F;1F#PFoHB0BғB!FH> BB0DBB!FH#9F0F#J(H>EJJ@FJ&JJJJJF# F-MdF0 3C0բMOr!(FH&RF_#F9F=#0c/+"!>-^# 3-U# 3 O OFF((r~Hh@-7 3+)FxH> *hwKBvHOnM0+lrHO{(F,nH(F kH(F2hH>gH|i)eH>-Ы+ ++@0h0+ZK!(F"`@")FXF=6#K\{dRHhd#)F8F ( d;e xed@F((1AH000000 0@D000000++m/J! U(k0i+HZimli'HQimlt$HHiml/ H?iml:H6lDiml|(H'EJJJJ'V <JJ5<J@JM<J[J_J$FJEJ~JbJ0FJJJJJ,JCJkl+QЫi00+ 0 D0|rIc RkF(LH%aH%\񼀔5F(@ǀoÀ HF FH>+mC~Jiml({H{H{J)zK AԒ0++#RF F(@Fo 0p O0{9FFZF@F0 @ @F] F& oUH>9 SF DO8NH>*?1'?!?0  ѻE B BclC"0+4>H/=HRT#FRF GF(#FRFOpGF(#FObQFF M?d?.mJJJ0FJJJEJJ=J$JZJJ!JoFO,@1o8 AH>u  A H H>a#08 FJJJ-AFFܽDU F=7(h=#B'o ZlB@H!F>$G  Jo FFF#[lH%P!>-F #:F)F@ H!F>G H%F(0F=~ JJJ0oF"Zl 0 I(F>#h5F kF"a!kF"FX TJo-E FFFD[l "0+%O -+&FW(=0EED0F #:F)FF?@H!F>3FQF JGjF!PF+H%5K(FF 9J QJJ-MFLHFF%FpFO 0F==Bغ"BH>E#FZF(FMJF=) b,f*!@F>O GF2H>"oWcl+=0):(F(FFHl)F"J43H%Fб`=#D+F0FJIS( 4;IFH>  F H> F Hk J=JTJzJyJJJJJp FFF%0H%H p1F(F0GJpGpGFFFF+F1F:F FG0+дpO0 KS pGДJhx *pG3`hFBhH>g&DJ-AF xF/+ FF}{ñ#0(F=>F=:D*FH>Do# }Or!i=)F= H>/BF I> FehG( ;`6J6JTJsFF FF%?h!>( 3F)F FpooF@hKhH iE`iBi?i< j9`j6 F@1-Eh FF9FFHF;3 *\ԚBѪp `P! HB"h#U#c`Sz\ 2Ҳp1瓽J-A F!hF a`F ) )#)#Fkx )"3b`+` .# "*# "!F# "!F&OW6) h=0c`6Js" FiFFh( !h2FH>;op+`GVJF"iFFh, )h:F H>!o "!(F>0`(Fi FUJFH%9H"F!>(o oJ)FH>o?FH?k0 F0 0 I00> o,3JJL3J-M% F mK")FFE@")F$#? F:#b#k ckB|H%F`iP aObZvH a (F=y"F(F mh#ahmH>|i8FjJ c[(ahfHdH%-4!FbJ>,( #8F^Jh?(ah[HjZH%FYH% FXH%FWH%3F*FUI#>j QI<!2(#l0jei0-YOr54(F=F#<D<5Doai#=H)F<F#<F!jDlxHzI/.F j <F <D(F< PF< F6@FD< F < ^DDD0F FeH=A]JFF`K  1F#jZJ=]F#YFLJ8FF(F. #i3ahQH=%dj,?J@H%x!=&F2F(=FH%kEH=4)F=F#x + F@IHJCJJ QJ9HJ8JCJZJAJ8CJECJmCJCJPJCJCJCJDJF(" U-M FF(FFF( ZF)hH= F:F)F0F)FH=CF:F9F0F(Ml8J8J-MFF+@>!H=o8F'/a<:FF  +++)FQ "3"+FRD(F2FH= HF?D F(jD"!!( 2FH=a Fdoi<ac"d`"  +ǀR#<JW>JW>J)=JW>JW>JW>Js=Js=J=J=J;>JW>JW>JW>J>J>J->JW>JK>JW>JQ>J" p + +khc`h<0h`8o J2FUH= 3QIh<F(<0 a(1FJ?J?J;J?J[<Ji<J?J?J?J?J?J>J?<J>J?J?J?J>JUJUJVJsJVJF$hhl`/|<3"+FRD&"FH 'e'VJF}H FF<F F<8D"F I H=o# }I=2F(F6J6J6JpF%Fh@`h=UhB Fp@3<80F6hsF FF"!_caa#2F1F#F(F( F$ Fp-M$ FhCJ 3 @K#F*i(hSF(mЫF:H$\F"[_E'+,NF3H=H 0FVF0F],K (GliEDT<#<$h<S!I@F=ABFAF0F(0F M3ih1W8 <(F+FW8 < FDF?hFQF0F(0ih H=14 gfff}2J8J8J\J8J-AFFFF!"0g``#su(F<(F<* apo H%(FF8BF9F"H$ OKFO BE[EO bQF xBhтH$ 4  ,CjZМBb#400lbo pFKF*F!J< k; c$v1FF FAPc#b(F6po F QJP7JFkFB!yRF"##F0k$ZF((F F#BB #Ubucoo o-AFFF@FQFAF8F F$*hBAAF8F`"#1F F#$+`o zaCa 8qFhs`hp iB 88A[Kh(FĖJ7F FG(` F07( iB08-E0  mñ1F f-KLOK\CdB{h+ 5D7XJI( "QF@F;w O3RF9F#(мH/J:JH/JJJJ pGp FF"! jfk# J TRFop1F(VJsF FF!"Fh( 0Fkk*k F? HoooXJbJjJJ˿JFH0 F-@H('J'J-MFF F0NF F1aFUE! F8J1 F1R(F( )F F1)Fعs9FBFF0F:( 'H:F%H;<5 )F# FJ8 Fp)F F86H)FJ F81O (2 OCFRFYF0F:}( HZF;FH;)F F0JJJJJ-MhFFF+{h0F00>HP ;HP"@WF;FBF :F1FXF::.E1HgOR9FXF+:F0+H:F(?R?2!F"D&H;:F!F0F1(7"H k l dAEtXFB( F9FDOR:{(F?R;?21FHs`2D;w4F@p H ~JJJJJ=JJ[J-MO FFFF) F(Ucl+^Д"0+Z!hsH;8 ! h +MmH!F;* F0(ɀiHQFh;Уl:m+2XQF@FXQF@FF@F;q@F(%(uQH ll# FMI #mLFK(A0 BH; F?Hf F=H* F :H:HU+8H 7H@@F0z4H,'ih?BGE .H!F;4`ch+`BB'HAF8F:O1@F  F(yfcffH;\ch BH`JJ~JJJJ"J@JWJsJ[JJJJ7JJJJ pGFF FF ( BH;!O5AH;(F F (J=J=J=JyJ=J>JQ>J%>JFF0p$%F"DB * e9FH;tO0%FPK$ 4`,J-AO`#!FFF:9FPCEAF8F;0` 4,`-AO`:!FFF:FPCEAF8F;0` 4,`FJ0b `@ @B,J8 FIF1*F F8@0y8-JFJ0@0ò #p#O0 vJFJ0,0ò #p#O0JFJ00ò #p#O0GkJFJ0( p O0$kJFJ0 `o( ` kJFJR|JFJ:J7FFJ0(` "`0FO0,J#FJ0 h #`o,J#FJ0 h #`o-J#FJ0 h #`o-JFjFFFFhjF9F F`h0 D9F F D4`+`+F2F9F F@FJ0X `@ @B!-J7FFJ0G(` "`0FO0ZJ-EFF FF1F-HF;)F FF()HE;&H;CF)F%J F0CFF)F F"J0FQFH;H;H;#)F FJ0F :F1FH;)F FF:F1FH;,MB HH(F];4#0J40JeJI0J-JBJW0JhVJc0Jk0J0J-J0J-AF" FF0zFH:c IF8F:A8 K2F)F FAhH:RIF8F:0K0J0J0J0J#-EFFF0F!FrH;A/QqH;<1F(FSp8F!FFjH;-1F (FW3!FFdH;1F(FF!F_H;'YH; !F[H; VH;8/_#/&#1F(F0(F+ LH;KH;!FGH;kos;ADK@1F(F&F!F?H;@4H;1F (Fd!FF5H;+/и/(1F(F(!F+H;1F (F4!FF$H;K@ձH;?~1F(FF!FH;r H;nn H;ii+i"F1F(FbQ/J0Jd/Jz/J/J/J*DJ0J( /J/J/J/J0J-M!F FIH;5H;1I F00FIHM;!H;& F0F}O-+" FI0~J#)F F0;FrIzH:'1F F0FlN-++")F F02FF9F@F: :F)F FVF)F F0F+x")F F0:FF1F^H:)F F F1FYH:/fNH:)F# FUJ0F1FSH:/[FH:PJ#)F F0F>IMH:LJ#)F F0F8IIH:' #BF)F;F F0F(7FBJ)F F0F+I?H:nO#ZF)FCF F0FP)F F0(F+.WF)F F0FYH:H9FH:C1FG(H:=YFH:97%H1F #H:.9FH:*H+2F9F F9F2J1J0J-J1J*DJ 2J2J{jJ-2JM2JQ/JjJg2JmJz2JpJ2JJoJ2JsJ2J2J2JChDpGF FFF( 2F Fh)FhG Zh`O0-MFFF0F, p:N"!F(F0F@F9AFFPF9u!F(F{/N!F"(F0"F9F(F0"FF1F)H: & %HQF:!F(F#J0+ h[H:sH!F(F0kF!F(FP W#? [FRF0F.sNBNXF9( N N 0J0JC1J1JeJ1J1J1J 1Jo1J`1J%1J0F F"0#)F F`")F F0 IF H: 0l )F F>0J0J-A!IF0 0NIFH: &)FH:!F(F/FOX,+ +"!F(F01FF8F:!F(F6(@F:!F(F/qF-J1Jv,J,JhVJF 0XBXA F 0XBXA F 0XBXA 8F F/Qعclh(F$!F0FFF J(F0x(F I0N(o F8ooo),J-J FIF04 ]9F0FJ0{F8F#!(F9FpD`<F)F"%FT9F*F0F0F Fso 2J{jJ0F0\F0 F-MFFFF#M0O \Eo[FRFAF0FFF0F#(B  F,F F8 FlFFz #*F F(o8o-MFF hk+JR#H2FQF:O10FFhFQFH: F YF0Fc#F ,/QFH:x0F#ڒHoZF!F0F/fF H:a- !FH0RF#0FP"FF0F/NFRFYFH:G0!F0F~J |H!F0F (yHo wH!F0F/D0:F!F0F0}8"!F0Fw"!F0Fqع--"!F0Fi"F!F0FS(a"!F0FL(ZѸO?-H-F"!F0F;(?"!F0F4ȻO+-!F0FDwFh|F8F!FF*FEH:o1-"!F0F x"!F0FF@"!F0F-!F0FQQF2H$"!F0F("!F0F("!F0F(x+M!F0FH+DQFH:ro*+orh-2D*КB(ٱB&QFH:Yo栓J&-J.-JY-J-J|-J-J-J2J.J!.J[J0.JC.Je.J.J:FQFAH:1#0F!F 770X(eѝ70 +`-V-T-0#BF F :F+F @QF(H:og7F-8F/h HBBF9F0FH` +?@ +F`5BBF9F0FB9FBF0F7F-ѝ70+.J.J6/J.Jl FF I:FF(####9FF F vnJ-MF# F *hh/f9( o ABFF8F:0+=9F@F-Ih@F#o "(F'I9F($MAFU;9}XPFshGF( FF  CF!J:mX*I>(`Iw(F H:PyJJ)JJJJJJ)J6JHpGHpGHpGopG(opFF "!"FIl!Il"IlIl pIl 8IlFo0Fp Il Il96a(`JkJuJJJJJ7JK`#C` sJ-A}FF6!Fi: gCF$?vR*o }28)F!F(b8FiBihDo !+Z(F(oOr!F0F88FihhD* !+Z(F(bx *O0@@* :a1X#xBch 1ooopİFFcF`- C)F 0FJ9 FDpoJ8FF F8\Fر FI F! I" I H8 K I(F F8@o 8JJJJJJ-AİhFMh%N%O FD#h0Fh8F(69F(F/(@FIFYhFlF(F(F(hFKsJyJZJFFFG*pFFT!9FF H9e"Fq(FFH$9 FpO4JJ-E8FFFF 3Xh9xa:)*#)( "I`h,`hJ+  B H9XO0@!1F(F8 #KBF@sSFJEJ{J FH !F@\JFF"H9 F(($HH "hKBH   FDH FH FMHH H O1 FlH F F( H;J<J<J'V<J2<J@JJ<J[J[<Jo<J<J*FF Kh@&$!W$9)4(&B0FJsF F!&`KHhV9kF"1F FpJJ7ML#d FIFaCH0%JH/Jm۶%J*̿XhH9 QJ"iF 79cH H 3]_J~J-MFF FFF.FO6.qcI`h8F(@Fh91FFh91FF i9FAF:hVH9&PRF3F(F9hqQJRKFBFFPH9` !.LI2F`h8F(?Ѡh9{FF(F<`DH9"CI`h80(F ":I`h8X(F9h(AF7H9 "5I`h8O0(F(AF/H9,I"`h8F(Ѡh93FF(F("FAF$H9#I`h8oF(Fh91FFh91FF i9FAF:hH9PRF3F(F9hJKFBFFHhJJJgJJhJJmJqJnJJJ ~J0JbJ B!H*JpFFIF . jhx-*H9?O4 F p%`C)F?Ozu H9$$x=pIJJ-AF+ FFO0" Iph(ChbB-hKB)FF3A`G JxJFJ>J>J>J>JJ-J>J{jJ?J!?J!.J4?JF#* OC H95SIjF h`hF(`h9GJJ F"FH9/JF#H"9 ]?J@FH d,hB TH,HI#.#O!.!@8NOH  V+ZEPF9h8FE $hfJJJDJ`J pG B!H<JY < K   -AF+ FFO0" IphX(ChbB-hKB)FF3A`G <JxJ B!HB`J-E h/Z/M0L8?/U k7_i6PF< ##:JB Bz,F#hxHD? X( BDd" Cc€ 0#H8 8  ףp= ףJh77-AF+ FFO0" Iph(ChbB-hKB)FF3A`G `JxJ*sF+ F(H8 p"phF8"FFh8 Ozr K `jC H#  H8*FIH8 O0tJJeJJJ*FFIXh7HF$&FW&6 B P K-&JsU-;\h!x-)5axp)s)0ѕ/!0h80(=68H$cxp+!8JFH88 1F(FGF H$8+ Fp$$Kh8Y$J"JJ*FFlKhlH lHkH8 !!Xh8r.FeI`h7( :()F`H8!8\F]HF(_[HF(FhF7c F7FUHF *|RI8DQHFOI 8'MH{ (jJHt0hHI F8<FHiF( DI8~DCH^F( @I8sD?HSF( =I8hD)ЧBHzQ4X$ JJ:JdJJIJwJ@KJJJJ6J9J_JJ@GJJ}JJ"(F8*x?* 2`23R*)FH32x )Щ[**3MKx]*0x *24X$ B\Dx])?[8K2 CF$7E@F7*D4S/BD7hhxg+@̀#/2/њ0s+))i0h -0n+s+H/F!F0h-`!FF0h-q0Fn+/!hi8(FO5{BݓB 5n* ]E !F"0h-F@F!F0h-Hښ0s+@FiO;KH8 ZF!F0h-F FI(P*Nݚ0v+>/ "!i8F F)Fȹ-"h9I.&. F7?7D F7:0>DB!F'- +OBYF9F86%Ha+F$I8s+rF-wFHp+#l+@ЀO/6/4hQF0h-)0h,Z)F"F-9F"FQF H7O J@GJJJ QJJMJJ1J6J;J$-(!FH7(FqH7")F0h-EF pxK)FIH 74,ݙH+JJ]JsJ|JJJUJJJ*-AFFW I"Xh \@hCF:F1F(FFA`GO0JKh+H "o` DKJT;JFFF . 8FFH7b  Fhh7FF H7T)F8FF(FH7I,F JJJ0JH72 ]mJ7F F@+F"!F0@0hFFFFP.%F"hh7FH %O.ۮB ")F1 )F8F745- @ O6 QJgJ* T0lH7$O1Xh!7CFF H7!F2 F@FH7  K`lJJJDKJFBhlH7clաlH7H7 F4 LthChhRh F7*eJeJhVJeJ*2 Vh,<,3B  Fj!Xh7FF2 \F(!FH7O J*sFF(!Xh7F0FIH73$. Fh7FFH FH7 FpO42J:JJ*sFF,!Xh7ziFF0FIH7$ .Fh7hFnF( FpxF(H7O42J:JJ#\.*D@x08pG3+O0pG-M*FO78FAKh`!8h L!Fxh7!Fh7Fh(F@FcF@s?1F#F(8+IE,)Hٲ7y(H 4%D, K``, H!H H7,&KB#F)FF(%D)FH7G#F)F@F(FIH79'},PKJLKJHKJMJMJMJMJ>JJMJ2J:J U R-MFS+FFM !ph7x!Fh7s!Fh7nFh#(F@F!0i7aF8FF8k)F{PF:F I!H7'8FFF!FD E ЫhC`#L(F(B 6!F Ipi6p(ѫhRF#`!FCFF(оMJ:JJ-MFHKh*FKFhFKhFKO5(F QFhh7QFh7Fh(F/QFh7F3F8c !FF(.I.H7Q%FWF/('1F;FCFF1F%H7<+F  BO !H >D_E  K`K`K`KH73 ^*H  H7\KJXKJTKJ`J2J:J&J2J,JJJ*-AFO0Xh!7Q!Fh7LFh(F!h7A!F i7<F@FPk;F"F1F(FIH6 )FH(2J:J-AF+FO5(F!ph7!Fh7Fh(F(FWF@{9FF!h6!0i6!Fc+ #NF0B 61FFIH6S% MJ:J*-EFO5(FXh!6!Fh6Fh`(F(FFs1FFع!h6&bFD!FH6FF'D;+ܺ 2FIH6FIH6%#!F F  @F" 4FAFH6J2J:JgJ-A*FFJXh!6H!Fh6CFh(F:@FF8k )FWF8IH6 !h6"(( .F i!6FN4+F9FF1F@F6 F5OztO0MJ:J2Jx F**O06,,,xh6,O3@  x*+!06;$+Cx{+0FF;}+# p +FpG pG-MFFFF5'F4Lh BF(F!h5(T h5EOeh>PFF8FF F5-G @ 8 (Կ  (̿  C1FPFz1FF8Fu-! #XBXA  B  BBB  4\E)FH6 ؞JPJ*FFh l(F(3 H ] (hahho@ #O0J"K`KhK`pGKJKJKJKhK`KhK`KhK`pG|KJxKJKJKJKJKJKhK`KhK`KhK`pGxKJ|KJKJKJKJKJ @ O0pmF cFFOa ;αp I 1 , _FH61O5$pDD J+FFH~ I0F  ?(F!?!F"F H6 !FH(F mpJEJ QJEJEJJKh#JhY`ppGKJKJ#I/*D?pGDKJ8 K Mh,L (8(x < KJKJKJ-MO|}l 5:GFO6 z@%TF=r :  y (fc(r(p  | Qh9JB M(c(ܠD!F4Fȱ!F/H"D6u(FP8(#0+d!@F:). =: F@!F4yB3#D(&FB8F|Bp5#F:F1FH6?!F0F7!FH (!B F: (O0 |}dJZJCEJsEJJ8HFF x1PBPAK-``h"!6FH6 F8d$F  Ozp5-0Kh'`hx<04(1FchYx-=Рh 7 6-h 9-! i5h->ѻ7"I4p}H5O;XF!`i5J[<0i+F-VF&$6@pOBO B ;!F :H;0!F :!FF( ;FCF!F\K\I ,(F!FXH[F54r+Zѝ6pO K`>K8 :K`:K`~Os*F>0!F >*F!F9H5KO 59EҺEаE3H5<4䲺EѰE*F!F.H50>,H5+5Fw+!O 6@'NE8Pҡ*F!F0*F!F0F5O 59 >0B4m+kO 6@ONE8PD|KJKJKJKJKJKJKJ8J JJkJJJ2 Jy JhVJ J J J J J#*F@0!FUH5!F0F5)FH5O 590B4䲯@0#>  @C*F!F@0@(8F"pI4a(@Ā80 +؝90 + hH5O #F6p EbM3F9F@"F9F(F5g#O 64 ⲓB +VH5X{߲TN3xB BAFC3LLHh"F5>#3BDH55FK6B #uhCHUk@CF5!j1*Q@)@06J7M_*F! "3H5+H530J*)!F(Fk,ID+KF*H5Dт!F(F + !I"J+F!F(FqI"I4(-vh J J3 J6 Jy JhVJJ J J JJJ JrJJJ J JJJ8JsFFF"5"FB0`O0p x-* HJx:"!5F #`x*-M*FFF@n[hxKh Kh KhKhKh Kh KHKFhhHx4*(1kh[xx+-Ѩhkh 3ChCj w.[j+gr.щH  #7w.=/&U'!5GF#r.7/PU'.!@F4F(;Р ZFAF4 `  # :FF(@7/хHIV$3F(ZF45 " 5DE$zIOU+3F E@ 4w   lIU+3\DR E@ BXIU 3UIU3(@ڀ  `A  "UIV$3F(@pY3(@sYx1 _*b0R D"QF15+@QFpY4 O @ D( 5IX*O3H $  A$ETD)IX*3/( Bk $,4B$,XI3IX3(R$,  `$, J1 Jd J~ JhVJ JbJJ J J J\J J1 JR JW J[ Ja JIpY34uIpY3'4n IpY3`'4f H~0F4HOO4O@J@JJ Ji J:F*h$+C4K!h F&F}2F!FC F(D1F,J,H4)K`i0+?!F(H48F!hh43!F!hh4,!Fh4'(F!H4'! FF!hh4!Fh4(F!h4! F1F J H4(FT!Fz H4}O7JJq J JJ JgJ J L! hpC !h 0{+ H Jr J*F8Xh!4!Fh4OF!8h_Fh#F2F9hH43(F8(H4+ (F#2FC F K JFBF H4` O0J J JgJJ J*-AFBXh!4n!Fh4i!Fh4dpF! Fp#F2FH4(F(H4 (F#2FC 6F K JFBF H4` O0JJ JgJJ1JpFK!hFF(Ch+H4$ Fp.!hh4 F FF(H4J J4 J*-AF8Xh!4!Fh4!Fh4`F!F*F#FH4X0F'#*FC F K JFBF H4D` O0 J JgJJ J L#h+( ##`! hC0 H JHJ-AFFF" FWI bChB -сh KB h;F)F0FFA`GO0 JxJ𵇰5jF' PNhO,<,3B l0F5O KlB;FbhH4j,<JaJ QJhJ*FO0Xh+b K`( 67(ahH4 H4 JJJ-EO F@PKFOHFF? QF4JK`- -y-O5(FiF`h4ehF(F3MDB]F(.FHLKOXJܓJ|JJ;J<;J<;JJJhVJ-AFFT I"Xh XChBhCF"F9F0FFA`GO0J0$KK"F!FHK4 T o M0"iF[hhhCh(F3eJ!JJ`J-MFFy&FEih%H34F F #9F(FnF(FjhH3  P#ZF9F(FmFFkhH3@F2s(7Bۻ o$P# !PF3O O _F4fJ\fJfJfJ*sF Kh H3~ ! pIXh27FlhT MN0,!FH3aD!Ft((F3S0FYh3N!FbLJeJ;JJ97JJ** \hT !F J'(!F H3* Kh+H3"O0YhH3LJ>JaJJ0FF!F KkF" hH@(F +hca0o~J*-AFFW I"Xh @hCF:F1F(FFA`GO0J0*FHF0$ F 0*.\h! F39(!FH3Hx#J)FFH3F,ObI H5tO4oJ.JJ5JJ QJ%J-MF1HFF?#/J UF(O+HF!0Fn((&K0Fh&I3='O *F1F 9( ?N*F -(H0 Z*F1F (*F (V) Do Fo J5J^JLJJLJ*!H:ȱ!3(z FXH3 FH3$HO4oJKJJcJ*pFF"IXh2H H3 8 p"I`h2(!F(Fp@b"KhxJJ JLJIJ-M*FFFF*2!Xh3-F-ѹh#XF YF RF9H3F3"### ( 2FQF1H3s (OD! F((9)H F'HO Foh-@5 XF(D7#D# A2CF B F(O1XF@HHehF- FiC K@F`9hpO0JXJJpJJJJ-AFx F**0!03p4F,& %%%%x0` O12F@FF0 H3o BF)F# FUh4!3>oJ-M FFFF % UE O PF*F0F2? :(.;h#D[H3FB ХBr2PFq2"F0F a;hd#D;`mJ-M};bx2F`<pb`2d0LXH3^ XF2F]F#xcbkFD"$2F! Fzk  aR#F)F<2sHj+{YFBH31$t2+#htach{a2;jBBcF7H3tj2O0C\;chj18  !_:ѻk(Fj{iihiR4$F(лh;j$3"0{`2q :{h(:iBj0Fch#h#9j08F(ч $wFdJdJeJMFFFF82@#H3 M <(FTF)FH F2uOBOAH3 P!F02 C@3h POAOSg0( R)F2H3\ Q(F1NdJaJaJaJ*-AFFO60F!h FFh0(EXIh2,,,!FhhF FtAKIh2H# hhaFEIh2,h2(AF(iF8D&htx,++(8F2F F20D0F ,H3&9F2\!F@F2lAFhhF$H3@F8F H/+ $+,%; +)#(((((^+ |+DhhBZ9!F8F66F!F8F6H3JJJJJJ-E*FFFPF E t9IXh2F&=4--4HF8 -.HF-Ih2,Ih2F*Ih2Xh(H36gi!H9F(%ch!h@F3(AFH%#QFJH39F(H3 2FF  JoJJJJnkJJ.JJJJFF F"!hF3/:hFhxh`"#1F(F##` pG pG*-M@O O7FTFV#ر3+  BU 2\lJ( hE$@  *%*/5>M\l|hh2bd d @(,  (W,9i lt(Y, F?H2Y ",!h:H2M "/U|"sT#6U!chF;+0J1JR# 1/H[2.@F1( HSFBF)F'H2)F&H2,  й (' H2PF1(0F1(Cl cF (  ()F F\#;p JXJ\J4JPJ`JpJ/JPJF "!hFXiF F8FiFt RClhF Y I(Cl Gаq ?$?Os"F(!FH2PhJ-MFSH21QI@QJ F 1NIOCMHNK F2j1SJH2d(FGH2\,FO1CEBHM2O?H2J !JJJZJ`J-MFKFFHhC/!ph2e/F!h2^/Fh!2UF Fl((VoHXO ]F&"F)FlH2"hkKBjH2  FfH+bH20+/]H[\H2 FZHZH2 FBWH)F F/[ݝ)K)wPHNHYF"FLH2uO1 FIHYF FJYFDHAF F/3AF F*=HAF FF9HAF F q)F1H7F21$H0F?1!?")H(H W?%F(O5"AF8F*F1/DDd)FH2O0F/(H~JJeJJ'V <J5<J~JJ@JM<J[JJ;J>J/JJ?J!.J4?JJJJJJ F1FxNO+1F138% F ,F F9FhF1%()F1m(1FdJJpFF O4 F p1}("(FI1YF((F1p(D<}+(F1F(1c8"!F(D(F1ZB(F1(F)Fx!hF1iF(FS(FFd dB(F3`%J-M$M$F$O$K @ B8ѝ0;"1""D#<"H$" 1D4oFH2o XF1 "6  hB1FhG(5&<;J;J<;Jx7J]7J-MHF1FH1FH1FH1FH1EDX5=DD'4.`0F1F o IF% `()F1蹒H2oI1# 1`I1!F1("!F18\O;*"Tx.@AF F(XrI1F(oIF(@(F1PFjI(!F1k("FD1PF\Iu(~WI1"(2 Fi+{5#E#oPFIIKرt"2 Fi+_5#E#MPF1FX*6I1c(jPF<6El8F- Zx;+J.!F1$(1FH28Fh XF o"F(F1AE0#0dJdJdJ#dJ-dJ4dJ>dJ2dJ^JaJ>JZJ5JdJpdJI1@(PF#Eta(F"DуH2H2рH0(HiAF2F;|(F >F@FN0FK,uI`h0F(Xi[ !F5D?4$?@4 nF  G AF(F$?B_H1!F(F TFxi ZHF1RH10(SHFNHzAF(F#F Fi@FHI`h0R(I#iFO4DJ{`DK E&11F(F 0GF`xh,01i8H (R9j6H(K1F3H(D1H,I(<.H1K 60B  )I`h0(F%I`h0(ޮ(F&i 0F+H1'!JǻJ7JTJ[J ~JkJyJ JJJJJJJ<;J;J<;JJJ,J@JbJSJ]J*DJ-AF')FXhx-*%JFhD3`>. (Ff+O?+#F9:FAFT/(%O5J(J8 *-AFFW I "Xhb@hCF:F1F(FFA`GO0pJ#0 FFJ /L,H1qF F 0 ! H/H1Y,F(JaJ'#J*-AFF[hx-*[xa+!<5, '&DB?+f+_H1J.h`0kBF(F,I/ 0 'Z'070BD FF!FH ;F &P+:F)PE&pџBKW# .I8F+ K)FhH1iO0JJ(JɾJlJJ0*FM00 M0hh FȱOa FJ1 "!FH(kh!x J#A"iF C p#"iF O0eJJJ*FF")O0pGKhpGJ K0#0Or x3iF ]iF  J-MFh#FFF 'F^F ;-`h x-)4!1D*F!]>4/OP"9FV:H/*:7K8Hh1 s)b) c)O0t)+S '+OF#)dF+EO PFM!14FI1[Ho ;OtP"!H.۸9]* 8`1 H;F"FH(JlJJJJJP08 pG"F!4@ H "O1_VH0 FJFJOzsXC0IpG pG LF g|0>J?I`| >HQ`| =I`| F Kh-!F(h/hh-iPJTQJ6JDPJ-E:JxF\ /d=!F/FCx;8FO4 F#;@t -F(L8F/C0`00FlC9F h/$i*ݣhC$8FYܣh+#``hM(F/``(F/4ap``SFa$)F`h/(h+9FH0O4瓽JDPJdJ-M$FF&F!(F/F(F/qD F)FF0D/9 & ! F/(@, F(FBЧ  AF FRFF)F0D/"FF7!8F/fOp:!8F/^F(:O F8F7F(M8FF(Gñ8F/RFPF/NXD0iF@ Q/22IY/AZF)FY/J YDO[DZp(F/w+FbhSh`? к Ѹ6O q /#CF# J`6R&0 F F (.d+bF*.FLPJHPJJTQJ/`=!F/Op0F0!XY_F!0[YB0Fq50XY(;#tJ`**׀@΀OXh/@+%F!/F!0S'0B00F;0;7 0S'0 F  F( *kTHpXXx0+(;#  D# [/(F/ #+T(DBp!(F(F?Kh{o93 #oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H.v F }F1FH.mo")FpH$5J6J8BhF* F#1#f1 +g0&+%+%IH.Co@!%fg+*"HOzp-l@+# f8###λJJ-EFFF%<@x#hn"A!d# F#A (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F("#xcx#Ie\B3ZB\\+#xB F#p#(oJ+8FOEY(M)` o89=+Ozp-o3 TopG7hn&A!OsG"#AAF(۴#I Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H.2o"p1FH.*`J4JFFʲ!q#pp#&QwBH.o$ED&1+ 3nhC$Os## "DApJd#0hn#D$!# "DA00hnD$d%%C# "!#DA0-A} ?FFFF$?˳³#p(z#FF(/#x+,O38c9#FBF0F( #?4ZB"F*p }Bcx+#x;4F?#oo"-MFFF(Ozp-1F F?@ !?F;FF1F Fڴ !H.0(F>F0F5Fo `ix)ЙH.<*x *FHO;)FpFa^F1B!9xzx*T0**? )ІH.9BۃH1x[E3Дa.~H(F0%Oz1B&O @s F19Fp# K%1#&1;xDr#C&!2&!) )`HADB^Hs]H#sC%ݒXHl %p D9F D"^sD\HxB"T Jp)HHuBFHwpк?DHp# p F D9F32F)F F560B5l#hn FA!d##!AA "PFH)+H.&of gBp-[( "1F@FH "1F8F1F "(F! #BF FV! #:F FN)?Ǯ #*F FDJJJJ9J_JyJJJJ J/JVJtJ#-Ah`FFFF0 H. F1F(FZF(Ѹ(Fd#ih/`#"(FAA H.Bp-.(FA/!(F)F(JJ pGFFF,Y(FCh+h;p$9 iqv(H.c#;p3p(FiFuJd#0hn#D$##"DAb0d#pA, *%)%hn#D$-DA"#ACpd#0hn#D$##"DA,0pGi v8 pFnhC&d#"#FA#AF , 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FFb۸@(F"1FojT9F(F(('O Ozz (?"1F(F@< -BF1F(F(۸@ 7/O O41FH.z#"1F(FTco"oг ""1F, "1F(F8 F@"J-MF:},  F&?(L`"1F(F('7x1F / '(F:F(:F1F 2yx!C#q #r" "! yy3+r@szcsx 9y"zC'1+"!(F#<0`@// /+hn"A!d##AA(F#A((F(&@, F(O3c&gz 9B򪀤Ho0"F.BB8F d/d0&`azp a 9B&O 9BT0+@#0KhBT 9 ; g#? J BД {iB1F(F ^({ ;iB#ihS``#2z+"srzbszsA`/`@h#1+?X@##dS@4S@s,9i8F#c1+l.+hnA!d## "(F #AA/(S :}i66"1F@FI61F F_!  (IH-o `D`{h `z``a6`O  C F?:iB"ihJ`` F`#ah ;I"1F(F Е1+"1F(FAF(F"1F(F}+AF(FAF(F["1F(Fg?."1F(F^"1F(F!i2*a1F H-n#0 \oYgJJpQJwJJ@9i "a pGFhhnA!Os#"zAA"!#R(#h9%H,g hazhA!nCA@AA H,V hzhA!nCA@AH,G O0IpF "!(F@C h0hnA!Os #%#z*FAA!#H, hazhA!n NC1CT hzhA!nC1CI(F p`-Mx hFQHh Fn\BO$ kzD4 CD@DD#&BzD4 CD@D0+b !F(hFO CECFFOs !FSF(h F(h 9+LЙ?!F*h9 E&+h9*;&(h"hnA!Os0+zAA!#_(hI hnA!AA+hI0F  E 3ЛF  DѵJ#sa# F%0$0F j hOzuisBp,6=ѣi3H-ao #{+ 3x++ 8 @Bp#++O0 J-MOF FGFO а G&?)F Fk{F+@)F F+ L0+M0+ (Tл +h9(FjGoPk{+< "!0F$#3p0)F[sp#0F3q0@0k{F)F0Fe+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x-8"AF F5'r%`"1#s#1+cs%P+&?J?K!QbF#"c !B ܐ"(Fjczzc{ zk!{ +-1H-n0J0K0H-g +!*ё*a6Lbrr+!*ё*!r.!% 3 1zѱ%0+#%0#h(FhnA!CAAA!bK$9(Fk( ?O# I#AJ:J0J=J];JJ:J-MFFOO °L *? hSrz0 "! F~##p0[cp$#0#q1F F3kGF`mH-O70FB0+єL0:+єM0L BbH-k{+х 8FB]H, /ZK@Ԛ0"+# ks y"I r "^k#O (0Y0b0 "!XF 0"[cpO  01FXF3k"pGF(sh GC'?s`"8FpO # "!PF%""p Rbp" 1FPF2kGx;"H-5shO4b#s`Os#;h2{h*a"?!F?ja"?A!!/!!?a4##'a FQJaJJ QJ-M[F s, !FF F!(d(h'hn _A!Os#&?+zAA#"ABȿ7x&3FRF !,"##Os0#I, t#F#FCrr)F F(030F XF(#F(6BO IF((FFcJtQJJ J-AFF(FW O%hBoT H,F-h(< 4`AF+(нB+h,FU Fo-MFFm(}){Ѓj+{h+VOFh  #i FG'FW ?hBѣi+Cbh0H~(+%jB,H,biJS  +F-hS GU ]F+(=kh 0H,o m#h[h 3`iGF(%j+hBU FhYF+q(=ooFJJVJ-MFFF(CЃF[ @EF F80F+ ` Fo Z PF$h(ѺJ|1F+-(УEF#hТFT Fg`kjjb``j3b o-AF, FFFOF#`Ba aG`aab](F+X`8 F$ F` #bcbFرFU ?hBѠhj Fg S ^8F[3F6hoii+"#aD pG:B3F FCa +Ai1 )Aa !AaL!)$]ɲ"*V.g+ɲcG,jрS*.Vɲ+T9,рDϲ/"ОFJ+Q\)@Ѥ:+3ؤF+.?JT*)ٞ+S,9,G,Ф:+F,!(F=,'O!(Fz.+ɲS,рL .DɲA (F_s+ɲ)[!(FRA,1!(FL>,5!(FF~!ɲH, 2!(F:C, K(F#DI,N,??J,?H,xF)ѓ)2 3P"!>@!Ff2K(dY9xn FA1#hA!AAA)`( h`y"`O3` F#F Fh"+l F)h#d(a8 !H,hP"!I+#KKF(u HI+(lI?Ff|JPJJJPJ PJJ-AFFlD*FFF_Y\)٨"+5B"l3F F9xAx' -AIF#lx+UєL0#L0&'9F" 9FF" 7H/F"lx+ ٔFB# FxC.) WL #?`*hnA!"1 "Os(FAA!#"!lD &++єL0C-A%K0h+Ozt$ElyB"I(F!iF(Ft!i(Fh"#l(F!h#k a ` ii hC(((FJ0FJRJ)* 9+; pG0{EliiiB + #3aD BI(F!i6F(F!i(F=h"#l(F!h# a `hC(((F8FFbFh)hB:B*1`+h!T*hH2D,+h3+`:B4`)hd,Hb1D0D+d+h!FT*h H2D,+h3+`< @ !J-AFhFFF<8 +*N#hBNE @F;h;;`0FH#h;#`+x h + 0D;#h#3#`50 `(xhH+#h;#`#JJ-M0F FFpI hO0FJ`J`J`JH`J3+@+pB# `8F#(F3+=FO $F,O  ( (@ #N+U+x+@ F2hK` FOc !+E.FF#3 C (PEq  ,ns3MT[(O(b(kD 41+>p!0[+Ѝ"%0(~(ѝ"01;+  "02+Ѝ# 0+ٍ$~(t% OcAF <$B!(kD ( C+SbpyfQ 6QQQQQQQQQQQX+@1)K+D"FF)D+ %!FFH,C  #F<+ 3RJJJJJJRJ!J#$ 0 <,цCB(]4|,? <Bo< k1ZFF)D+xYFFH,   QABMJH , ;B>B:jaH,u <,)?%JH, ;+(1щKh*Q`1IH hh`hB` kKS!@,)q!F(F+ (F+hF(?*FFpJh+pI hBmH3h`BĿ#`hBiJR#@bL 3 3^J^H,O (;+K\E#8F+U+*XD@)F8F(? OcAF!+?2hHK)FS"*3hBJ3+#h3`Bȿ`@Jh3`o*F8F,F Ʋ .# .'S&kWJWJWJXJWJWJWJWJwXJWJWJWJWJWJF.G.V.%@3Bw .i#8F#pI (M,D#H#pP`}#O0+pxPFF;CE#,F!J QJJJJJJJ#JJJ!F(FF+~x +y!F(FFoKD#3k3]3#`0 "MJ"I pJ-Mm FFF*#$"FFMo-w##p mGF+k; '.\)k=XF1FF\. \)`8ЃF1F`++'.\)Dk=#$.\)#(.9{.7-"pfp%4=4).}.iF#F >sEۼ C!$"(8?+-;=3#F#o\++Ы 0+ 0Y C ppG 0+BKS CkGDJpFMU$kG(U$p@lG *DJ@0 pGF @0ս@F F@ gKS kGpGDJ  B0 [pGF @s0ս@KXhkGg@ &DJp0FFFKS$hY@lcSBSAB )F Fp@_I0*[ pDJJ ]_KFؿ%O2FĿ PUjlB D!O5(bFX @ ] D$x1KjFGpF8F F)(#(KC$P, 8| IQ`|0 J`| I`| Ia| IQa|0 JaO0DJZJ\J[JZJZJYJ(KS kGO0pGDJ@0 pG(pG Kh 0+(( K`JJKh`FpGJKhpGJ"K`pGJFF?hB 8F F& )FF F8@\O3F8FIFFF*` FI*0 FI*  0- 59F !FH+ J+UJ2UJ"J"KF [h LHL!hHGHDahH?Hk0F7FJ# 3>Z%E(ѻ[F !0F *w5"F)FX+5@xC  ;kEPFX+*`&&O JJ7F FF , (O KOs H0(OKhhOsJ QJ-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F)8@F)F$5? U,F$ F5BU )PERF@FU)W(ѧBJF$ FoJ-MhFIh )bF 00F)%1FȿH̿F)(FK xF , ,t5A+FK< , ,- "0C,-OS x$+JGи D#wK!Os(8(Z0U )1@F))"F@1DB/DBt$t0DYByO *lD``WKXIXH#AC*FUH 8-?d  _(и  (NpIXF(FQZF#2E3BF۠ lи 0U ($,"}PFU7 2UDDF |!H(FH(N%F\ pX HH) ,0F)(p'{M+ HHX =DXF"JJJPJ%JH/Jm۶%J2JhVJ8F F(@( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*ء7BJ;B4#*4# 4#4zCO0Pt '&%O J]J_PJ -MFFFO zL)44+.+BO +404,Z04B o0O34PF4F(@)є+4 +$ 4Bj#DB*4 $C4444+Nє)4+4+ݳB3FFF8F4v[44/D+DD4$4\- (D<+4# ()о$4\- (;48$ DB8$[4;۲B8 1 \$A+. %4+#)4>(4+  C 434F #)4-p+4?jP;o(4+  C 434JpG FL4;+        7#)4G(ڽ@H(J0&KS HpGJOJpJKFzL#DBahB40FciGch3r Fp4B$<;J;J<;JF$ F!(-M{F+WHM,h7)E)BKRPHM)z&)G1)LHI^ 4t)b)C)I)|)+Ѐ)^IzAz =H)S=Hc{;H!{)^[]]]W]Y5HI^ )7 0H)1Ah/H/H/H.HgV<7 %OZ#B"  DBT1B$ K)F F8,^OX; F[FgOH)HHHH)HRJJJfJ)J<JJJJJGJhVJuJQJXJgJlJJpF&#N#rKM.DB FkiGkh#rp5;J<;J<;JpFF(!zp@!H)h H/#hI+01+++$&+,H7+C+H |+ b+t+H+HH 2FahH)d+i{ Fp@GHHHHHHp[YJYJYJ\JYJYJYJYJYJJYJYJYJlJ#pX0FFFaPh["F1F(FG(opo\o%8"# F%###iMe a4I(I(XP(F8`qJPYJ-M FF.! FF(F F(#,U FF F)TFx{"F9FH)o(F'0FF PF)9Fx#RF9FHF1F8F/F(#0oYF(@#{+#hC+ FzJJ-M F!F`F"F!HMFH)Fo @FPF$(F(d((FI(6(:!(F(KF(F("FFcT4:FYFc ZFrH)SFF̱#x FnI( F)Fx,C1*FfH)7o 8hz[$t8hz3%$2F!F8hF`rm-p*pѥBр"1F%F4,-oЀ"0F,F\8hzk,F2CZFJH(o w2C,ZFDH(o\ i,+ЂiO ?!!?##?A!!/!!?4""a1F8h<c2F!FF0!F&H(-*46 "0F"I'w@1F!H( H(9hFi? ?##?@ / ?4""aJJZJzJ JJJ:J\J`qJJxJ-EFFFFбh۱$ hB2F!F8FhG o FQF@F'(4O4o%O3ҿ-MFFF FY#!(F'F((F'H"cTFFBF8F( RFYF0F^ FYF H(0FS BF)FSF8F[*F9FH(VJVJ7F,hFb,C,, KJ7,Fkha3 I(0 KJt,FJJJJ[J[J [J[JqJ[J-MFxFFhF<0 XF!BFu EbEqa#x0FEMGo% -MF z FFrhF<0#XF]F Bu E rEp ` 0F# z EMGo% -MF z FF4hF<0#XFF Bu E rEp ` 0F# z EMGo% FM( F@ -AFF(F(-$O`!F0F :F !kh('AFF(F"@K `4, ,VJVJ-MFzFF(F3hk+h+A0FM(0F2H iz[F+@=F(FFz)hCF0FGFSEBiz[F]o%-MgFFF(L#h<0{g(BF+F FMGo%81FU+-ѐ1+)#FrI  34, " I6' 8"IR'( O0O0JJ𵅰i"#s#@3 # O%?#"#F((FO07F(F(ѣn+1+Цf#g-MFF;kyk8ly`k9`iF?!?@FF iH(7FO O _!?ya("F+F]H(xiV@{iYH!(}T{i1{d{izFs{a *TR)0ћ0+@{i  Eњ0*+Ѻ 0 DBB{h;hCTFFxh9hC@Fw{i  Eы*л 0CC AA9aO``E*$H7м4F 0CC`# )@ @8a`IXHqFzl1F:iHhh(T6*I*?z+vWJ5WJbWJ QJ^J^J^JFH(##"# F#YJ0FiћCsAq # Fi0-MFiFoFFг&'M"# Fg( +x+ лRFahzH(nO6"wIh'6FHSFbhsHi([ R "B Fg((xp"cIdH' FSFbh_I_H2C(ѻRFahZHH0Gp"G'I0GGJ0Gg##F:F FZ(лSF9FbhJHAO2F9F3F1 2D*3RFahBH~U++л?wRFahAF0F+J@ \F(Щi0F+>&I0H MB"J0 BBL0KC#NBbCCO(FCcE@Fk`k0FQ P0UC#R CCS CcT B"VBBWBbZCAFoY X0C#Z CC[ CcBkhx w uIGNOREMEFm F8iF+"##D#0F~(C0F#s O0O08oiF H )FO0+)F+(8 8i8!F+!F'[Js#F"F F( Bc FVtCXBXAp-EiFF!F[ F+ZC?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 $A!"0AA#0Aa%0@ &0@@'0@`) (0-C#* CC+ Cc, 3B ".B B/B bB[b2i F+aJF !'I4&"I F&00@ @[H@"heX& @Fi peJ`qJȒJ-Mi!FF[ +%D?4$?@4 O&?1F@F `(EH'EH'DH'DH'3mhB.7F F5(Д!0 B""0BB#0Bbz`%0$(K+&0-KK'0Kk)0A!*0AA+0Aj,0C#.CC/Ch Fp[F)FzhH'100 5B"203BB40BbC#6HCC7Cc'h!F H'dH'_ZJ0ZJ=ZJIZJZZJvZJZJZJ-AiF F[ !F+D?4$?@4 $ ?(?:AF0F|`V(F )F8&xh{ F7Fo-Mz`iQ0FP F@ R0F@@S01F@`8+1F @+f?6&?@6 O?+#?F"#(F#"#/(H"!8`pkJU"O!";h!1ȁ+i";1 1#(F#"#&(єQ P0UC#R FCCS @FCcT B"VBBWBbZCyh#Y0Cb{Z0#{XC#{CC{!FCb[@F#ctCt"# tt(F#(o7FI0H MB"J0KBBL0C#NOvCCOBb(FCcE F100 5B"20(FBB30Bb402C#6CC7CcyhC|EO O c~"~aB"~~BB#BbC#(FCCCc\(@F-MF(`)0,F&*0FFF+01 Ff-0H(.0 FHH/0O Hh00X7C#2 CC3 Cc5 40C#6 CC7 CcJ~ ~C#~CC~Cc3I H0C#J CCK CcP0Q C#R CCS CcT UB"VBBWBbi*E W#R WĀVCbEs C EO~ bEs C EO~ , !L# "$0% B'0& Z"CBs;[EzCxє100 5B"20BB30Bb40C#6CC7Cc!( )A+ ",0- B*. )I"/0(F"8F&>F(>F"0OW,!H0 8DB0 H">E   B Pp  57, 2FCFfFH6rH3o!ooJE# pF#KpI#p #pP# qA#KqR#qT#%q'\# F rMrrrMsssvMvvv wMwww sF2; 0!B2!A#0#"$ %0C&0' 2";!B2001A30#4 50C2607 #I0CHJ0 0K0E,0/08#P0o"() B* +:F0FLPMPNPOP-P.PQPRPSPT0UPVPWP%tetttXPYPZP[P8&=@ @B-MiFF[ !FFF*\D?@ !?jF"F!8iA0!F*FD?@ !?UF@(Fo  F"F!CFZF)F0FFxSF:F)F0FF(:F)F0FRF8F(F#F"F F (O08h#! P%E%":EE#C3Ee$A!&AA'AaBB0FG8O0-EiF!F[ *%D?4$?@4 G *?  U"#0F#F G:$?c0F&M(h,<,3B FPChFB Ѡi\B F.(jJJ$F%F)F0FA P;z;4 8F5, 'F({+} FoF$ O!F(F P3{+!F8F&0Fd4J7 FF0)FH&P F0J7F FH& F)FFЃ H&o F0((F++{+oJJhkhGo%pGFpG8F F ;)F F8@־8Fhh F=!F(F8@Ǿ-AFF FhFh,<,3Bo FhhBChB@(FjF h@:(]D ]F0!F@-MFFF'#hF<0{:Fi3F@F:F F3FGFQE@E :Fi3F Fo%-MgFFF(#h<0{Tg(BF+F FMGo%-MgFFF#h<0k1gBF+F FMGo%r-AgFF(X*F#Fg(A-AgFF(X*F#Fg(AsF NFPoh,<,3B0Fp FLhBChBFj,<(0 -M ?FFFFF,/RFAFYFX,3B(F F`hBj4F,! F F(F-M(LF uF (FB-h+ЁhEhBjBREsӁi iG CEqӆE Chk``#`#hX`4 `( J Sh3S`iCj 1  Jh3`JlJ-MO h2IhSBzF9i(6Х|h̐B)(JThB``h:` Ƞ"Br `j$cj8F`bp FM ( F(:F`h#aca`j%bKhT`#J`h3`lJJ-MFFO OXhF F 0 Ff!lF FJIJ 8JpFhFPAhi zFB #SChЍh I H%e pZ%hX_Ih6 C_Z!hP"J(J!˿!ȿ pG8?0 ?!F@ F8!"F(F)4(F8F8@ BF(IH%# Fh^JUJF(IH% Fh2JUJF(IH% FiJUJ-M0FFFF#0xhF(@P! F(O24Ccc,bc `Ca <dcdabd[hZlCh[ldh) +l H"(;ks cl Ccd9k(𜀠`[hkQcl Ccd( a3hk3j[hlIcl Ccd(t`k4cc#d` F!Fh.E[hh+UѸXclC@cd(F FGF( F(ah,H%BUF&#lkS``clc&d F`cl F!##acl Fu#` Fp3hj+ FGF(лi+ FG(ahH% FGF(@o o o oo JJFhFFFFl_ O3(F#oO0$4#F(IH% FiJUJF(IH% FDjɼJUJF(IH% FjJUJpF(XClԀi&hjӱ F1lj&o  FF(cl%(Fpa#j[h]ke F@#j(F[hYl(`bihUkj[hkU F0(F1l(Рb#hi#clCScdl* FGF(йosF(Cl$ Fp"  1F((F.hF(KѨi(-klCkdi+.(FF(;ѫi+/l+!(FF(.3i+3(FF(3!(F;jh"I"H%Fklձ+j[h[hT+(FIh[j+(FGF(kl(F#kd(FGF(iC+j[h[hT+(F I"F F}ozkJYJ{jJ8FP4O<<#FScl F)F Flcl F#! Fdcl Fu! FV FFi+#lkS``c dcl`h^ F[GF((F8o-EFFO U4OT<BPF#hB FF8ahH$Fk4F<;JhFj;! F#j[h[kC F! Fi{hRkj[hkC F! Fcl#ScdFF(oCl$ F" F(F2F(FiF/h;l oB3B' ZL(FF({i+is;l _KF0(F"kl #kd sF( Ooto(FGF(jh IH$8hj+(FG(jhIH$*ooot'JJJ-EFFF'ozT4P7JJPJG7J-E  *FFFJ#lFFla#BԿ## FRF;F0FHؿJ Fhh-AFFF$O B q0F4 FF -MFFF$O O B "F@F SF@a(Fh_/@p @Mbp Fbih3F!(FBFh_H#2FX!(F`_Fh_1F(F Fp 8FF(F `O3 Jll``# Jll rJIl=` 8o MJMJJ-AFjFF!(FhFl!(F{%hh&z_OD `!f9F(FF_.`_FH&d1F(F@@F`&a ʚ;-MFFQ"F! ,ƀ,À,RFh9FF  )40,h0  `-if/:R+F! FF(P?! FZ+FB>F(=)F FPFh DL9K0_`_H#*F(! F`p!.տ""X!P!BH_` F*F^F()F FFh_+>s)F FFR+F! FyFH#H'FD+)F F*FF/: _`_(!*F F`WFF;_`_(!*F F`FO:wBiiFB`ii 0+ИG(FiciB*#aD y0+ FG(O08F F"!w 8@lhkhGFpG@lhk[hGFpG8FBihF "0!##`Ked#dKPcK!bKb8@ʿJJmJ}JDl F#hmk"@P0h F@Go%Dl F#hmk"@P0h F@Go%FFFF:F1F(F<#0#FYhkh K@ @BCCC" F#cFOzp!" F FO`! F)-!!!!&E$EGo 9FFE F& ##(E*E1P1@]hhF O01@#"{x$ F!$F( FH"FMJ (KS HpG@JKJ #0#d0 F#" D#`p)Fj@ ѳ* ,KdkAL,Bd!!CBB@r#(F"F0OzrF!(FbCF&iF(FF8Ro d !0FBomFpOtOtoOzr FJC!Fg&O(FwpS`o9B H"SoE,6Ozp!4F4F,H"?om@MJ*MJ0c#0#" ] -MFgFVF@hF Fza(JBq3H" (Fio(2F;F(F8FO EwCC ZC"62D&2#"(#*#,#.#0#2#OsBԿagcgBgmck^ "4 " F 7#O 40d0" F 8'F(w#O F|i0F(j F{z FZF(`chgI+E7#P0d0Fb F1F`F(H3#3# `1F# F'?F(/;hcyhCE :+:JHOJKFUc`HjbhDCSbEK!dB)DJjj@AO#xx@KBH@H!B?M#`e>I>I>I>I@sCs2 :K/KO Gܠ'?#l0#@# # F t wF(ihjCb"W<7O WVH %FBz2`hqc (70+3ИFAEr 8F!iO 8FzIQ($#!##! !# F"JFر"H|(FJFEF|xQ  F#F(&!! F(Ozq FFJ ,(FVFHJHJ-MFGhF8F)F(m9FC z3(f FoA(_ѨF#h&]i Bx<=FFF FF 1#Bs  F'#-H#SF LO BE0o#hWF#Uk3C ##!i,0o[FSC #  # F FF0H  k3C #,0# F nHOzq F(HJIJHJ8F0F(F:#h[h@O hS 0#h[hհ@ 8 pFH FBOv)F$&0"( * *F!hH O0p&02@imCCeCCC3CCC_bh `6ngMJ-AFF0FjF0FshF+`O@`#k`Oska-K)F`,K0F+aF(J0F a#%J#F%IlF(9 i!IspC 0x`;`0F0F8FIpF#F0FI  5"P_"iOzp`o Fu"J[JJ6nJFF  F@^8F zF_ Jiaii_+ ۣik__ ic8(FaoO0 pFF F2kFi]h_%2_iZ` #o`p Fk(%3#_iS`_!iC3D_i FS`(ѳk+ѿ_"i `+ѿ_"i_"i-MF FFg FhF+@* ** O#OCjhHC@HCQHCs.\ѩh_ia*C_ia KzFik_@Fz @汳hKz+4OOHFik_0Fx(р @̀kh Fik_0Fo򸀻jhi}j_`7h@rhhhTCSCS*CS_iahhJC_iJah_ia*C_iashh ##hiSChO*BBo`O8OjO ;Eb4EXӢik_BKxX'p_irFMCSD i"@+Eѿ_j_`ij_+ai[j_kaij_a%_O2icih_C_i`(FO5 O5Fik_om_"i F`L8FF(F)ByyAzC#yCCyCczB"_0k e_k Se80kSj#CSbki#CakSi#CSakj#Cbk@8hF5iZXBB4ZP@ ,($a 8-EFMF3i(F@T D?!?PFQD KOFsV @rB ثh;` Fo $Fh@-MF8P? XB??XAB[ Bs8YFPF1FPF85CC8OC8F8@ -(% 0 PSiCCSapjF F0$-( 4uD C@C_kd_k@6dk Fl_ FB(Hop {GomOJjF F|#4-( s5+C C@C_"k d&k@7Fl_(FxB( Ho ;om#kl_OJ-EF9F_"5+k Z`0KF0_"8FA (XTHmoRISH F om#lCr FT*kSiCSa*kjCb_Ob+khZ`AF0F7PF9F@rOC Fa@DD2@4B`AF0Fg{_O +k^cSDtD@4Bg@F̏@a_+k kF(+kkh_i)CRi#  *d*C _*k`*kjCCC b*kSiCCSa*kSjCCSb*kiCCa_OJݼJuJ-MFF FdF FL8`0 F 5bHvIwH o0F FsI@PFP4#hbhhnHmJnI FiIFh 4#hbhhfHKbJcIAFlbJ `J#QFlF(QFlhc0O;O (AFlRJ[FNJlh`l|`(j+9SFRFDIl FVF@I QF`F@$#hbhh9H1J1IFZF@$#hbhh1H(J)I#(0h.J+`AF#l}/FxbI(HH#'JAFlm@CBFbI!H7!Jll<( ##" FI ($#lJl5JmJJJLJLJJJJ JJJJ:JPJoJJJJJpj F9F F50F۱5!(F&Fi!(FF`i !F(FF0j$ Fp-EFF(F;h4@ PF#cF`E+hjhhdH0FbJcI0FpU+hjhh\HPFFFVJWI#n`FP5+hjhhRHxMJMI0sF@%+hjhhIHDJDIjck*.d1_C_bkd1Fp=KBFb ;hFYh"HD!O  H=#a Q.H4oma0Hoa !0F#8F"O1(FFLP0PFF"O1(Fa5JJ5J5J5JpF"O1ckF+Xj "00baa"O1 Fs"FO1 Fl HO0"O1(FOzpx[JsF FFhSBjh!h[hkH1!`fbpn[J-A !O1@FFF{F0BF9F(F"FHK[JpFF F "O1|"O1(FuDC(Fp@ "O1j-A?F FFFh )j;FAG7iA&CN.*FF FAQ"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1o-AFhFFFFh` &ah3m[@Sh|h)ѿ_"aCO"!h_!AC_!` x_L@ 8@_ p!xɲ_1Cɲ_!p!xɲ_9@_rB!pOUѽpFh Fv`#bhhZCX@h@h(@pm I.Fh_EC_X`p@p#8Fh FLChihhB ڪh[i@)F c`8ooFh0`"chhCh!0! 8Fh`"ch MhD+h3OzpXC#+`ch!  8,JpFh`"chhf{ChZh** |hX_C_P! Fi(Fh#: h H(Fp J IHF(#" hHJIJLJLJJ-MF7F(FF(F\(Ā(FcI_FX'(F^I x`H60hB$E[i@񝀦D YFE(8 YF=, YF5XXFIIF!XFF0[|["hFAI+XF@IF`!XFF0FXF@F( FXF5IF(!XFF(;F!hF.JiF(F .F`=;F)hjh h'H;F%J&I;F!%JhF2FiF(FFP-;F)hjh hH;FJI0|{;F!JhFmiF(F_FFH 7a7`6 QoDJMJJzJJdJmJJJLJLJJJJ-EFh`#oh_C F(Fp#B h6HS0F4J5IHyFP#" h/H,J,IZ0sbhhZi_bhh#_Z achZh**#jhr|"hX_#C _bh!h|P!(Fch|+#hj_#_"hbX0+# !F(Fv(F#" !pbh#*!(FhiJLJLJJ8F 8h(6hF FS BhchBС #`@` 8FhP I < B 8h F #𵗰`F2J3I4F(FR ȱFR (EF)23O2$I_#`hkhC1F FGXܱ#h˱ FF hOAF bh`'1h J``a2`(FR 9P`+c`Foo 4JJJlsFhh[hkch;GhF+3`$ Fpch(FGFx*hBF hHShIJ#4JLJLJsFphchkhChF+;`$ Fph(FGFx*hBF hHShIJ`4JLJLJsFhh[hk#i;ChF+3s`$ Fp#i(FGFx*hBF hHShIJ#5JLJLJsFphchkciCChF+;C`$ Fpci(FGFx*hBF hHuShIJp`4JLJLJ FF "F'( F&( F( F@LFPh;( F@?F-EFl`( uFOl,9F F+AF FFC FmF#F(F I!( Fa( FKFo)J[J \JhkBlBBBdKk#opGFpGFl F(# F2I;(FGFx*> !,JlF(1%&OB V%jFS h#FFF`<8F#hbhh5JIHjRhRhT*h!Fk[kG!T 8hkkSo%!T a(!FG&\J4\J?\JLJLJhkhGo%pG8FhFk[h;G)FF F 8o%hklF`Go%pG pGpFFF$F(F D0;F +F2FI FpFP7J-MhFFHF<F(UFl1F8F+[1FHF(RFl1F F+K 0+A1FHF(:FlF1F8F,.ۣ,ѣ1FHF(KFlF1F Fo F o #BڸGиxи $O'OO1FdH]F(Fl F1FPFI,+h<0;!(FGFEo%!F(F0GF2(?41FJH'F(ހFlF1FPF,+h<0+ )(FGFE!F(F 0GFX4(FW#+h kjGF,h1F,HF( lF01FPF3W   1FPFBEQF(@+h<0o%)(FGFB!F0(FGF0,1FPF4pJ\JJ\J+hk i+"F(FGFi+hkTj( "\E kH 0* ))hhk kj,(FGo sFFFX00FFp*F FJ("pFFF2h$ r 0(F ( `*FI F= p*FI*FI)F FJJJJJ F~h 0vy7 FpMByc A3D!(FJ(F00JJYy@ FFFPF8F "3h2h$ e 0Rzn I_5 J-AFF FF(9F F Fd8` FlbhIF(F`yB F Fر$!:h"`P"qjyAFA22DBq"qO286oo F翸J4JpF F<F[k ,$$h2F8 p$"h +K2:o#` -AFFFFPl ;F"F1F(FFA`Go o%-AFFFF2l ;F"F1F(FFA`Go o%-AFFF Fo#hFZ*)F F( )F#;C F3hoOppG) р#"2!i(oro\FL0JF Fl J8FF(so<:Il`o<7Il ao<5Il`ao<2Ilao<0Ila.Il$,Il%"*Ilt b(Ilx&l&I'$Im2"I(F4V#icch= #i=КBjCbi=i= 8#20BjCboaJbJ/bJHbJ_bJvbJbJbJbJbJbJbJF(IFl/b@lboj0F F\ F(BFjB1Fj(aJF(h F@Go%F(i F@Go%-AFFF`iS8FFѐ$05j8FFiAF8FGF3j{u 8F(1jKD!X Fo%o F FF\ pFF! FF Fp6.F + 5S/B` Fpph )F Fk !)F FhG 0p8hFk+i+! F+iG(8hki !G pG@l׿8ElL8(F@lڿ@l8Fhk FkhG A p8@l!h8 @BphkFy3hF0P"!hFah "# K)F KhF K K KU  FG(p8J8J8J8J8J FapG8 *PD8(FR [pG|pGXpG R hkh"GpGl`.R0F4ILF0F2I|F!Fc ` 0Cs0 :!Z*F9F0F9F*F0FF(0FP8FMF,#X!FHYc(+(!c K(!c &(c (HcJyJcJ*8FFD2 8 FBKFа_аOаO аaO а?ЩFH j!FHLP07@?LP0- (`3LP0!HSJ-JSJpG F!Ci ```h`Zh"shshbsi#a𵉰FF(FF(FKBѨi(7o `"Il`"Il`"Il}jF``!(FhF_ a#iSOI:Flg(F;F#a.## caO(&>QJIQJSQJ6nJhhDh@X\_pG!F@i`i@!o  F!@i$   hhh#D@Ҳ_ZT8 Fp!F@i "F!hi , 8o  FV) *+J@iV HSJpF F@i!! @`i`i!`i"!2F`ip@!8 FCiFi!Q!hF(F 88F F!`iRB"!`i|"!`iw`i!Bir"`iFmk)F F8@8sFeF FFiHO( F'C0`iF FhF FIO1ha(F po pG-MF&O ,33B @  @j_)3H>1F2H:6OaO`FH8D*I*H'Ob!r r  rP _%`"h__ ``bh_0_`h__`h_#o#CCC#g_Kai_XDkF"j_(FMXEٜ6JdJJMJ#R1@d @3B-MF3 BDF ohD,HO0j_+"$ aF 02\```$KhC`hD\`h`aAF0F~_#ck_Bzk_ TE HhOzp4TE0FAFz(FJJ-A F }!F"2I#0#+V"!H' 0#Ow0# _&?AF3F(FZл2{8F!HIHo }ROr1F(FOq(F*"ID"6D". 0 o8:JaJJJ-M#"#0 F0F;H+'"  +x"H+ {+zl{y! D$>H'(0d+5#%#*0T F"z#,F(O OJ#J/KHo #@F, 0 *x.H*10 20o+0#O@50/OJ# 4F(+HЕF 3CDFDsh"H'< "> "  h`hW`h`Xha_"ck_A6k_շBOzpF7B? D  B2PJ FiG!xF() )p%))a9H9HH)О)8*)"!F"!FF@ 0-HO0#BOA8O0"iFO3"D H "iFi"O3#"  @ @B!F@JGJJ1pG8#$Ehj_+Ozp< 8 8FCh_C_C`Ch_OzuOzpoah_=8H#O0'J-M@XF 3#3#F)`3@_F(@_OB  __$oD$|d dDd@_" _ _$# _F$#(2##BĀ _B_ 0_3i_$C^j_R*/*.KH*FJH(#3#3˲B# IOK F_K FoJ FoJ FJ FJ F/J F/J F?}J F?{J FOyJ FOwHF_vM FtOF@F FFFkNF jH1$(FgH0 <84XF'@71FPF"RP`Fi_L B "@B"_ai_PH"o"BBB"gi_B_ai_1F(FmF(1FCH6"k__"c j_Ozpj_(D b1BѢj_*>.H"k__"c"i__"a_pj_*,#:C,#KK JJYJJ QJ J%J+J1JJ5J:J>JDJIJOJTJZJ`JeJjJoJuJ{JJJ JJJpJJ FF_#`JsFF#C`#``F(FuF(F`h3B8F`#B``pob0Fpв@@COѲ0C@0AAPc!x0z C@FpGpFbBF_#0A00&C#00A0#c##CcC#00#G3#psC3C s00CSCC00##00#C@00#xsCHs00C#00_C_ >Hjop d&0Cs00_> H C _#0!F(Fp@oJ J]hkhGo%pG#p\ ,:B݌\ ,FEB D2B!#CTp3B]4o-MFFFiF ?J h(W #F\FF#4M0#B0OAOcrɲC7N_hip!qir !* !(p2Ivppg XFOw._H$F DTF@JH$p@CqdDpp p q q#rs#0#R r s qBss0-MFFF7iF1ZzWK z h(Hi #FF#KL_0O0z3BsF8FAF8!*Fi F 0SF  A h^FF!F(U Owi0BOC| ۲O( O`Acpk#qzCq #0#J  pp'r0hrC "q "cpk #"u&rH FFppq 0DVl@J-MF aP(FrFL0BĀ4 _ Oq#!"Q0R0T0#!0"#!p_Iap(F!Fh `b0 (@73x+00"+#IU0"I "I 0OQ00R0#!O @!p`pa(F!F F(H ;ѝU0+@" F{A##00#!F(F0(@р SxxyA!x AAxAaSy @ y@@y@`{C #{C C6O^N" F<%##p0!F[cp #0#(F0eF(@ PxxC#xCCxCc3ВyC #yC CCc?!!?""?A!!/!!?4## !0JT0;F##(FO3'Ib#o'F )"Cr rU0 0<BClk0F<Fz_zVE%BMѧ՝zzE%BDf{_{ֈE%B;%{_{E%B2ՖzyB,Ѧz]yB&e{yB y+o'P{KyBՐ{yB ѥ{yB`|xXBXA  0 hkjGo%pGFJ[ xppG@JF0 hkh]$`6F F!FGpo%-M0yF:hF8jKt pF(0rF%Fh7L܀,>,B"єh,<,B5;h+?v FH 'H$Kx< Fqh F0FFH5j,>H#50cl F?Cy Fnjh,<,3Bcl F*Cy FYj@JJlQJJJJpF"F(FiFi(F,Y20 i F#`p@AOb F| a,Yps FFFD_(3F*F Fpokp(#` FF :A@C烈0][#F$RO a`3B08PDT:[h_!Կ_OBT:Za#:_T*S`_"%T:`T:h_=H_"2%T:`T:[h_BpV=HO08 K:J9Jpj#OUAT4XBRDp3+"OUX6CDSPD2*H JRJpF`"%&#hB F pV]5-MF F FBF"HMO (O@F!?"hTh$bbatebf`#`e`->5D`O F!?cihZ``iaiO1!?MuJ-MPE@ T?!?@:0@ p_zH:3HH:IO4 F0_@@ O4$ H:3H:H*.տ_#00_&@ ?!?1@:@`@ $?!?.@_#00_տ_#O40{@:Ozp0 _"ZS 63Q#0+@$_ p'O F!?ci"h$4uKuHS"`iO!?h"ջ%|1E! [!h! C`0D| : `iO!?ah$|" `iO0F!?4h$0+|0;B h[ph qj(@3[D 00$0 >K"FS$>HD=KS$@ 0Buљs 0+l0+n O&?1FPFE0 #B^њ0+Z01FCC0PF *ӲM+~+i&*? @@*R& ZE@ 0XF06 .њ0۲+IPBX X D@D ~i9J9JJ9J9JTJ#$00+0 0S:#:_T*S` _T:b:EF0:#00 `O1!?0 0S:# :_T*S` _T:b:E0:0 `O1!?] 0ah 3T_ y$Fbh#hB (chT" Qj)3Pic`-M hFiFSiFiiPCH:3vHO3FSb \O{C#~Z#~eHdH"~X)vb:Db`chR`##v_cv838#bCYCC OhOXHRh<B HB8%H@Pc~+#~+ڲ0#uuO#?F F,л6л%лeb1!+a#,`+b$B-"~Q(F%HU3@+"OqHq 1.)eb0"HU>ebYFqHq 1 OX b l( N/30@("(F :hJЂ+<Ѐ+N%\XгSУ+T:4h_DoGܳoo@#2B9)65555۳ocoѿ_O2T:+#%"EDFFBF"F8FIYs#T:m_##%"`)%"_O2T:e9)S!nJnJ/nJ/nJ/nJ/nJ/nJnJ/nJ/nJ/nJ/nJ/nJ/nJ/nJnJnJoJoJ+oJ_T:4#`_T:4#_T:4Os_T:4O3_T:4O3_T:4O#_T:4O#_T:4O_T:4#T*h_b_"T: D`Y_T:4OsT:4h_D_T:D"p9 + ++ԮBE(BF*(" H% BE(BF*("H@BE(BF*("HRJJJJ@3BBE(BF *( "$HT:l_B p!Ap!qCqqT:l_xq)#rBE(BFxB(FHA r#xCr1pr"p%)#"F1F;FXFNFpJFFF(F'Oq'qPDFTjF@ (Or!@ ?!?'(F(yO3@RHzSdB8B0B9BD1 B@E91:_%T:b_T:b@*_T:a_B/"T:d_RT:`bZc_ObT:Zd#HZ:_T*S`_JT:Za_T:B`_S"T:ap[1h_H(Fo oRJFD(PD@ o8FF(F[@01PD 8 8@8-MF F'PF{F;F|J}Il @OAh (o (FF+QF FJOJ. XDF&дSF!hbh heH% XD (@=FSF\J]I+  2E+%[+FVJWIl yOAO  (ЪF+QF F (O A 8DF(0\SF!hbh hBH 8D 8,W#hbhh9H/F<+F!hbh h4Hk+F,J,ISF*J*I+  2E+[H"AF F4F( FGF(?G@F@(д#hbhhH<[F!hbh hHwU[F J I J I J I4#hbhhHeLJI"J[JRJLJLJcJ cJSJSJRJdSJF+@"bP Z` I J6( F``/JJJF JD+@?zJ+J+d9FF FPF | F#DFuh[h_?_hS`hh_U A8+Ozxf>9FmPF i FehL@E `9F+d3hh_C@_h` "hBsF0(#FHh[h_<_ "hZ`5C _h`OBhF:K0(8H!!h[h_տ_ "hZ`(c+ ?D!?'H(F(3(@+4 +3 + [@"# #P+(Р+# !@ n"@ C f9F F OO0 B##7JJVJFF,F$O0pG-MF, tF+>h#B@?#0, cxFK+B3"B<л9лoHB@#EہBػoo#9#9O0boix)+ѹNOzp5xYB:F*Fyy5FC#BFF 3(F<1 1GF(лoZHB6@#EB3B@#3Eh_!*xxB"*6*$*@B!~q!  B@.CS_o3`oл#Ozp0/:F"yyC#BFFxxC# **5*fsMOzp oB>FyyB$B4F,8"F)F`2gNOzp'0D00B=Fyy,FC#BF۲+?/YJOzpR#PWJVyyB$B 1EA(ڳ a/Br;F l  p1FF UB 8HGYF6H@z RF1FiXF#GF+۸hh6иh5*i 3Fw #!HϱH 9F   Ozs JHH1FH HI FJ Z(JrJJ@JPJ\JJJJJJhVJJJ QJ8F+F* !h`h`- hHQ8 8O0 8JFF F@K -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF *F1FF@F#tTFPF.F#HSͱH)FOzs J H H%FO4JJJJhVJpF+F"hhh7F Kh.Ahh FpHO4$PJ*DJ*F hXhHh8 O0 *FhXh8h hH O0 J*F hXhP!ih8 O0 HO&$ MO> HE HB +hC,,!:!8Fjh4D5J@JJJhVJHpGJJhrBЈBξpGHJ7%L#!hq( Hc !hq 0)F+F*Fq!hq HJ%JiF|@ ]t Fh 2O0 KFh(h0" O0HJ"!Fhg F@-M(F)hK[lihi D# BBOAڴ cC+sO0  B Br;B22*B@`*+<'F *O3  BA'?? CF[(+`Z`^ YFYFFYC2 BBO \F`*E" BB &*SF??8 BB(AFAr 3D3 3 C+Fc\FYFf CF(?FD+D  J?? CF(?O5*!BFG0F Hhh HhP EE0O0HJDJ-E FFFF(QF HO0X2F F+F*%JFhFFC#BBiB FC9F@  `P;F"0F)F(( F2 e'a 牊F@)OhjFpG-MFFFCli@ )FF*F!Dj 03 Fg CliO iYF 5 (si?8FFF SDDO|   L [F@L(аi P 0 )FlF( FAF|jF8FFQF\QFD8F FMCi 0 Oq@  C+*F# !Cm8 |-ML#hFiF 3FBli:j]k.<Y #h$O i(7 3@;FO 23 B:BO1 F1B XE)" 2Rh  @C"@F@ CpFwxBhEF!D@F H$@F o E ڭh@F(D2  W+$@F,OlN ZEhۺ5!F@ F"FQF|aHO0O2^K`^K`tmB2h9Х  ##F"L(QH8 BPFO1O HJ@ `!Fd"FQF33` AH@m@03h K S+l 1YE 〫2!F@ 9F"FQF,HO2&K`&K`m BOХ  #3h"L#F*(9HgT0BPFO1#J@ `!F3`0#F"FF@HJ _J@J"_J<JJ_JV_J_J_Jm@0O:!F@ F"FQFѾHO2K`K`AFVF[ 0ಀFB:h:Х  ##F"L H0BPFO1#J@ `!F;`0x#F"FFF@3hS(0@0;hS*H31!F@ MF"FQFчHO2K`K`;n B9Х  #3h"L#F> yH|ر0BPFO1#qJ@ `!F3`0 #F"FF@;n@0\O9!F@ F"FQF[H?O2RK`RK`3h8S 0 FB;Х  #;h"L#F GH0BPFEO1#9J@ `!F;`0#F"FFq@3hS*0@03Nf!F@ F"FQFTO2)K`)K`AF[ 3h@BAF[!F  "#F@Lh(;hS(0@03hS"`8J`J4JJS`J`J<JJ`J`JaJ0J,J JD0BPFO1# J@ `!F3`0 #F"FF?@,J JL hH#J#``O2K`L hH}#J#``O2 K` L hHp# J#``O2 K`@J<JJ8J4JJ0J,J J8 M L(h8!h)qq#+` hC##`8@DJHJ-MF0F FF#`hhB!$#O 40F[FhXEۻs)FzHh|( +irЭ `h;h0F[F(3ی!@ LF"YFL3hh#`i+k+@O O+G~O F0h"+ F k#0pCOyDHJhhBHE FhD`e O/9HOO6HM4H-Uи6J-MFFFŠi;?2F?1!?F1F ?(?B F 7F BF!XF{`(FO00FAFeDB F2FFFXF@EѪDBCDF!?2"?F2F ?%?*FXF(F"F)F0F0F*KFhFFO4 Fi@ ?1!?F(F! n(O4(F@")F F㊻ #@!F"3`8F3h4 +O!F H$dB#$4 H #$3`"!FH(#JLaJUaJ^aJ-E F FF(:`h (`b 604 `30C#b+Уj7J hb00.h+Pb ,0iE%-0B)F)HC(Ho8F?O2!H (OC $Ѩ acbO3a#O?1@ !?< `(4`cjs``cj`#sa201)F @ b@D #a`J%J%J%J-M?FFFF0F?#?F3F ? +?  BF 7F)FXF sZF!0F{`({hFO0 FDBF*FFF0FhPEѸ0DCCDF !?#?F3F ?(?@F"F)F@FBF!0FA(F8FhhŊrdiiCDh , kCi!Dy Ho8jdB(,FicC)D 3J8iF "!(FD#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IFc(Fi8(O0+\.+oOT)F0F0FOqo F,!F=(4QJ-EFF%@NO., ,!FPF%x# Ԥa+@5B(F_$pJ-EFFFO O#FEFxZ-B F 8 DEх/*\*FFxF/)F\)F)SFB L#<`DF;#x%F +.+kx[.+ѫx;(F"8(DB5`K;`x +.+)8J-MChF+FF[ + +gф@FhDCF#@FYCF FiBOh B(F8 2(?ۨZFAFPD(7a#skh+3 +, +-(hD/00OA@/S/"pC 0+h 3C# @FDDCDF+hC$`+h#`  0(h00C3 0(hZ!R)hZCR۲ 0(hֲ00"C# 0(hZ!R)h 0(h 00C 0-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F%4F;FpFFL!F(F4(F"F1F Fp-MMvAh )!  ÊF D !  AC+ͱ-ch +mKB 3B)F Fch +OS +OsBOso@sSC-$F2F%WO` 2B ahr )&Op@|)`FE0QF F$chF +!+@sB(@VOcSE@QUFF8FOsB(@@Os@E(@86K )M)@ OpE[b2F3FCBAHQF F BF=bh *)*@rB4(ObB@FF )Op@w)8F HOrB(݀OrJB (ԀBF !B A  ` b B s<  c C_ФO:h*ZCi#X@Ev*.@@F @π SC :FYC SCB[DfDXN2h㊘BFBF9F0h*2h㊘B9D1B1  CBvbh *Os@q* FBOFFRO1@ 8`(kXHO0c BAMN2h %㊘B0h:F@D2h7㊘B cXDD@9L6K9Fh3Kh⊐BfDD3 BI#'KQF FYbhF *Os@q* FB)F Foch + + +opE*FQF FK@uOucv7&1F FX6XJcJch +3 ^.:㊧iw3DZKhB+XH)&QF Fbh *Os@q* FB?QF F%FFQF F=5FIK'izFFOzWFBw i F(2[A2ch +Y+Z +opE*FAFYAF FBBEF/i Fr(!G!aD-ch +)+OsOcBWF.F(bh **OrObBJFJ@uOuK\JcJi?3#?@3 N ?"0`$?HE"F! (#O53`(FF"IpF(" I6("IR(J`Jw&JJJiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1FN(#hsC;`hci`"hSh + 1`ӊjKCB##aiD h(`#h[h ++OsOcBKiFa [ ;0ix+;ai 3a-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@FU#41CFF+#{@Fi#z.#>F;"0F5#{!0FT#;q7F;x6":p,1+Aх,!<1+A }iF& F  6. Ui6 .! 1) & &  ?RAFkF2FF@F(F"F(?@ZFa+#,1<-MF FFz+x.FF5/+\+0F8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FP<1SEBFQF0F(iz!F FJJpF Fv F@(F< ix p<1B1F(F(-EF'F!}Q 2CWPB߲OlFEF "! F#`F3iBFApp!2+Qp3+" F3q"Dss!ZC*< #F 2 * 2 x"wӹ"!"DwQw3"C3B#5%prE@gs#p(F- 5w#*%prgs 4pp2qZq!F "ii= h F H  " & H@+@"J[+Jn+JsJ~+J+JpIF@ FiFF@"1F FFS FP@ p@-AFF@ IFhiFF0"AF(F/iF(FFh"AF(FF3F$6(F F iiFo @-MIFT@ FFg(G(n"AF(ci )iOOOHBz. ,C-tuJBtF FBz3hkj3CRFBx+F?O@!?FFXO3!F(FeJeH + +OsOcB]CFF!FD0VHXFPh  j XF?1J1U!FD(F ++OsOcBҢFEv+F!F2[H2-KQFlBE[F!Fر'H(~ **OrObBr FCFJ! Aq! [DQFh3(FP + +OsOcBD FKo ,@+J+J#"# ]𵇰 ggF~F)FH, FY&J-AFF@ IF!Jx@Fq%FP"9F@FF8Z(FW5` Fo pFp F+(6Or!0Fym1zaى01dي(1!X@ ! z !#`i`#.`poF F@pG0F RFh0(F0 I0l F0&J-MFڰ!F0"Fd FF( = 8FVF(9F9FXH\o $@F FXFZ@ OIF(UF(IK ` F"EF FDH. FFHiziѶ??iЪBAb af*Fb3F,(?/Ho FFUD9F F [ YF Fxi "!8Fv0 +Oѻ{ # "8Fri9F F oF(lWH FFao ^o [o Xo ^+J@\J+J ,J",J0  EE0-EF0"! FFvHo $ F@F(FiF?kI8F/XjI*F(hH`o@ eIF(gF( `K9F` F"XF8F9F[HAo F9F 9FVH4izN 8 0")FPF@ KIF@u(Fro UF!F1żŜ#L@ YC?1!?Q8FO35F8F.`B8F?-)F.H5%hijhY *(F61D(Fd(#HoGajhBѣj"jaaz* F FF2 FF(+xs&@> FF( F(z&J8J QJ&J@\J+J&J&J",J0"-MFذ!  FF( ?8FXFP9FF@9FH_%o.F@ }IF( cFwK`QF"0FSFFQFrH<@F 0F(F FX0FF8fH%F!osi+:9F0F|!F0F6(@,8i5h "! Fkh +OѣO0 "ca F FpD @ WC?!?Fȹo DI(CI(o9F0FrF(Ќ:F!Y "8I(F "7I  +riʱ# *#kO{"#QF{  'H] sh * 0 * QFC k "#{ (Hpo00FF+FFO4&F}+J@\J+J-&JJJA&JM&J ,J",J-MF F豁i?$?@4 $h 1B 2pJJpFH0F0F F$E&BAO p8F. F%iu: M(F8<0+#<0/ Fm<0+%M-EF FF9 Kh+ L L F'U'PF(@,tњ<0PF2{E #U# <Q!<nFFB:3`JF)(!K`%@J-AFFFFF+i+.O31bBr SOX@1@@As+H # Hc<08FO0FOpFFF\2F+F FFlFpHJhFBh BpGJFFFT_BH "1F$=` -hH7FFXiB #S```D` F0LF FF&HqJhFBhЌB")FF(#3`HT BАJ```C`)F F(i3` O`MHe0FH F JȑJJJ-AFFFFFP(F(9F F8HWBhB hB #$S`F` `L`z FAFHpFFF3F*F FFFp-EF FN3hFBh@q 2[O3B(jCR!5 FEнFR9FB?hЎF^FEE"F 01}J-AF#FFF #`+` KB*F X+hBF9F0F#`HsFFF>*F F3FFLFp-MF FF(4(L< F)h(F.!F" F ,&FFREN+h3D+`IP*O iFBFҀE (h8/FQ 9`  LȐJ-MFFFF*D.# `#FF[/ ZEhѰ+;2HihBѼаB-H! #"F iEh2`! (<+j(bC``0hz3``.) )+#iE"i* "hhqFh)#$hhBhREiB Fi0H -EFF FF?񱞹- FQFF@JKBFD F- ---L -0-@F(8F(DECF:F1F3F-MF@FFF(60FF(𥀏(F2F9Fټ `\` F hL FL8FFg*F FFhhB#S`` ``` Fi(F8-EF(H&ULԱ"AF FU- I FF+Ix+L F6"SF!F8FF5,6>FRZh8hLȐJQ ]pGQK FFF@pGF&UU, F56>FRZhF". HhB# FS``!`a`L pQ ]pGQK FFF@pG02KhFk F(|+IF0i*k+n%Ij#$IFG)abaPbFhKh2K`D KM`#a;)FjGF1k"Fo#FGFJJJJ0F(FF##I(FF!#i++IF0k{(FkGF) F!IJ#O>Khn]0J-MF#F+7+2PFH(,0+',@!F"FIF@F(tF0O8F BF(]@u RD BR!j(Pv @F0 GFUW  RD BR ] 0@FG?/  F(\@rD (F!FBR^KBhX# F`5F5FUO"F(FTIh+F(FQI(8, AF(F-F.m pXFGF>KB@@r !F CS0F ( XF` GFg P*JAF(Fh,&J;FAF(Fh `!J3FAF(FhOJ3FAF(Fh/%FK2F)Fh F\@sD6 (F!FFR/P J` OXJ JJ0JJ-A FF!e#F(F+FIF@ܹUBF9F0F3hGF4LIBF9F0FshGF)#*F(FI) FJ-MFF@FFF(z#" ;IFD7L+Eձ+x+>'F3S/O &7FO E$R/S$ FR*hB !B*h*F@Fw7  !EP*)*F@Ff7  FZE,F[_E;i 1F#*Fh~F!F F?hLJFFF"F(FFF:F1F(FFH"F#!F(FRl F-AFFFaw## F F'I FR&#i++ !N F\0FKhBѥifj` + FG0F!H#ji`9F "jV(#j:FAFhOifj`##b縑JJ%J8LOq"F 8F J KDh LBb Jb 2bbc H F(F8TJJ0JJ0JxJp#"IHp !0J 02F I F pF2F(FX!F稐J̺J^JFFQa!%!F@il`aH"K`aJXJKpeJ8F44s V(` 8B  FX,h!l!HKue JXJ-AFO FF~h= #sC JIhBXBa Hj FLLXJpJ2J%  F K` JR1 [hHN HGXJJJ'J F JhBH !K3h+T`B XJpJ "KH` % XJ'JHF4$ FLF3L Fgh.[-YO1(F0F(PO2)F1F 0F #!"J="5(Ft F (#i,( (#hhB(#iPh$3#a#i(`B+;#a So(h3h+;`3`#a`LLXJpJ 8F F5, JhFBh M"(F8B%# FS``%`e`(JF FFFܱձϱƱ! YFKgaZh\`#`b``4`$ FLL(J p FFF KhB Hp #cC Hh*X3`% #Ch+` XJpJx1H$+-Hp@zF([+ &(;+,$R+ 0; +U$ 3E$0,VHO.K1-!J\a`h*ZhBhBZi*iBhB"b"aaK`"Z`pJJpJXJOC `8 L ` hB  ` hC ` *+( hC `;(F~( I%F(F%FF& '9, /, 0<FF%;,0FI-%FJM+x3Kh@([(VL?`` r?#++S+؈Ich@CCc` +Bp=HO([(+(@Ӏ F(O(!08XvE8("chCCc`#lO >hb+pB@+x+[1+R#A J J J7 J J J7 J7 J7 J7 J7 J7 J7 J7 J7 J7 J J J J J7 J J7 J J(H(:0(s1+?nR# J J J J J J J J J7 J7 J7 J7 J7 J7 J7 J J J J J7 J J7 J J~(8 l j&8g'8@84(2( ܠ0+?!8~( P8 J F BKc`#Ch"hB hbhBsiHG6h2JJJ(J 8F F M+x F$" IK,ph<@ F8LLJJJm@pF Fa-B,@!M~)xA F "@Lg FpJ0F+ + + +Y)Vhz &&B@3 )`3SȄ$K,ph<@LJJJ 1@#𵅰%O&K&N'J'I'H(KFF(6#H*F"I!HF`F!OpJF(H0 FhM`!FJHFH2"#!(hF(HHJؑJJ0JJ0JJJȐJJ$JJ JPJyJJFF F0"Fu 8F%\#hK F>(!('( id(v(C(Ѥi5i%5i#j[h[hC+b++ 55i 58-MFFFjF)F0Fi3z+p0_O(ONOl=""p"bp"p"cr0 r#s0cs0s0s0#t 0pct 0rt 0 t 0#u 0cu0u0u O"pO!bpO*cr0#s0pcs0ps0s0#t 0ct 0 rt 0rt 0 #u 0cu0u0u3z+##(0n+ +"@F)*"@F)0"@Fp"AF)0_()FHJpF F9 h+F>((>'(Иid(v(C(ѩi FF(Fu F"ZI4 Fpi FF(Fz##p #!cp%#F&pp "0F*"0F)u#%4AjF IPO2!F F FIF DJ-M F xF) Y9bx) z)bx**@!(FFcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(FcG"I^xx.C#*0FIO$D4B0FI>0FAF/7D*bz#z`yC#zzCC"yCcB"yIBByBb (FD#(F+p !nS+)x|3yyuIC#cy"y(Fayyy"yC#B"mI"mIlK cz"za{B"zzBB#{&|C#{BbCC{(FCc_Ib|.*0 ,YIYI0F|D* R,TITI0F5ycy"yQIq$0PI+ #.0F/AF|BDє$ FIs#.zyayy"yfzC#$zB"(F lv([XFF lmF(Q/@XFw(X&e%F(F F%=FXF[o8F)9FB(Fx.+0F1FB(F.FCEF)/*@FAFB8F  XF l( FY"#XF#`&#XFI#e |&JHJ;,J>,JA,J QJ8F(lh$d(n7(F F8$8Fl FH8)Fhx(-AFFFFN"0F0I>(Yh/!0F FQ/K2BOAD1"m CsR BL< FPO1@FP0|F AFO2e1F8F (8F8F FF(BBLLLJ p FFFHA:m;m& hl:Hp+h1F0h# (*`1B2 HHH8 FF(FhF he`s(F8MpF FF2F)F FF FpFrzX@FOEFLO@<SE-=b5E 0F"{Fh< J-EFFF'3+'9H\@<SE(H"AF FXc|"|B"3B2 Hh8F1 (FJpF%iBp#S```E`pF%hBp#S``hh`E`S````mF& ,jB F# FS``&`f`W-MFJ| |C#|CC|CcB$x + [; + & + FgD~L F! F(Հ"!F0ia#` FH'cz%zE%zEEzEe%DE8! F(|9F ha(\Д,0- .C#+ `(NO /aczJ*zJJzJjDE3FS/U`#h5aB`+x[+hO1@@75EF0+++ji FB+jiR+ O1F @   O 2Lhhi (FX*L*L ;P+&L +FHO`@```by#y C#Esj ubE B* (F8(F(FILRFYF0h J`;`x``PhS````#  JpF F )FFF0F /0(];(а@ p  FFFY F1j H;h#b HT_BZH0Fh(-h -EFFF )0F :$HhBظ.HFZ_UE8FhxhB+iB٧9FhiFH*ihi?!8Dna@FF(kiD -h -AFFFn FF HT_B@Fh+iBjiC;R#P-(F3hFB0`^HF)F}4`T -h-E FFF- F >H+h#5H'FOWE+hE%H N0D%iO;4FB%%p(FBh F h 2-hD-AF',iDEѽ&#S``'`g`#i`iBzhw FtP&o6F F F#S``##`c` F@W F FzH F  FFF&M(F( KFZhX``#B```aCaaa bCb M)FF( Ft`4`J OeHFFC0F T(L FN&Lc|%|E%|EE|Ee%DB!F0F{F6x +; +R#:J5:J:J:J5:J5:J5:J5:J:J5:J+8FD0F0F0F0 )F )"# # +H -"#"#J-MFttPpEEѽhB-h"QF iXF j9j:H D T9jBӻj DB Ha 9iH H 6hJJJJJ&JhVJ?)EM#BkB XDPSB `H-MFF!FFF8JR;SHH $@FBѪD("JCFBH "0 :FB@ #)BX+kPF\7\00F,0!k0 FnH gR RR DB8F(:jD(000#DrD F'>Z? F!?1# @,0(`0 PK*F@ BkkPF\\00F,0!k0 F(ЫjD(000=HsW ,W\JBW ! D*FWW  DD8(?DB_h/? cF<+h D  *  bZBbR?bZ*DbX*DbPbXR@bPH @r!A FBRLJqJJ JJ ,JNJ7 FFI(iE0H縑J-AhF+F HJx xC#xCCxCc`+h;+`Jy yC#+h;+``)h FI9 hC2p/*h3B*`BEDAF F`(+hDD+`8F4aBBЈBA pG pGO0pGO;hBHpEqF6FV$EBqқhHKBKAB cFJ-MD0,F FXFCMJ0!h 3`,F1,O2# ##u1bu`qbKhKB!CBB@'J ShIV`#J`$Kh ,""OCCCS$ J#CS @Ez𓀤Eph)@Ez<Bs'FAF<FFEz-ӢBs#S``#(F+`k`O7aGWC3xh$ DT qqC0! 5F Ǽ0000O4hDT Ckh0P c O3C SO22(-h(,?O2O<BRB]EQE+ѥhhB'jjjjBBH k e#S``#`C`F8FKhBM,hB jX" I %0 F $hHH,JJ?JpJ8J7@u RCOC `BR n0-MFDKFBF~.|(O2@(i(tO>;HhFBh9Hh)E-EU$ AE~ #c# FeE hШh(E-EU$ @B~ <FuFeTEuE * F)F(HHoJ sF"F FpT N"F+F I H Hp#2FF)F FK(FJLJ-M@vFHF,## - DTEU-O8H x=J:8@F Bzӷ_"F (*F(CA;K {Bl 6aA K6 FV V22Fy*j j R O1AQ$Ke8FFF  )`@s@1@ FVkF2F9F$ (JKdL@r@c@#@1Hʑd}F"!@ TeTK@E@uEBBE"F I H H"#D#!2F@ʑd}JlJFH$th bE("TC`` #+`B")(<E(џ rF4(ĕKh;`HJ,J&``3F F2F hFKFB9h*F(1 9`5F`FF)h8FF(hW.` F-MF x@s"d e$%A Bz9"O f O;K[. ZF(FQF,Bx  "'(F'QFZF BxOOf BR8FAF H7 d$! 0klm EA07@s$!LM8 @(@:D BR!F#F#H J(@*@!F#F F0JJ! F(4'%#&Gpp"Ipp8Df##u#cuKuu KO K"FK8FKIK KKKKKK;ha H爒JHJhJ0JtJxJJȐJJJJ(JJ JؐJ NFO4hB j"9F p F- -#FFF.$h#FFFCpJHJHH! `"H"ZOsK`]HJ pG-MFF FFz.MM(F'-)F Fn"GKF`GKF`FK9F`FB-* @DE,;FOE3#B_F:hD*j%<@:i<Dh7Ka=W5H6Kb6Kb%9F FGh3(2)Di;=1 FG$hBiBR$dH "Hh OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33JJJpJJxJJJJJ.(K`O0J9M,h,i F(aF(\1O#0J1I1HF(LF+I,H+KB*"####J#I#&HFtF6F`F@F .FFF;!8F p H #" IC HF( H ,` FJJJJ:JTJJFO1FFF0@O2!F+F!J 9O2p ;JFF&%DB (.(~I`_#&;+0Fp))H (J;J$FFF KB 8](@83%0#%0@ʻ4J F<4@. pFF>=65OC FpF(B$O4 F{<4@ @7+"C  FhF?([(*(7(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-B%hFB8F F)F FF F8FFFF#(F"F;F1F$F#h#`(FFFFF,#"F1F;F(FF FLpF FF2F)F FF Fp FFFF L F,8L;F2F)F FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI HzF Fp H 4JJJJJJڱJJ-AMFF$FO20F)hX"8Fih ( #h4,  J-AOFFBFFFKB(hEFh+FBF9F0F( F#+`$ FDF8M,h4+hiDBch[  3+*"h2D# FA8@J0"! F M!FOB(`~"+ha!#FE@ JZF@F!J HPF F0UbEfiVaJQJ%J`L#h3 H H#z ! Jch u h "(HJJJJ#-M`OA F(qFDF'K EJ٫:F 0FO"F F1F4)JFB0@(FF0F "F(ch2#F#`3SD#FFK"#d# #AF# C@`#CKUbEfiVa p"kF;Fe"#e H(#BBLH 1 F pJJ-M2CFF1H 0H/I/KBB"i)F :fiB#iDB  O18FzFF+hS "9FPF##QF28F9FH ~ QF8F@"YFPF kh+h3D&JUbEfiVaJJOA kF(H NHOB#!F#H"#F(#*s H 0 F iBBH FO(J JJJ-MFL FF PN0F *)*"FPFj@F&@㱵OXQF8F pF ,5qah)m۸ѩBOOahi@1A-0Ѹ+ Feh>-A$Kh+=:*<Ѹ9( 0 !" ! ф* 2k.##h*FQF8FF F.k (&bN`N^J8FFCr##Cr## 8HKcKCcKcKd׾xJJJJJ70@?H $#FFF2@ؾ;JFKh)K#!"#8JK!#JH~FH F8JWJJ  -MFFv! FF(/1F(F/mF(aXFRIF([#F#FF(PAFPF g@F2;B22{mAK#"fg9K"o:I:F((.7+z+4 "!@F3Kcb3Kb3Kb3K#cck{D0#E0#did"e@.3"b` + FAXF$7 g2;B22;F1F(F(a(1F"o(FIFg Fv(F0"b`Kh2zm*h`jhrZ`HJhJȐJWJIYJ1ZJWJ XJJ-MF FF(^ЂhhBVSy+Ui;Qh@@1B  #BA ikL/@FFU `M(O{2F;FU FhKEF FU .2F;FLLLLL  IuXi(hy8 ] JF  "F!FF, FIG(iXJ-MMh(F( (Fh%+/(FFChCih8H !FFP2JihBF0H O0)F F0 o FU4O<<<B F!( FzF FtYFF(i2CahH72FCF(!F0Fc 0oi0Fk<<`JsJȐJJ7Mh(FJ(!(FF(F+h%+oB!(F F0M( !(FF(O4$ x]|HpGHpGHpGHpGHpGHpGHpGHpGHpGHpG )p FٱoN4h,K FhFDcBX\B KhS$KhC$P3h33`pHJLJTJPJ FR#lh+ M/h K N3` U+h7`C"clCcdKh< @MHJ]J8J<J)?HF FFF'3x+;lh;+ "!F(F#+p^#lppsxpx+qxkq FLLLHHH8Fu+lhl"Kldh<@+l` F8LL<JpFFF"#lh+cl3`#cdK h*`$` FpLLL\J-MFFFz-t+q.o+lh+m+m0+i7O܀9h R! {J{D$,)"d +"F #"FD~ %L9h"h0hR! B "L2`I F "d0S!_;h"hR# 32`ZBXSB;`0;03"Kh< $kl#kd L L L LHJLJTJPJ<J-MFFFF(R-D,Bжo?+lhB9ﱻ7к4кB2Ѹ x"YF F"AF0[#s#cs+lh۱+O!F2F8h1F8h K`$klCkd FLLLLXJ\J8Fx+lh+$ A"Kldh<@+l`} F8LLL<J8FPm+lhc$ K`+l`[ F8LLHJ8F2+lh;+ $ ? K` B +l` L0 F8"Kldh<@+l`LLHJ<JF#lh*"`" FFF FLLLHpGHpGpLF#hFOb! ho2F)FOb h Kh@pO` `(Ob!h$`JDJ-M F(B( NOM0`0Oa 8`$0h58h4`1+h3+hY4*,(h%wKwLh vH ?0 ?8`! (`($O`+hHY+4,! cK`(0h0hbIF(@4h/]IF FF(@0hYI$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUp'J-AF FF8#x/+6BF/! F "(FF!F8FF88F(DFFBBРF04/+/!@F (F4F)FBF8FL(F%o8FF F !FF(F8@8FF F !FF(F8@-MFFFFۻo F$E?o=I]/):BۚBȿ"DB!FPFFFS[Ex/"6]TE B$-ȿ5|U!FPFa ۠E2F{%F&Fb#o -AF FFF-(-O0 Bo BFB3`B@FF8F&(ۄBoBo "(o ]pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FwB"!Fo-AFF FF FB BF!F8F h*F! F  4-D s6FF%B(Fp F1 0DB5o-EFF (F@F %G&DBO5 F1 0 E ظBTF5:FAF F R(oFF0 +`$ FDB-O3 F1 C#DB-o-(`F?FJ"FQ@ )J-A#)F Fo F4F(shB0FA(O'F%F0FAF+E' (o 8(>S uJ7uJCuJtJ_uJ_uJ_uJ_uJ uJ-o 5$-AF0Fx++筱= ''kFAF0F(FFo o  FC*B*F  po-AFFFF F B(F "F9F*F0Fo#F CF F`F(  K@BS K(FpGHpGHpGHpG$J*Ju*J*Ji'+لhD$Bh"DB jBh XB   8F(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(F wO S#ah2F )D6? k`fbh*j )D ``+j#b-M0FF[-@Fh?!j'DBFF 8FF'.Nۡh )D3!D#" F 3FpG@F#j;#b(F!jsh QD F!D8Fp"jD"b FAF^VF'FO@r06`0` S`5F-MF FFFع(FD.i"F6#(F FXQ#?O` F-AFFiF(FB 6#F(F)DA"O4 F-AFFFFp:F1F(FF B:F#F1F(F)0 #(F @$@ 3 `CF3FF(&2F)F Fp-M0FFFFTFZFQF0FF  2YF0F#"йBF9Fk`XD FZFCFQF0F BF9F 0FFFFFH:F1F(F[FF F2"#F(F 2YF-MF FFF(;CFRF)F F(6C1)F F FYF8(٥h-]Df'"1F F%OscQ4F:F FBFQF FOsXF>Ds`opFFFF"FF1F(Fp@pFF1F FM( ۣh F!Dp@#p-MF FFGh(0(Fki+OkjAFZF(FO2F!F(FOSca6cbf` #(F ((+j ( DDE  B ?/DB Bo'F[FBF9F(FRF9F FK6#`OScaOSf`ai a 8FF FkcjB!F Fth"jDc`(F8F;(h(o ]o JC o &JJC *J𵅰FFFFoF(hco$:F1F(F@opFFJF FC+3F!F(FJC+!F(F(F p2F!F(F(!F(F\(JV(J-MFFFFX(F F(FO )F F F  р 1F F FX AoZ(0"   :D F# 1FF F( CE)F F ")F F1FF FC(F;F*F F()F Fk-AFF$FFAF8FJ`+ohZЫkFAF8FJFXF0F,( 3o0F-,`UJUJ-AFFFFFF(F AF(F(F !F(FFA1(9F0F"(!F(F"!F(F9FFF0FBF9F0FRC(F#F*F0F(!F(Fo -MF FiB(Fb;XF *F(FF (F(@(FI -g4(FIFF4!(FFD.Հ!(FJ!XFJCF!XFJdF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFhx# #h02(!F? =O07 F F`0(=7 F$ F0n(4=(ݰo4?447FFh# #hp0G(!F? =O0(ܠA+ 0pGBXpG3*pGKJ(ܠa+ 8pGBpG3Z*pGKJpF$B 5`104.pO1z0@pF0FF$ Fp2F)Fp$?&: F5;,\Go#Wsw3 ap1aAp?acpp0$)F Fk+;o F g??{cCpFXAoӣ\Ao?# ap?acApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4 F0M\B0K$5@`@JF FF @" F F +h$ FphF F"!0FQ#3p#p$spp+h 3+`phFF F "! F: ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a 0Fi#Z`8F1F F3,a FU0D7gJFh_F F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`hJgJhFF"!F F"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(`qJ wJgJ;'JhFF"!F FH##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`hJgJgJgJ wJhJ-AF0HFF&4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF(FII`v(Fvhh3bx3hD3`(F IqSeJhJgJgJgJ wJgJgJJhFF2"F F!~##p0#pcp'p``#+a#cq#Oq9F(F@9Fq(F;##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`gJ-MO6m  #*IlF%FF"4$! F%.3#0F)F[;GoEF/D$" FIT%#"0FIeqG!a0F=)F`u F8 q=F J`JJJsF p$%F0F(-@$ x.*@$5&-0F$^7 FP px+4B p4B0#!DB Dx#@ @C0K#DOsB  -AFFFFlF5F2F)F8FG(%`-h$h-&`6h$h.%`-M hFB FFk% T"!PFKch`#hcFB0VTl%F.EFEhF"F`[+B.%.F#HFT<AF8F"FK,65FZ& "AF8FF6F1F8FG(.`u`6h-h.ѽ+`]`-hh+.`*h8FFG+h]`-h+h+,`e`.DJ-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N>DD@k@3DNjsc N8>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ K`3C`)Cc`3`#aCapG#Eg-EFia(CiF$3CaCiTsFCa@ TE"FE8RF59F(F]@ CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@OIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3;3~߯-EhF?`(ChF(3F(C`@ ERF@<"AF(F,CC=,Cc;,<DFE@  aE5҃I!O1T@\ @B2 @B)s%4308< >dEADqD5FDD qEcDY'aE:>F9DADBqD4DDDF oo BDBdyBqF;FF,3F!FFo0F&(o;OG   D՜Yp3<.#F#F>F>.?GKN %9D I LO4%1DI !@J@JAJ-M ! %FF%1)%k!B&$4>h$`OqVh`V$ `N 5P1E5@l6%@l%F!51)ѽ2P>'7/3.5%RP%745D-$B&ѶEtF(4FBO8 F 2 **@𻀺o  0 <EO0 5PUE5 | % @4"O2O  FbF5{=F5B=FBP5P%o,uD /popo ED%O`} /DA <@\=,@\5B] 5B1  E+%*"F%D BB3%@D-Ѻo\h ,hlphPFs"&J&Jd@$J$J%~%`%8P-0OE@'O@O _R 8@B"!F' &EFpH 8BF>@h`0JJ.JJi۱$"aBcOBDa`aZab`\``bbbcccfed Fo8F F*<x1*9<+7o8#ajJbbcj Kcb!B0R#jjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aooJJ8FiCjkk3"cjikjGj"cjiG a8o-M*FFOE xDOsBD<%DB٥E=D@)*DBOsBDOq(F<D@;D%DVS>< #D DDYD D!D !D [D!D D!D!DD!DLDDDDDDDDaDDSDCDsDcD D D#DD2B FOq$(F FOq FW7ASB.?g:F1F)&D>DBP FOq(F FOq FK < DL @ dD+D D#D LDD #D D LDD #D DLDD #D DLDD #D DLDD \ D#DLDD+D,D9;D%D -MF(Fi,ChCh+>#hk + ##` 00k0#"($&0FL1 %ftxo1o hZ ##`/#;?@D5-ٓH3B"FF "a ,`#^F]Fa#`##a#jO2ch0! !K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ɀ;?@D5-+&a`O@#j"`#i"i ,`a%#.F#`-@Ԁ#j^`#i"i a%#.F#`-@ɀ#j#`#j2 `#i"i ,`ya%#.F#`#icр-@#j&d^a#i%.F##`#iX-@FgE(F!"jzihQii D[DBbDRZFQF#iZFQFi:a#l  D#d#l+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFiaDf 0p0jccK"h0*BPkk+@b"ij 0(Ghc(@U##`oK/;?@D5/;?@D5*/;?@D5?"i ,`aA?J?J?J?J"j*?8a5"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiiaDe##`#i- "BгKh"j*Sb/?Q+?@D5%.F"j*@#b"#jc"FF7a4 # /?3;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZFQ  D[D#l #d3/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?b+?@D5-Zf7J=2083$ nB!0Jn+cfd#cecmloJxBF#0+/?-;?@D5 0p0@Fcc 00pkk#+"ؚO3@C3@@cD #0 E /?;?@D5F@m@@;?Y:K#d##`lC##`O>m moJxBF#0/?;?@D5/?+?@D5BO2!l@&D!d@+"ؚO3@C3@@cD #0 E /?v;?@D5F@m@Z Kub@J|@J@JAJ@Jd#D#`l[BO2al@&Dad@jDblB ١KJ/?7+?@D5##`+?*clB!l1D0E?j cDsD( B( F`kDB(F!d9˃B#l ##`D F+?"l+:""`h##`h#i+J##`#/?Ϋ;?@D5-0D0iDabiYD#ia4#i{3iB WK0##`D3F%.F/?;?@D5-iBGK%.Fj+"ij+c@bbpjBhk IӉ#+cjbP]0 *D  2D i2Dahzv D#i2Fi+F?a4#h ;ZBZAch;#k.CD,0++o+k E(FD9DRF  WD2Fhk9D.c+kjSDB#+cjBSDc@J@J@JJC ɾF8xF+x,HRO08`Czz 3 H #xF3-DDxF0-H0BH.8JG8J-IF&K %KF FF<#o"JdFHFHhO4 F 3h ! F+ 1cK ! F)+ H;O43`JJlJrJJFFFhFFe(#"F+F9F0FFGHBo #`O3x KS"pGJJ#+0I@  GJ**J-MFFFFFAF(F#I(FF(FA(Fo.!F(FFB'x/.$D,9F|й1FPF0hFQF(F@E C0F!F(F'J-AFFFnIF(FfF(FO7F,8FjF!F(Ftx/+D<[BF1F,(BF!F(FF'Jp FFPI/*FF# Fp@wpyJl :lH1O0l l(2+J#FU0h F@ ϽO00F#FP0Q"0D"02BF+8 ]-MFFF(o(F%'DB +T;{ B%YF@F}!oYF@FtO3RF@FCB BѻN%O1 O1XF(( 1`FBT;F?5l+ F FF:FT -MF TFF 4 *zC#DBӻQF@F|F&!F8F0`F)FFO3-AFFFFO0AF F(۝00 :F1F F -M(FFFF!F(F!FF(FZF9FF(F0F F F"!3D BO4BEZF9F(F!FF X8D$0F2 pG! J Hl x "lx x(@lJDJ)-MFF;*9$JHRD4BtCF a(FG(Fp E)B ٲDWEI*OT F hh hhhhp(h FFF а@((F@ h(F8 (F!#F)F0FhFH) ;FJ-MFFFF%} UE$ W%F@H F } ѳ0FW% X50FW% ($dJ-A&FFF4FDE0FU$18F&E$4pFFhFph"#UCO2`#hZQhD`p0 FFFF(FF0`G0pGp F h@&1F FB 46)#!l```(`0 # J`p# lJFȹ" K`X+phh5B##`%'lJ-M FFFFAO F4khB"K`#F +h S 0+ :F@FIh 0 F+hSD33`4lJ-MFFE%QFt)8!MC#hFZ[Ys+@'hE@ #V-XAЙB%O ah0F9P5FKBchB##h S 0YMѻF@FQh( h+7/5  (D"9F0G# F#h:FXAFh#@# eJ``#h+Dh#h8F#h+Dh+#h+D30F`B=@FQhK(7 h++WhF;PD"9F0G(#h:F AFh#(#hSDh#h8FSD`#hSDh+?N#hSD3`k(F#hS 0+U+_ѢhchB?8]FO #h@FC `#h Up`#h8F N` hPDCh+?h+?h03` hPD0`h h"PD9F0GH!h*FQD F11@ F#hAF :Fh#9!hQD(*F F191 `:#3lJ-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(FlJ-M`BhF2" Fk`+f(d%O h}a;`shSE")FTK8izi2,XДBW!FOHa #H# 2hX+,{`k;lh(k+;h#0x.+k{`;iC% #}iD D}h{a  0;/*ZE\*55#O0(J`7FFhh"F!0F!O= O\;iB # F3p!F hF`(ьChh:sцP/Rh:oFFF1F^E\.уCFxkJU:JlJ-M`;mF# FF` "K` ?PF "KQF"F#+Ul  ;m2Fymhs0@0AFOpع(F0+@F(<(F (7Fl+F.F+{`3x +E +C#+D4F;hB{hB#x+5(FѻhSMTN;mETHAFlY!h(v0F1  ) уB ^x .23Ex)Ѥ1p`+F"(Dt&FF0\F=+  OhBO#p;m[AF0Fl4O#p\F0Fh9m (\)Yx)#F3;mӹlk#({i+{ZF1FHt0Fh9m(?m(Fcx+h=*КB#ZF#p[FFhB#p3x+"K`lJ:J:J:JFF$'khB *hX+40G(FFKJKF(F)F0FJ;FGB);F J01DBؿ$p)J0D%0FJ QJr4JP7J8JF F!ǿ"iF iFH9 3]eJ-MF FF&o 6.< 2#%CC%C BFF9HM&<$ # %CCO2  " @ @@ #%S9F#HBFQF"HO ! ! ,KO  0b   @@ +C C +F  o &DaFH,!FHNJ^J\J^J\J-MFF@+FFFF@ &F$)F  F3ZRF0F.IJB('FO FDjE)I #D0B4}C# F.'#NB/!P3kDH I(XF-0@*00FDD  - 00۲ 0 0; x$p31o MJN:JJJ-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FD8`hq ;hDD8o 7F , F-A FFFB(F7GE(GF!F:F(F6ЮE]$O  D i E DEB   )iaE8 `` GEќB<ЬE $ D`E 8GE5B iB $D`EEO0$,AhB !t,Q\ 9BMahE(O2RE  *F!F ( #*F"($ F "poBdp FFF 2F)FH FpDJ#FF F "chh{ DB DFO (FbEOF F!!QF<2 F !bQF)F +hZ*`x)+!K2! FQF/+`9F F+K**Yx ?) "3+`1F F?)3 "+` " ""XF(+h FZ*`xJJ2JJJ7% RRRRR x!^SBSA 2)FFxx+! Fm F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pڱLC+B &\\D 0D 2ҲBѩBFpF瓽JO2ڿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFzFFB5*F9F0F#lsU F8F F+F)BНB 8FDBFx2,8F00F$ F8)FVF 0\oF(D@&=F66.G ѽ0"[ CC[00)F?C F00 FFhF*F!FhF0FhC3SCC`pGH$JK`pG$J PH#FFF砆Q HF &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '8M9N FEO | ӽMO @ H@1L L  A AA %H"  O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@Fк ! &+RBcC)𞀺O -'< !q+'<)>R>O  '4-'< x <!x_ @K1   #B B@RR40#!0 B FFOEE8/p5EE<0#+pDјECX<k &0&"F+F:1$s<DF+F0&1Rк кz-'<  XF CE83:$s<D"F+FO FCE8p3CE8p3:B@(D FF; )@"FF !:,BE8^]8lCE8p3J-AF*K*FFF 7 F'B<"pB "B0Bp;2B+Bȿ#D#F !!F(CD? B ,B"p7Bp<3JF%KF*FFF0F/F("FB)+ &"F`B*B DB82B۫BԿF!ȿ"= DD"FO `B88B8p2J-M FF(CF(O:(;xkBVE83psE<# <%+VE3pt$F-*A0*Y0: *JFO F+0 (Ox.*hZx_0 )\9F# F+0 L#s9xh)X7:xx*b*r%*X*VE<%#3p;xt+EspDFzx{+* г * #* **O8DDD@D #"0UD"0**џU;FO3#z)k) L)zFZ)O1Dl@l)xxl(L!7c:*P"JUJ{J{J{J{JUJ{J{J{J{J7JJMJ{J{J-J{JYJ{J{JMJBF3F !SE8p3:*ܸ3̿F"ODDVE8U;83p !#FFD* ܸ3ؿ#D&F7SE8p3l)U+QF40FCFFg)FQ+yxU)I)M)RD) и? OD D! i)pm)@a)O hDa#QF0F#B4QFCF0FFFF(FQFCF0FF(FI_vI{x\;FRFD@!O:oM @ @\O (\Pp) 1F1)А!$@p4 CFPD@x$@4){O F  F <9 һ FO.   "*Txl*B*L* "" s* ' F"4CFQF0FU"".I 'o  F+h4F`5VE82pD  D L)5%Fih[+0F FQF]FF? l) Z) h)*ht)z)!*h*h-h*E1J=:JJ FjB ` F S+[]pGF FoAPR]pGmF FhFOaFhF F mQ ]pG#F M Oku5 F !D#F$01 +.FO0FtJx0+ Cx J\D 3۲x+#0 ` h # `pG h+# `瓽J Jò\D D 3۲9+Կ0WpGOppGJ F!F&F0xB.`F" "#`FFFjFo:F FBx*3B *(` x-,н@0@B F"hIx\D 3۲k+m+g+рS#`Sxi+2"`#hxB*3#`J-A FS!F FFfB FC1A8 F"hMx\D 3۲k+ m+g+щAQAQS#`Sxi+2"`#hAQxB*3#`8JpFF)KB J \@Fl;]v `!p@8B!`O0pJ"տ!-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0QpJ-EF&O8 jD# uB ci+#kHh#CЩh@F!D( #BB!@Dj(??1!?+6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@Ddii(??1!?6yF+*ѽ@,j,DDhhbich+!@hci!?D?1!? 6+Bۨi!i)D{&('KhFBH +H ELFWJ{J#J`J`J`J`KJ#?`pGJJJJɿJJ-M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FKhMJQNJVJp N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`JLJdJJ`J7JO  Fp+hkh+"F(FG,$oo-A' 4$H F"HF(7F(2$Ol[l@F8FZhl.BHB[lH4i+H d%NJ#J#JLJ$J2#` FFFF(F1F(j7FhBa}#}}C#}8A! H[IhGDJ@J8J$J$JLJBOJJKOsB @s@ B  pG pG$JpKFOsBFd"(F/"I*@s rBӲ" +sjsp@to~)s!ds$ iss+tjt$JVJ8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuVJE"Fp"[p#p0ICr Bp[#q#cq@#q#h#r0`qiFrr "" ! Fr r<JFFB"w"JFh!4{rd+uu#",v$kuulvvvLJ-MFpFFF/>)2"J?FOb)F8F F*0 ZF1F8SFI"(F 4$K`K`K`K`K`A FO6M O0oJQNJ@2CCC5I x* ##3]#@$B& 0M/+(hI(hF(h"F9F0D+h3D" U M"F9F+hO0o{J$JhJ8JFC#DBFF)/*0pmObFFhF.JhBPR#+L F mp+&M(h# y$Kx)$BJ+hh"FDnKhB`+$dBIHOQ(h)+ ##3]#@ $ O4o{J$J$JJ JPJ FF$JFhM0`"OpJBb`J`BJxO@p-ea a*FDK-h0*F!F8DKB3B KKhKIh h H Mo"J$JJJ|JxJJPJ]lFFOrOS##F333#bbb ИBF2F"RjDr`*F9F .& 3D"F!Ha ]0]lFOSOr##333#bKx "I l"F! H6 ]0 MI*h cbX+h #D$JJJ-E]lFOSOr%#KUxUU%b "I )uD"F!H ]8 (F Icb 0#P``$JJJ-M]FOSOr'#7KFxwww 'b. ".I D оB3F+F#S3kDs`2FAF"F!-%+DH} ]ORIbb "H6&(*F"S3 r`2FAF-%+D"F!$JJK]h3KhOrOS##jF333! #H% ]]JJ0Kh;+ 7>CJS+K+Jx$#Or33OR!##H#jF]KJx#3Or33O@r3Kh]5]Kh]KhKh]]_pJ$JhJlJJ$Jp Fo9KJhB5JL#h;+0%6oW FFEH|0###`D FFAH|0#|0;Ha##|05L##`p4HO3Kh!|C/H0.Kx+##`3##"#`)K`Ob(K`p@$X|0#H#M(h"K.h`0F#.`<|FO`I-Jh+D`+#-"K`xJpJOJ4JOJJOJ$J$JJOJhJlJDJL#h3+#` H@ HO`#hI@tJ QJ1QJDJ"-A=K=M`=K>Ih>LOb(F+`!`{;O:h:IC h#Ҳ!h5H h3N0`@F #<F,H#I&J+H*I hS*Kh:;h(hC@B'H!h&L2h&H!hII$H h!"J@|!K"Hh!IO`H!"KH`K`OzrK`"'A*JJHJhJhJLJPJ$PJlJPPJaPJ`JdJPJJPJPJ QJJPJDJyCJtJPJpJxJ"K`4J$MF$HHBp"I"L*h"K"I` hOb'$hJD)hF# Fh5%!J!ueu[v#vuu%vevK6`uK u(F`{ K`@JPPJFJJJJhaX3`K2h`>K>I(h`Q=H"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0qxG Q0_ o-e_JP1P`1OJ T\`3/_o1OH@NOD ͠  o p`?0:?01 Q0Q@Q1PJO0 o/@aJ6n6/^haJ_eJ` eJahaJhaJhaJeJ eJhaJhaJhaJhaJhaJ haJ haJ haJ haJ haJhaJhaJhaJhaJ@-@Oo@OP`U P@6/@/N-_004; 0Q@o0 !  AA_oqv^Y@T S@NoN/0@0oO/0@0o/-oO/`0C@/`pР/=  /JKC KC OpG@fJ0fJKS pG@fJKS pG0fJESXCo#2?o2?[#2?opG8FIl_[ _ SP!K  H@(D])C_!` C-8\P ]-RO$?o Kh_2*ٿ_aO OoR p FF FFg_OsJ _#"qA dK@ Rc Xf % D@@_=`& R K  _ d(F C-pcJP_KJ/O0J0#C0_" Ks_",,B,?#C?opG /R1=C.)D![NYd9ir;5<̬t@).'F%6L% ,J)J'J.J)J-%J.J*J'J)J+JM.Ja)J$JnW ?m9ir;nW ?m9ir;aʓ +8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b3Dh&P]`FC=݋#1--'?M(s*K>;iJiJiJiJiJiJiJiJiJiJiJiJiJiJiJiJiJjJ jJjJjJ jJ'jJ.jJ5jJ2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentu-boot*EHCI Host Controller  * +,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_devicessunxi_set_gatedev_get_parent_privdevice_removesun8i_emac_eth_of_to_platphy_device_createata_scsiop_inquirysunxi_set_reset_ehci_create_int_queuefs_devreadefi_free_poolefi_runtime_relocatedev_get_uclass_privsun8i_emac_eth_startefi_free_pagesdev_get_privahci_port_startdev_get_uclass_platdev_get_parent_platfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue #gpio-cellsahci_scsiInvalid port number %d timeout exit! 1.564bit ncq ilck stag pm clo nz only pmp fbss pio slum part ccc ems sxs apst nvmp boh SATA link %d timeout. Target spinup took %d ms. AHCI %02x%02x.%02x%02x %u slots %u ports %s Gbps 0x%x impl %s mode flags: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s controller reset failed (0x%x) scsi_ahci: SCSI READ CAPACITY10 command failure. No ATA info! Please run SCSI command INQUIRY first! scsi_ahci: SCSI READ CAPACITY16 command failure. No ATA info! Please run SCSI command INQUIRY first! Unsupport SCSI command 0x%02x No Link on this port! %s: No mem for table! Can not start port %d alloc space exhausted DRAM: arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x bootm_boot_modenonsecnonsec: Security extensions not implemented. bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %s: No memory for ataid[port] ATA scsi_ahci: Error: buffer too small. Hit any key to stop autoboot: %2d  0%2d axp_sysreset*?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %llu, count %lu ... %ld blocks read: %s %s write: device %d block # %llu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** ** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u PA17macpwrinitcall sequence %p failed at call %p (err=%d) ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into loadablesThe given image format is not supported (corrupt?) ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': Scanning global bootmeth '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid Automatic boot of image at addr 0x%08lX ... vbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s fwupdarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] CACHE: Misaligned operation at range [%08lx, %08lx] %s: %s: error: gpio %s%d not reserved bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) clock-divclock-multclock-frequency#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesxtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\...%.*scyclic function %s took too long: %lldus vs %dus max bootcmd=run distro_bootcmdbootdelay=2baudrate=115200preboot=usb startloadaddr=0x42000000arch=armcpu=armv7board=sunxiboard_name=sunxisoc=sunxistdin=serial,usbkbdstdout=serialstderr=serialbootm_size=0xa000000kernel_addr_r=0x42000000fdt_addr_r=0x43000000scriptaddr=0x43100000pxefile_addr_r=0x43200000fdtoverlay_addr_r=0x43300000ramdisk_addr_r=0x43400000dfu_alt_info_ram=kernel ram 0x42000000 0x1000000;fdt ram 0x43000000 0x100000;ramdisk ram 0x43400000 0x4000000fdtfile=sun8i-r40-bananapi-m2-ultra.dtbconsole=ttyS0,115200uuid_gpt_esp=c12a7328-f81f-11d2-ba4b-00a0c93ec93buuid_gpt_system=69dad710-2ce4-4e3c-b16c-21a1d49abed3partitions=name=loader1,start=8k,size=32k,uuid=${uuid_gpt_loader1};name=loader2,size=984k,uuid=${uuid_gpt_loader2};name=esp,size=128M,bootable,uuid=${uuid_gpt_esp};name=system,size=-,uuid=${uuid_gpt_system};mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiscsi_init=if ${scsi_need_init}; then scsi_need_init=false; scsi scan; fiscsi_boot=run scsi_init; if scsi dev ${devnum}; then devtype=scsi; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=fel mmc_auto scsi0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then run scan_dev_for_boot; fi; done; setenv devplistbootcmd_fel=if test -n ${fel_booted} && test -n ${fel_scriptaddr}; then echo '(FEL boot)'; source ${fel_scriptaddr}; fibootcmd_mmc0=devnum=0; run mmc_bootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_mmc_auto=if test ${mmc_bootdev} -eq 1; then run bootcmd_mmc1; run bootcmd_mmc0; elif test ${mmc_bootdev} -eq 0; then run bootcmd_mmc0; run bootcmd_mmc1; fibootcmd_scsi0=devnum=0; run scsi_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=scsi_need_init=; for target in ${boot_targets}; do run bootcmd_${target}; done%s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%llu x %lu) Capacity: not available reg-namesunbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone U-Boot.armv7bootp_archInvalid pxeuuid: %s bootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list error: overflow occurs , Build: %sPXEbootefi %lx %lxefi/boot/bootarm.efipxefile_addr_rtftpextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sDriver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p Class Index Probed Driver Name ----------------------------------------------------------- uclass %d: %s %-3i %c %s @ %08lx, seq %dset_dir_flagsget_valueset_valueVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s %-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmdError: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Trying to execute a command out of order ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... List of available devices: %-8s %08x %c%c cyclic_demoRegistering of cyclic_demo failed Registered function "%s" to be executed all %dms function: %s, cpu-time: %lld us, frequency: %lld.%02d times/s data abort Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s -n## Resetting to default environment edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! New length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d '%s' is not a number %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Missing disk guid Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_nameenumerateguidsuccess! Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) CRC32 for %08lx ... %08lx ==> %04x: %02xreadingError %s the chip: %d Valid chip addresses: %02XError: Not supported by the driver Invalid bus %d: err=%d -s## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier | %-*.*s| %-*.*s| %s ParentDriverCan't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? FDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available activeeth%d : %s %pM %s not used Supported partition tables%c %s: %llx0x%x-bootableUnknown option %s %s%xping failed; host %s is not alive host %s is alive poweroff ... prefetch abort Invalid pxefile address: %s Config file '%s' found Config file not found The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... %llu bytes written in %lu ms Reset SCSI fmtgsubCould not set var invalid op ** Abort software interrupt ## Executing script at %08lx pin-controller device not selected %s not found -pext2fatInvalid filesystem: %s Error reading config file undefined instruction starting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)%2u %2u-%2u = %5u %sefiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed NetMemEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition %x:%xCannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout EHCI fail timeout STS_ASS reset EHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) %s %s: Failed to get clocks (ret=%d) %s %s: Failed to enable clocks (err=%d) %s %s: Failed to get resets (err=%d) %s %s: Failed to get deassert resets (err=%d) vbus-supply%s %s: Error enabling VBUS supply (ret=%d) %s %s: failed to shutdown usb phy (ret=%d) %s %s: failed to disable VBUS supply (ret=%d) %s %s: failed to release resets (ret=%d) %s %s: failed to release clocks (ret=%d) RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}0:autoUnable to read "%s" from %s%d:%d... Unable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... .flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment  %s%daddr%saddr%pM%s.%dethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdev Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s address not set. Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** ${Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. ** Unable to read file %s ** UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesethernetlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? WARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. /__local_fixups__/__fixups__/__overlay__//__overlay__/__symbols__failed on fdt_overlay_apply(): %s base fdt does did not have a /__symbols__ node make sure you've compiled with -@ /cpuscouldn't find /cpus device_typecpuenable-method/psciarm,pscicompatiblecpu_suspendcpu_offcpu_onmigratesmcokayfdt_root: %s serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer ///./../binmanmultiple-imagesMMC Device %d not found ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): descriptionUnsupported %s address size datadata-offsetdata-positiondata-size/imagesalgounknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... Bad Data Hash No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDT%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSignCan't get image data/sizeerror! %s in '%s' image node Corrupted or truncated treeUnsupported hash algorithmCan't get hash value propertyCan't get hash algo propertyBad hash valueBad hash value lenuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Jump offset is too bigError: writing directory entry outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to write file %s ** %s %s: PHY: Failed to exit %s: %d. #phy-cells%s %s: PHY: Failed to init %s: %d. %s %s: PHY: Failed to power off %s: %d. %s %s: PHY: Failed to power on %s: %d. Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x nonsec: PERIPHBASE is above 4 GB, no access. %upxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sBase path too long (%s%s) Retrieving file: %s SPLsunxi SPL version mismatch: expected %u, got %u Bank %s: %s%d: %s: %d [%c]%s%s%s.%s%dError insufficient memory gpt_partition_listMore partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> ERROR: %s device removed! ERROR: OHCI Unrecoverable Error, controller usb-%s disabled ERROR: USB-error: %s (%x) ERROR: USB-error: %s (%x) ERROR: USB HC TakeOver failed! ERROR: USB HC reset timed out! [0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drvNo I2C bus selected u-boot,i2c-transaction-bytes+,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Could not find script subimage data Wrong image format for "source" command unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudratebinman_init failed:%d load-environmentMMC: Net: WDT: Failed to register %s for sysreset WDT: Not starting %s WDT: Failed to start %s %s=%s%d.%d.%d.%d./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rsocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdr%s: %s list passed to list_sort() too long for efficiency No match for driver '%s' Device tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes prebootNo CLI availableunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! PHY extended status read failed, assuming no 1000BASE-X MII devices: '%s' Current device: '%s' No such device: %s PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T fel_bootedfel_scriptaddrmmc_bootdev%s%s.dtbfdtfile Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%llx~0x%llx mmc erase failed mmc_blkMMC: block number 0x%llx exceeds max(0x%llx) mmc fail to send stop cmd mmc write failed vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modebus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! udevice *)(NULLcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vStatus Error: 0x%08x Timeout waiting card ready Error enabling VMMC supply : %d mmc %u error cannot set clock to %u MMC: no card present writing%08lx: %02lx %04lx ? %08x %0lx %04x #(-27:"/\|?*reg-offsetreg-shiftreg-io-width/configu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-typeohci: Error out of memory allocating int queue ohci: Error out of memory allocating urb ohci: Error submitting int queue job ohci: Error out of ohci_devs for interrupt endpoints USB OHCI %x.%x ERROR: submit_control_message: pipesize for pipe %lx is zero %s %s: failed to enable clock %d %s %s: failed to get clock phandle(%d) %s %s: failed to deassert reset %d %s %s: failed to get reset phandle(%d) %s %s: failed to shutdown usb phy %s %s: failed to assert all resets %s %s: failed to disable all clocks ## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdoutstderreth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,targettarget-pathExpected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%llu ** bad MBR sector signature 0x%02x%02x %08x-%02x** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8llu %8llu %6ld %.32s hdusbdmmcsdxx%s%c%du-boot,efi-partition-entries-offsetCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfiggroupsfunctionpinctrl-namespinctrl-%d%s %s: could not find pctldev CPU: Allwinner R40 (SUN8I %04x) fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%seMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10llu %-10llu %08x-%02x %02x%s%s %u Bytes%s %ciB%spxeuuidError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 pre-reloc realloc() is not supported^%s$## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d %s=%s regulator-nameregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvolt#reset-cellsresetsreset-namesHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command scanning bus for devices... id%dlun%dscsi_blkstdout-pathNo serial driver foundError get-and-setting cluster Error: no space left: %llu uuid_disk=name=,start=MiB,size=MiB,uuid=;uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: readonly variable%.*s.%.3s~%dWorking FDT set to %lx fdtaddrError compiling regex: %s %s: No match ## error: pattern buffer overflow: have %d, need %d ethernet%dethaddreth%daddrserial#%08x%08xmodelModel: %s Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x %-10.10s %3d [ %c ] %-20.20s | `-- |-- (effective Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s (T)reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Unknown01/01/2023skufamilyproductUnknown Productasset-tagmanufacturerERROR: sohci_submit_job: EPIPE ERROR: ep_add_ed: pending delete ERROR: sohci_submit_job: ENOMEM ERROR: need %d TDs, only have %d ERROR: sohci_submit_job: EINVAL %s: Failed to probe keyboard '%s' (ret=%d) nulldevIn: No input devices available! Out: No output devices available! Err: No error devices available! RE is too long (data overflow)USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vloadaddrbootmethu-boot,boot-stdbootmeth_distrou-boot,distro-syslinuxbootmeth_pxeu-boot,distro-pxebootmeth_efiu-boot,distro-efiaslr-moveaslr-randefi-runtime-randrandom-randvbe_simplefwupd,vbe-simplepoweroffPerform POWEROFF of the devicePerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionbootflowBoot flowssourcerun script from memorybdinfoprint Board Info structureblkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigurebootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryconinfoprint console devices and informationdmDriver model low level accesscompatdevresdriversstaticuclasscyclicCyclicecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsI2C sub-systemcrc32loopmmmwnmprobeolenitestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsrNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoldisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part types - list supported partition table typespinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] commands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r default-arm-sunxi-sunxidefault-arm-sunxidefault-armscsibootboot from SCSI deviceloadAddr dev:partSCSI sub-systemreset - reset SCSI controller scsi info - show available SCSI devices scsi scan - (re-)scan SCSI bus scsi device [dev] - show or set current device scsi part [dev] - print partition table of one or all SCSI devices scsi read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' scsi write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'setexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substringsysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagegptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable read - read GPT into a data structure for manipulation gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageusb_kbdusb-keyboardmd5sha1sha256crc16-ccittBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOsatanvmeefiloadervirtiopvblockfixed_rate_raw_clockfixed_clockfixed-clockfixed_factor_clockfixed-factor-clocksunxi_clkallwinner,sun8i-a83t-r-ccuallwinner,sun8i-h3-r-ccuallwinner,sun8i-r40-ccuallwinner,sun50i-a64-r-ccuclk_sun6i_rtcallwinner,sun6i-a31-rtcallwinner,sun8i-a23-rtcallwinner,sun8i-h3-rtcallwinner,sun8i-r40-rtcallwinner,sun8i-v3-rtcallwinner,sun50i-h5-rtcallwinner,sun50i-h6-rtcallwinner,sun50i-h616-rtcallwinner,sun50i-r329-rtc/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfi25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiunusedfuncgpio_sunxiwdt_rebootwdt-rebooti2c-chipi2c_generici2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2cMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcsunxi_mmcallwinner,sun4i-a10-mmcallwinner,sun5i-a13-mmcallwinner,sun7i-a20-mmcallwinner,sun8i-a83t-emmcallwinner,sun9i-a80-mmcallwinner,sun50i-a64-mmcallwinner,sun50i-a64-emmcallwinner,sun50i-h6-mmcallwinner,sun50i-h6-emmcallwinner,sun50i-a100-mmcallwinner,sun50i-a100-emmceth_sun8i_emacallwinner,sun8i-h3-emacallwinner,sun50i-a64-emacallwinner,sun8i-a83t-emacallwinner,sun8i-r40-gmacallwinner,sun50i-h6-emacGeneric PHYsun4i_usb_phyallwinner,sun4i-a10-usb-phyallwinner,sun5i-a13-usb-phyallwinner,sun6i-a31-usb-phyallwinner,sun7i-a20-usb-phyallwinner,sun8i-a23-usb-phyallwinner,sun8i-a33-usb-phyallwinner,sun8i-a83t-usb-phyallwinner,sun8i-h3-usb-phyallwinner,sun8i-r40-usb-phyallwinner,sun8i-v3s-usb-phyallwinner,sun20i-d1-usb-phyallwinner,sun50i-a64-usb-phyallwinner,sun50i-h6-usb-phyPH23sunxi-pinctrlallwinner,sun7i-a20-pinctrlallwinner,sun8i-r40-pinctrlbias-disablebias-pull-downbias-pull-updrive-strengthaxp_pmicx-powers,axp152x-powers,axp202x-powers,axp209x-powers,axp221x-powers,axp223x-powers,axp803x-powers,axp806x-powers,axp809x-powers,axp813regulatorns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartahci_sunxiallwinner,sun4i-a10-ahciallwinner,sun8i-r40-ahciwatchdogsunxi_wdtallwinner,sun4i-a10-wdtallwinner,sun6i-a31-wdtallwinner,sun20i-d1-wdtsunxi_resetusb_dev_genericu-boot,bootdev-usbNo ErrorCRC: Last data packet from endpoint contained a CRC error.BITSTUFFING: Last data packet from endpoint contained a bit stuffing violationDATATOGGLEMISMATCH: Last packet from endpoint had data toggle PID that did not match the expected value.STALL: TD was moved to the Done Queue because the endpoint returned a STALL PIDDEVICENOTRESPONDING: Device did not respond to token (IN) or did not provide a handshake (OUT)PIDCHECKFAILURE: Check bits on PID from endpoint failed on data PID (IN) or handshake (OUT)UNEXPECTEDPID: Receive PID was not valid when encountered or PID value is not defined.DATAOVERRUN: The amount of data returned by the endpoint exceeded either the size of the maximum data packet allowed from the endpoint (found in MaximumPacketSize field of ED) or the remaining buffer size.DATAUNDERRUN: The endpoint returned less than MaximumPacketSize and that amount was not sufficient to fill the specified bufferreserved1reserved2BUFFEROVERRUN: During an IN, HC received data from endpoint faster than it could be written to system memoryBUFFERUNDERRUN: During an OUT, HC could not retrieve data from system memory fast enough to keep up with data USB data rate.NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(1)NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(2)ohci_genericgeneric-ohciehci_genericgeneric-ehciext4unsupportedEFI block driverFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSbaseboardchassisseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlanERROR: submit_common_message: pipesize for pipe %lx is zero ERROR: sohci_submit_job failed ERROR: CTL:TIMEOUT ## error: substitution buffer overflow %s %s: failed to disable usb_%ldphy clock %s %s: failed to assert usb_%ldreset reset %s %s: failed to enable usb_%ldphy clock %s %s: failed to deassert usb_%ldreset reset phy_ctrlusb0_vbus_power-supplyusb_vbususb_vbus_detusb_id_detusb%d_phy%s %s: failed to get usb%d_phy clock phandle usb%d_reset%s %s: failed to get usb%d_reset reset phandle pmu%demacgmacgpio_ingpio_outi2c0i2c1mmc0mmc1mmc2spi0uart0%s: Missing variant stmmaceth%s %s: failed to get TX clock %s %s: failed to get TX reset sysconallwinner,sun8i-h3-mdio-internal%s %s: failed to get EPHY TX clock %s %s: failed to get EPHY TX reset allwinner,tx-delay-ps%s: Invalid TX delay value %d allwinner,rx-delay-ps%s: Invalid RX delay value %d snps,reset-active-lowsnps,reset-gpiosnps,reset-delays-us%s %s: failed to enable TX clock %s %s: failed to deassert TX reset %s %s: failed to enable EPHY TX clock %s %s: failed to deassert EPHY TX clock %s: Timeout eGON.BT0TOC0.GLHUnknown boot source %d ahbcd-gpiosgpio inputgpio outputdisabledfunction %dP%c%dapbAHCI PHY power up failed. AHCI PHY calibration failed. %s: (CLK#%ld) unhandled %s: (RST#%ld) unhandled syntax error System reset not supported on this platform ERROR: index > length FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed HUSH_VERSION0.01( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?USB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusbkbd%s: warning, ret=%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s 2H53F6CDBA Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx vbecur-versioncur-vernumU-Boot bootloader-versionVersion: %s Vernum: %x/%xU-Boot 2023.01+dfsg-2 (Jan 18 2023 - 01:57:16 +0000) Allwinner Technologytimeout-sechw_margin_msu-boot,noautostartu-boot,autostartunable to find wdt device cyclic_register for %s failed every %ldmsWDT: Started %s with%s servicing %s (%ds timeout)  smbios_SM__DMI_ERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d BIVJAWJVJTJMVJXJ9XJWJIWJMYJUYJTJ YJxJvJvJ[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS5JxJ QJ QJvJxJ QJ QJmJxJ QJ QJJxJ QJ QJ#vJxJ@ QJ QJ+vJxJ QJ QJ/vJxJ QJ QJ4vJxJ QJ QJ#-JxJ QJ QJ JxJ~J QJ QJscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be present For FIT format uImage addr must include subimage unit name in the form of addr:"xJxJJ QJ QJ'xJxJقJ QJ QJ[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead xJxJJ QJ QJxJxJJ QJ QJxJxJJ QJ QJxJxJJ QJ QJ1JxJJ QJ QJxJxJ݉J QJ QJcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree Dump tree of driver model devices ('*' = activated) dm uclass Dump list of instances for each uclassJxJŋJ QJ QJ7JxJJ QJ QJcyclic demo - register cyclic demo function cyclic list - list cyclic functions /addr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speedJxJiJ QJ QJJxJŨJ QJ QJhJxJJ QJ QJJxJJ QJ QJAJxJ1J QJ QJJxJ%J QJ QJJxJJ QJ QJ!JxJ+J QJ QJ$JxJ%J QJ QJJxJJ QJ QJ ~JxJ1J QJ QJB!JxJ=J QJ QJ*JxJ͢J QJ QJJxJݠJ QJ QJGJxJqJ QJ QJ@їJxJJ QJ QJJxJaJ QJ QJ#JxJJ QJ QJ ~JxJUJ QJ QJ&JxJJ QJ QJ JxJJ QJ QJnJxJJ QJ QJhJxJJ QJ QJ7JxJ%J QJ QJ,JxJJ QJ QJ8JxJJ QJ QJ7JxJJ QJ QJhJxJJ QJ QJ7JxJ%J QJ QJGJxJIJ QJ QJUJxJ9J QJ QJtkJxJJ QJ QJ J$J6J{jJaddr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] {jJxJJ QJ QJ߳JxJJ QJ QJJxJJ QJ QJJxJJ QJ QJJxJ1J QJ QJJxJJ QJ QJJxJrJ QJ QJJxJJ QJ QJ@JxJ)J QJ QJJxJIJ QJ QJkoJִJ8۴JJ nsJJJ J OJ J J iJmJalJJJJmJaJJJYJ%JGJ=JJpJ;JJJRJaJJaJaJJaJKJJJaJeJaJqJMJu^J&JaJJM'JaJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ J JJJJJ$J$J,J,J4J4J<J<JDJDJLJLJTJTJ\J\JdJdJlJlJtJtJ|J|JJJJJJJJJJJJJJJJJJJDJJHJJsmJcmJAmJMJ }J+mJmJlJTJJlJlJlJJ#JlJlJqlJJ+UJ2UJ JJøJJ@((((((@( @ @ @`````` `@`````` `@`dh lllllllllll l@lطJJm JtJtJJ!J[ JJU%Jy(J%J%J%J QJ QJ QJJJ QJy5JWJ9J5JCJ>JVJWJVJ3^JlJlJqlJjJdJ_J U-Boot Root Hub  @   mJIJU{JA{J=vJxJuJuJ)  @ @  uJJqJYJ1JuJJJ JJ JmJJ1JQJJJJqJ͢JJ1JmJ]JJAJJsJJJ)J/J5JyJ9JmJ?JJAJJsJJBOOTSERVd J=JJJJJqJqJJJJJAJJJJ!JJJEJJAJJJJJJ JyJmJJJ)J9JaJJJJJIJ-JJ-JJJJJJJJm JiJ JUJJqJ(J(J-JJJ JJJ}JJJXJPP21$JJJJJJJJ1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@.J JJxJJJJZwJxJMJawJ QJ|wJxJJwJwJtkJxJzJuJ QJuJxJzJuJ QJ1xJxJqJ9xJ JyJxJJyJyJ(wJEJxJ1wJJ~JAJxJQzJuJ(JeJxJJkJӝJZyJxJ-JayJyJZxJxJJ`xJ1J׌JxJJیJJxJxJ5JxJ QJJxJ)J JJJxJٵJJJxJmJxJxJJiJJxJJJӝJxJJxJxJJJJxJAJyJyJsJxJJ{JJtJ!JxJJJJBzJxJ]JGzJ QJN|JxJJW|J|J$}JxJJ/{JU{JSzJxJ{J\zJzJ({JxJJ/{JU{J{JxJmJ{J{JRJxJJXJ~JxJݏJ~J~JJxJJJJSJxJϏJ/{JYJ+}JxJMJ4}JG}J}JxJ?J}J}J JxJJ{J{J~JxJ1J~J1~JJxJJ(J&JJxJJJJƂJxJJ΂J QJ#-JxJzJHtJltJJxJ}JYJuJJxJJJJJvJxJ=|JOvJovJ<JxJJJJtJxJ{JtJtJЭJxJUJ٭JdJ/JxJJ5JZJJxJJJJR|JxJJJJlJxJJrJۉJJxJ1JJ̊JJxJJ<JۉJ_JxJJJۉJJxJJJƋJ JxJӜJ/{JOJAJxJJݍJJRJxJJWJmJ8JxJݺJJ)JJxJuJJJVJxJJJJJxJJŗJ֗JJxJJ>JRJ'JxJ9J?JNJJxJJJӝJ!JxJJyJJvJxJm|JvJvJnJxJJJJmJxJJrJJJxJJJJsJxJJsJ QJвJxJJٲJJtJNsJxJuJrJJ JxJ=|J9vJ QJ%JxJJ,JLJJxJJsJsJJxJrJJбJtJJxJŜJJJJxJJJ QJJxJJsJJBJxJJKJaJJxJ)JJ0JtJ&JxJJ.JhJ?JxJMJGJgJ>JxJJ{J{JFJxJ JLJjJJ;JJMJtȝJrJCrJDJ \JSطJcJJJdJJRԣJ&JJhJ(J1JJٷJJXJCPJ!JJ88JJTئJ3J3JJJ^(JNJtJTJJ JpJ_^J@JxJuJvJ /J:JMJ5MJ J>JyGJ8JJsJJewJvJ JʸJnJJdJ*AJ;J JaJyJy]JAeJ)JB!JJBJe0JBJM0JrJ1EJBJ}0JJ:JBJ0JJ;JJaJJtJMyJlJ8ݛJEJUJJJ͑JqJJ@JJJ'J0HJJJJJ=NJ rJJAJnJJmsJ%qJJ'J'(J*J(J'JJ.JgJ7J<J2MJJJAJJ4;J:J VJCJGVJMJR)J)J \JS,JJTy-JJU4JJ\6J5J8J^ӷJJbJc9J9JJdyJ JnJ˿JtAJ WJ]J@ $Ju˿JwJvAJ:J]JD@ $ J>EJQJQJ9JTJ`9JdJ9J\JJJJJJJJJJJJJJJ(JHJpJtJlJtJxJ J8J<JJJ$J(JJJ J J$J(J,J0J4J8JJJJJJJJJJJJJJJJJJ(JJJJTJXJ\JJJJJJJ`JdJhJlJpJJJtJxJHJLJPJTJXJJJJJJJJJ JJJJJ J$J(J,J0J4J\JJJJJ$JLJtJ!J !J!J!J!J!J !J$!J(!J0!J8!J@!JH!JL!JP!JT!JX!J\!J!J!J!JP"J\#J`#Jd#Jx#J#J$J$J%J%J%J%J%J,&J0&J('J,'J0'J4'J8'J<'J@'JD'JH'J@(JD(JH(JL(JP(JT(JX(J+J+J +J$+J,+J0+J4+J8+J<+J@+JD+JH+JL+JP+JT+JX+J\+J`+Jd+Jh+Jl+Jp+J.J.J.J.J .J$.J(.J0.J4.J8.J<.J@.JD.J.J.J.J /J/J/J/J/J0J0J0J1J1J1J1J1J1J1J1J1J2Jd2J2J 3J$3J(3J4J4J4J85Jd5J5J5J5J8J8J 8J8J8J8J8J 8J$8J(8J,8J08J48J88J<8J@8JD8JH8JL8J:J:J:J:J:J:J;J;J;J ;J;J;J;J;J ;J$;J(;J,;J0;J4;J8;J;J;J<J<J<J<J<J<J<J<J<J<J<J<J=J=J=J =J=J=J=J=J =J$=Jp>Jt>Jx>J|>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J>J?Jl?Jp?Jt?JAJ AJAJAJAJAJAJBJBJBJBJBJBJdCJhCJlCJpCJtCJCJCJxDJ|DJDJDJDJDJDJDJDJDJDJDJDJDJDJEJEJEJEJ(EJ,EJHEJhEJEJEJEJ\FJlHJpHJtHJxHJ|HJHJHJHJHJHJHJHJ@IJDIJHIJLIJ$JJ(JJ,JJ0JJ4JJJJJJdKJ,LJ0LJ4LJ`LJLJLJMJMJMJMJMJtOJxOJ|OJOJOJOJOJOJ4RJ8RJTJTJPUJ,VJ0VJ4VJJ?JL?Jd@J|AJLCJPCJCJCJCJCJCJCJ4EJ8EJJ0>J4>J<>J@>JL>JP>Jt>J?J`BJdBJhBJlBJpBJCJ4DJ8DJEJEJ|FJFJ HJ$HJHJHJHJHJHJHJHJHJHJHJHJHJHJHJHJ8IJJ>J>J>J>J>J\?Jh?Jl?Jt?Jx?J|?J?J?J|@J@J@J AJ$AJ,AJ0BJ4BJBJBJTCJXCJhCJlCJpCJtCJDJDJDJDJDJDJDJDJDJDJDJDJDJDJ0EJ4EJ8EJJ>J>J >J(>JT>J>J>J>J,?Jt?J?J?J?J@J @JL@JT@J@J@J@J@J@J$AJlAJAJAJBJBJDBJLBJBJBJBJBJBJBJCJdCJCJCJCJCJCJq''vrxtxfi2s@1c22800`/2allwinner,sun8i-r40-i2sallwinner,sun8i-h3-i2s( zZVwapbmodV?q''vrxtxgthermal-sensor@1c24c002allwinner,sun8i-r40-thsLRibusmod z$V;serial@1c280002snps,dw-apb-uart€ z`VIokaydefault (hserial@1c284002snps,dw-apb-uart„ zaVJ disablediserial@1c288002snps,dw-apb-uartˆ zbVK disabledjserial@1c28c002snps,dw-apb-uartŒ zcVLokaydefault )*kbluetooth2brcm,bcm43438-btlpo  `serial@1c290002snps,dw-apb-uart zdVM disabledlserial@1c294002snps,dw-apb-uart” zeVN disabledmserial@1c298002snps,dw-apb-uart˜ zfVO disablednserial@1c29c002snps,dw-apb-uartœ zgVP disabledoi2c@1c2ac002allwinner,sun6i-a31-i2c¬ zWV@ +defaultokayppmic@342x-powers,axp2214,zqac-power 2x-powers,axp221-ac-power-supply disabledradc2x-powers,axp221-adcsbattery-power%2x-powers,axp221-battery-power-supply disabledtregulators dcdc1(vcc-3v37K2Zc2Zdcdc2(vdd-cpu7KB@c dcdc3(vdd-sys7KB@c udcdc4(dcdc4vdcdc5 (vcc-dram7K`c`wdc1sw (vcc-gmac-phyK2Zc2Z3dc5ldo(dc5ldoxaldo1(aldo1yaldo2(vcc-paK&%c&%#aldo3(avcc7K)2c2Zzdldo1 (vcc-wifi-ioKw@c2Zdldo2 (vcc-wifi7K2Zc2Zdldo3 (vcc-wifi-27K2Zc2Z{dldo4 (vdd2v5-sataK&%c&%eldo1(eldo1$eldo2(eldo2|eldo3 (vdd1v2-sataKOcOldo_io0(ldo_io0 disabled}ldo_io1(ldo_io1 disabled~rtc_ldo7K-c-(rtc_ldodrivevbus (drivevbus disabledusb-power!2x-powers,axp221-usb-power-supply disabledi2c@1c2b0002allwinner,sun6i-a31-i2c° zXVA -default disabledi2c@1c2b4002allwinner,sun6i-a31-i2c´ z YVB .default disabledi2c@1c2b8002allwinner,sun6i-a31-i2c¸ zXZVC /default disabledcan@1c2bc002allwinner,sun8i-r40-can¼ z[VD disabledi2c@1c2c0002allwinner,sun6i-a31-i2c zY_VH 0default disabledgpu@1c40000&2allwinner,sun8i-r40-maliarm,mali-400TzEFGHJKI#{gpgpmmupp0ppmmu0pp1ppmmu1pmuA buscoreV)ethernet@1c500002allwinner,sun8i-r40-gmac zU{macirqV( stmmaceth@ stmmacethokaydefault 12 rgmii-id3mdio2snps,dwmac-mdioethernet-phy@12ethernet-phy-ieee802.3-c222dram-controller@1c620002allwinner,sun8i-r40-mbus  @tcon-top@1c700002allwinner,sun8i-r40-tcon-top0K$bustcon-tv0tve0tcon-tv1tve1dsi'ptcon-top-tv0tcon-top-tv1tcon-top-dsiV3D=portsport@0endpointj4port@1endpoint@0endpoint@1endpoint@2j5>endpoint@3j6Aport@2endpoint@1j7port@3endpoint@0endpoint@1endpoint@2j8?endpoint@3j9Bport@4endpoint@0j:@endpoint@1j;Cport@5endpointj<Elcd-controller@1c730002allwinner,sun8i-r40-tcon-tv0 z3I= ahbtcon-ch1V1lcdokayportsport@0endpoint@0j>5endpoint@1j?8port@1endpoint@1j@:lcd-controller@1c740002allwinner,sun8i-r40-tcon-tv@ z4J= ahbtcon-ch1V2lcd disabledportsport@0endpoint@0jA6endpoint@1jB9port@1endpoint@1jC;interrupt-controller@1c81000 2arm,gic-400  @ `  z hdmi@1ee000092allwinner,sun8i-r40-dw-hdmiallwinner,sun8i-a83t-dw-hdmi z: ; iahbisfrtmdscecV#ctrlDphyokayportsport@0endpointjE<port@1endpointjFGhdmi-phy@1ef00002allwinner,sun8i-r40-hdmi-phy :busmodpll-0pll-1V"physDpmu2arm,cortex-a7-pmu0zxyz{ timer2arm,armv7-timer0z   opp-table-cpu2operating-points-v2opp-720000000*T B@B@ opp-9120000006\  opp-1008000000< @@ opp-1104000000Aʹ  opp-1200000000G    aliases /soc/ethernet@1c50000/soc/serial@1c28000/soc/mmc@1c0f000 /soc/mmc@1c11000chosen%serial0:115200n8connector2hdmi-connectoraportendpointjGFleds 2gpio-ledspwr-led1bananapi:red:pwr=7onuser-led-green1bananapi:green:user=user-led-blue1bananapi:blue:user=vcc5v02regulator-fixed(vcc5v0KLK@cLK@EJwifi_pwrseq2mmc-pwrseq-simple]  ext_clockbinmaniu-boot-sunxi-with-splyu-boot-sunxi-with-spl.binblobyspl/sunxi-spl.binu-boot-img__symbols__/clocks/osc24M/clocks/osc32k /cpus/cpu@0 /cpus/cpu@1 /cpus/cpu@2 /cpus/cpu@3/display-engine/thermal-zones/cpu0-thermal*/thermal-zones/cpu0-thermal/trips/cpu-hot//thermal-zones/cpu0-thermal/trips/cpu-very-hot/thermal-zones/gpu-thermal/soc/clock@1000000/soc/mixer@1100000 /soc/mixer@1100000/ports/port@1) /soc/mixer@1100000/ports/port@1/endpoint /soc/mixer@1200000 '/soc/mixer@1200000/ports/port@1)2/soc/mixer@1200000/ports/port@1/endpointF/soc/deinterlace@1400000/soc/system-control@1c00000)R/soc/system-control@1c00000/sram@1d000008Y/soc/system-control@1c00000/sram@1d00000/sram-section@0"a/soc/interrupt-controller@1c00030j/soc/dma-controller@1c02000n/soc/spi@1c05000s/soc/spi@1c06000x/soc/csi@1c09000/soc/mmc@1c0f000 /soc/mmc@1c10000}/soc/mmc@1c11000/soc/mmc@1c12000/soc/phy@1c13400/soc/crypto@1c15000/soc/spi@1c17000/soc/sata@1c18000/soc/usb@1c19000/soc/usb@1c19400/soc/usb@1c1c000/soc/usb@1c1c400/soc/spi@1c1f000/soc/clock@1c20000/soc/rtc@1c20400F/soc/pinctrl@1c20800!/soc/pinctrl@1c20800/can-ph-pins!/soc/pinctrl@1c20800/can-pa-pins#/soc/pinctrl@1c20800/clk-out-a-pin%/soc/pinctrl@1c20800/gmac-rgmii-pins/soc/pinctrl@1c20800/i2c0-pins/soc/pinctrl@1c20800/i2c1-pins/soc/pinctrl@1c20800/i2c2-pins/soc/pinctrl@1c20800/i2c3-pins"/soc/pinctrl@1c20800/i2c4-pins,/soc/pinctrl@1c20800/ir0-pins5/soc/pinctrl@1c20800/ir1-pins>/soc/pinctrl@1c20800/mmc0-pins"H/soc/pinctrl@1c20800/mmc1-pg-pinsU/soc/pinctrl@1c20800/mmc2-pins_/soc/pinctrl@1c20800/mmc3-pins#i/soc/pinctrl@1c20800/uart0-pb-pins#w/soc/pinctrl@1c20800/uart3-pg-pins+/soc/pinctrl@1c20800/uart3-rts-cts-pg-pins/soc/watchdog@1c20c90/soc/ir@1c21800/soc/ir@1c21c00/soc/i2s@1c22000/soc/i2s@1c22400/soc/i2s@1c22800/soc/thermal-sensor@1c24c00/soc/serial@1c28000/soc/serial@1c28400/soc/serial@1c28800/soc/serial@1c28c00/soc/serial@1c29000/soc/serial@1c29400/soc/serial@1c29800/soc/serial@1c29c00/soc/i2c@1c2ac00/soc/i2c@1c2ac00/pmic@34"/soc/i2c@1c2ac00/pmic@34/ac-power/soc/i2c@1c2ac00/pmic@34/adc'/soc/i2c@1c2ac00/pmic@34/battery-power*#/soc/i2c@1c2ac00/pmic@34/regulators/dcdc1*-/soc/i2c@1c2ac00/pmic@34/regulators/dcdc2*7/soc/i2c@1c2ac00/pmic@34/regulators/dcdc3*A/soc/i2c@1c2ac00/pmic@34/regulators/dcdc4*K/soc/i2c@1c2ac00/pmic@34/regulators/dcdc5*U/soc/i2c@1c2ac00/pmic@34/regulators/dc1sw+_/soc/i2c@1c2ac00/pmic@34/regulators/dc5ldo*j/soc/i2c@1c2ac00/pmic@34/regulators/aldo1*t/soc/i2c@1c2ac00/pmic@34/regulators/aldo2*~/soc/i2c@1c2ac00/pmic@34/regulators/aldo3*/soc/i2c@1c2ac00/pmic@34/regulators/dldo1*/soc/i2c@1c2ac00/pmic@34/regulators/dldo2*/soc/i2c@1c2ac00/pmic@34/regulators/dldo3*/soc/i2c@1c2ac00/pmic@34/regulators/dldo4*/soc/i2c@1c2ac00/pmic@34/regulators/eldo1*/soc/i2c@1c2ac00/pmic@34/regulators/eldo2*/soc/i2c@1c2ac00/pmic@34/regulators/eldo3,/soc/i2c@1c2ac00/pmic@34/regulators/ldo_io0,/soc/i2c@1c2ac00/pmic@34/regulators/ldo_io1,/soc/i2c@1c2ac00/pmic@34/regulators/rtc_ldo./soc/i2c@1c2ac00/pmic@34/regulators/drivevbus# /soc/i2c@1c2ac00/pmic@34/usb-power /soc/i2c@1c2b000 /soc/i2c@1c2b400 /soc/i2c@1c2b800 /soc/can@1c2bc00 %/soc/i2c@1c2c000 */soc/gpu@1c40000 //soc/ethernet@1c50000 4/soc/ethernet@1c50000/mdio* >/soc/ethernet@1c50000/mdio/ethernet-phy@1 C/soc/dram-controller@1c62000/soc/tcon-top@1c70000# H/soc/tcon-top@1c70000/ports/port@0, [/soc/tcon-top@1c70000/ports/port@0/endpoint# u/soc/tcon-top@1c70000/ports/port@1. /soc/tcon-top@1c70000/ports/port@1/endpoint@0. /soc/tcon-top@1c70000/ports/port@1/endpoint@1. /soc/tcon-top@1c70000/ports/port@1/endpoint@2. /soc/tcon-top@1c70000/ports/port@1/endpoint@3# /soc/tcon-top@1c70000/ports/port@2. /soc/tcon-top@1c70000/ports/port@2/endpoint@1# ,/soc/tcon-top@1c70000/ports/port@3. @/soc/tcon-top@1c70000/ports/port@3/endpoint@0. ^/soc/tcon-top@1c70000/ports/port@3/endpoint@1. |/soc/tcon-top@1c70000/ports/port@3/endpoint@2. /soc/tcon-top@1c70000/ports/port@3/endpoint@3# /soc/tcon-top@1c70000/ports/port@4. /soc/tcon-top@1c70000/ports/port@4/endpoint@0. /soc/tcon-top@1c70000/ports/port@4/endpoint@1# /soc/tcon-top@1c70000/ports/port@5, /soc/tcon-top@1c70000/ports/port@5/endpoint /soc/lcd-controller@1c73000) $/soc/lcd-controller@1c73000/ports/port@04 0/soc/lcd-controller@1c73000/ports/port@0/endpoint@04 L/soc/lcd-controller@1c73000/ports/port@0/endpoint@1) h/soc/lcd-controller@1c73000/ports/port@14 u/soc/lcd-controller@1c73000/ports/port@1/endpoint@1 /soc/lcd-controller@1c74000) /soc/lcd-controller@1c74000/ports/port@04 /soc/lcd-controller@1c74000/ports/port@0/endpoint@04 /soc/lcd-controller@1c74000/ports/port@0/endpoint@1) /soc/lcd-controller@1c74000/ports/port@14 /soc/lcd-controller@1c74000/ports/port@1/endpoint@1" /soc/interrupt-controller@1c81000 /soc/hdmi@1ee0000 /soc/hdmi@1ee0000/ports/port@0( /soc/hdmi@1ee0000/ports/port@0/endpoint /soc/hdmi@1ee0000/ports/port@1( /soc/hdmi@1ee0000/ports/port@1/endpoint /soc/hdmi-phy@1ef0000 /opp-table-cpu ,/connector/port/endpoint 8/vcc5v0 C/wifi_pwrseq O/binman #address-cells#size-cellsinterrupt-parentmodelcompatibleranges#clock-cellsclock-frequencyclock-accuracyclock-output-namesphandledevice_typeregclocksclock-names#cooling-cellsoperating-points-v2cpu-supplyallwinner,pipelinesstatuspolling-delay-passivepolling-delaythermal-sensorstemperaturehysteresistripcooling-deviceresets#reset-cellsremote-endpointinterruptsinterconnectsinterconnect-namesinterrupt-controller#interrupt-cellsdma-channelsdma-requests#dma-cellsallwinner,sramreset-namespinctrl-0pinctrl-namesvmmc-supplybus-widthcd-gpiosvqmmc-supplymmc-pwrseqnon-removablereg-names#phy-cellsusb1_vbus-supplyusb2_vbus-supplyahci-supplyphy-supplyphysphy-namesgpio-controller#gpio-cellsvcc-pa-supplyvcc-pc-supplyvcc-pd-supplyvcc-pe-supplyvcc-pf-supplyvcc-pg-supplypinsfunctiondrive-strengthbias-pull-up#sound-dai-cellsdmasdma-names#thermal-sensor-cellsreg-shiftreg-io-widthuart-has-rtsctsvbat-supplyvddio-supplydevice-wakeup-gpiosshutdown-gpiosmax-speed#io-channel-cellsx-powers,dcdc-freqregulator-nameregulator-always-onregulator-min-microvoltregulator-max-microvoltinterrupt-namessysconphy-handlephy-modedma-ranges#interconnect-cellsinterrupt-affinityopp-sharedopp-hzopp-microvoltclock-latency-nsethernet0serial0mmc0mmc1stdout-pathlabeldefault-stategpioenable-active-highreset-gpiosmultiple-imagesfilenamepad-byteoffsetosc24Mosc32kcpu0cpu1cpu2cpu3cpu_thermalcpu_hot_tripcpu_very_hot_tripgpu_thermaldisplay_clocksmixer0mixer0_outmixer0_out_tcon_topmixer1mixer1_outmixer1_out_tcon_topdeinterlacesram_cve_sramnmi_intcdmaspi0spi1csi0mmc2mmc3usbphycryptospi2ahciehci1ohci1ehci2ohci2spi3ccurtccan_ph_pinscan_pa_pinsclk_out_a_pingmac_rgmii_pinsi2c0_pinsi2c1_pinsi2c2_pinsi2c3_pinsi2c4_pinsir0_pinsir1_pinsmmc0_pinsmmc1_pg_pinsmmc2_pinsmmc3_pinsuart0_pb_pinsuart3_pg_pinsuart3_rts_cts_pg_pinswdtir0ir1i2s0i2s1i2s2thsuart0uart1uart2uart3uart4uart5uart6uart7i2c0axp22xac_power_supplyaxp_adcbattery_power_supplyreg_dcdc1reg_dcdc2reg_dcdc3reg_dcdc4reg_dcdc5reg_dc1swreg_dc5ldoreg_aldo1reg_aldo2reg_aldo3reg_dldo1reg_dldo2reg_dldo3reg_dldo4reg_eldo1reg_eldo2reg_eldo3reg_ldo_io0reg_ldo_io1reg_rtc_ldoreg_drivevbususb_power_supplyi2c1i2c2i2c3can0i2c4maligmacgmac_mdiophy1mbustcon_top_mixer0_intcon_top_mixer0_in_mixer0tcon_top_mixer0_outtcon_top_mixer0_out_tcon_lcd0tcon_top_mixer0_out_tcon_lcd1tcon_top_mixer0_out_tcon_tv0tcon_top_mixer0_out_tcon_tv1tcon_top_mixer1_intcon_top_mixer1_in_mixer1tcon_top_mixer1_outtcon_top_mixer1_out_tcon_lcd0tcon_top_mixer1_out_tcon_lcd1tcon_top_mixer1_out_tcon_tv0tcon_top_mixer1_out_tcon_tv1tcon_top_hdmi_intcon_top_hdmi_in_tcon_tv0tcon_top_hdmi_in_tcon_tv1tcon_top_hdmi_outtcon_top_hdmi_out_hdmitcon_tv0_intcon_tv0_in_tcon_top_mixer0tcon_tv0_in_tcon_top_mixer1tcon_tv0_outtcon_tv0_out_tcon_toptcon_tv1_intcon_tv1_in_tcon_top_mixer0tcon_tv1_in_tcon_top_mixer1tcon_tv1_outtcon_tv1_out_tcon_topgichdmi_in_tcon_tophdmi_out_conhdmi_phycpu0_opp_tablehdmi_con_inreg_vcc5v0wifi_pwrseqbinman