;Q04$Q 6PȻ?ݽjho2DV%ͯ6YDXkGd('ERK32`@p`@p`@p`@p`@p`@p`@pᆳQ1) | /   P!:0@" Р @pqFI Hp@h]pF(H pMNkh( )hF0F4,H|pdzp^|p_KJgpGwshh[hCa pGFH!F@H{ppH((ИK_ JB2_!HH|  ps<}p Kk_ I_c_O2b_Zb_"cpG6n HtF6!FZ tFH{p|p  pGpG8F FH0?"3@SB#@BؿO)F F8@>?D J pG6nR pGpGXРgРg 440 SMPР </qpЎpGp _/_ РP/F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡC?  pGpGpGhG J pGpOR   (0CC0@ 0Cc0(Fq ` pG-H)M+h#`0[OtO$"!N KUE&L ch[E#iFhGpiFH,~| 4TEHBypᆳxplplp|pO#0OS0#LIF"0 F F F輠P08 pG"F!p4@KS CkGĎpFKF D R[h *0ս@ ӿ@޽FKF ݾ R[hpG J0KXhkGpGĎpp N(4hBB!(F KhBKhB F5`pO0縎ppppNh]h%t$$d$T_ h+DB`B0 h+ IC hS`@ I` phJ-E]`h `ppp0H(FPRL!huhB%D9P,hDh``EZ``EKhB$CKhu`P DhBh``p@h԰h*D8MB Bca#a``Y`PpG!!h``BX`P)ѲP "@`hC``JT29``D20` oOR!ґ 81HT0B$"bh Cb````)[1T) n1 w1@TPB ~!|1hBAh!Bhppp p-M FԽMJIh h C ( 3+M#4*DPhBOhBChhh#`D`ZhBZ`0&3(iIBoGh',G݂DFF`ja*a``S`Qs *+س 83ZPhBBh",;3+[3T+3 n3 w3@TRBس |3?#~#,hۃh``F,ia)aD{hC{`lhOW' Ѹ2,o ?0lO Z&0ӹ 0?lP#O 8J 0(FF6 2C-Ѓ $ F4 ,F 5,FplppsFFFFaFH*F F#poO3]pHOCBlFCT4_<=<B (p(F1FkX0#nhS`Zh`pGXKFɹ `h ` d F JX3MPX(  oDp K JF H!XC5Pl!FX o lpp pGF p FP F0!F@X|0FXJFPh0h8FnS_B 0Ch[hBХh0FF+I# `F(?(FF(?! F(;1k! H `#acaf```h hK`!aba`j˱ FGF3k# h##`ci"iS``##aca F(Fo %<`o"o_o #s F`FhB!F,;FR,OBo+`p,9O2P?,;FQ,OBPlBF,sFFkSO,<"FR,Bo"hB F,`p,8FF!F%`F8#F`"FF@FF18UO,<,Bo FB F<`@njj,h`3bc`iFj[hi G(#kjS``#b#cjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gp F FF#!F`C`-0` pQ<=B,? LL_O~>xO  <OLL_Oz| 1I B(F@B@_b!*܁*6/C@ Mb h"B`k"Bcj"bBDbbk_abjJB" a Cb!*"2Aa*sh CSCs`h_+ѿ_#kdl_HJsh)FC s`h_)F0F1+G#AFF(F j#"AF(F aBFAFK(F X1BF#AFC(F I1BF#AFC (Fp :1(F#BFAFC0a +O#1;hDzh!h ! _Dh!A`@ A@AL!AL!AL!AL!A LAALAAAO 1h#pC@#`_cK1_11+€"F8F~h(=1_)@ۀ*܀1+@_&.f3F"!(F6+!GK3i#3asi#Csa#!3"B+!sh#3V_OD2_O#D21O`Q;#OPO \1L;;_`2`1;_T2_$K0+OO!!ACC_D2_ O#O#D2D2 OcO`Sh"`k"BcQ2!a*VapAp9 @! 1 +#C"(FA+'_"+f!#(Fkn_+?ox"!K# 1h#pC#`D2_Gԛ#1"F8F$1(1+pп_"h8F`w# ""19hxhM_#&`#1D;_`h_Bj:*эHH&D2_ԛ#1$1##1#D`AhO_DhAA`@!@!LAALAA2C2~@#2@CC_ 1"@0_ au#h_+ы!!_"h8F`"_#`_!`h_B: *HHo#h_+Ҳ'!&!%1 3FV_;JH0`#K!# (:&Q B0NV{B3+-H3 !)D: D1D1:o# "!;!CB3 "&'B;ӿ_L 01CCC_H ` زвoHO31_ """Z|p}p|pzp|p|p% @)C QO= )CC!1 ;@C"%&1 C' A#1GC$GCCMh)k!pA)cQ_0h2` 1 1Poph )F Fk !)F FhG 0phkhGFpG pG FܿpG8 *PD8(F FCi ```h`Zh"shshbsi#ahhDh@XX_pG!F@i`i@!o  F!@i$   hhh#D@_ZP8 F!F@i`i*F! 8o  F) *+J@iV H{ppF F@i!! @`i`i!`i"!2F`ip@!8 F\CiFi!QF(F 88F F!`iYB"!`i"!`i}`i!Bix"`iFsk)F F8@8pF!F F FiH#O( F&C 0` F O1ha(F po ( KZi_տ_ "`KZi_տ_`pGi ! K8/ *\i_տ_`\i_տ_`iKZi_Rտ_!Y`_"a_ `_ `_ `_Y`_`i Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/--xGApᆳᆳᆳᆳᆳK~pUp~~pUpUpUpUpK}pO}pT}pY}p^}pc}p !1A"2 0B  d}pcvp}upupup vpEup~p~p~p~p,~pA~p alloc space exhausted Returning to boot ROM... U-Boot TPL 2023.01+dfsg-2 (Jan 18 2023 - 01:57:16) DRAM init failed: %d TPL: failed to boot from all boot devices  clk-uclass not found %s: %lu ### ERROR ### Please RESET the board ### rockchip_sysresetCol detect error Row detect error niu config not found could not find correct stride, cap error! DRAM init failed! FATAL: unexpected command to back_to_bootrom() oscaplldpllcpllgpllnplldisplay information about clocks/mmc@ff0f0000/mmc@ff0c0000rockchip_rk3288_pmurockchip_rk3288_sgrfrockchip_rk3288_grfrockchip_rk3288_nocrk3288_sysconrockchip,rk3288-nocrockchip,rk3288-grfrockchip,rk3288-sgrfrockchip,rk3288-pmuBOOTROMfixed_rate_raw_clockfixed_clockfixed-clockfixed_factor_clockfixed-factor-clockrockchip,rk3288-crurockchip_rk3288_crurootroot_drivernopramrockchip,rk3288-dmcrockchip_rk3288_dmcns16550_serialrockchip_rk3288_vopaxiahbdclkrockchip_uartrockchip_rk3288_pinctrlrockchip_rk3288_dw_mshcgpio_ledsrockchip_gpio_bankpp p p(p(p0p0p8p8p@p@pHpHpPpPpXpXp`p`phphpppppxpxpppppppppppppppppppȀpȀpЀpЀp؀p؀ppppppppppppppppp p p(p(p0p0p8p8p@p@pHpHpPpPpXpXp`p`phphpppppxpxpppppppppppppppppppȁpȁpЁpЁp؁p؁ppppppppppppppppp p p(p(p0p0p8p8p@p@pHpHpPpPpXpXp`p`phphpppppxpxpppppppppppppppppppȂpȂpЂpЂp؂p؂ppppppppppppppppp p p(p(p0p0p8p8p@p@pHpHpPpPpXpXp`p`phphpppppxpxpppppppppppppppppppȃpȃpЃpЃp؃p؃ppppppppppppppp WpyYp~pOepfp[U <p@pDpVU <p@pDpdef wt6nOW9is;Guy#@|pDrv  @|pHYGX~CTzlmnoabcd;}BN  $  @ CH ` @dU0'Z' ~v;~pQpEAph}p}p~pypUp(yp]~p@zpr~p zpUp(zp}pl{ppcvp,{p~pP{pWpXpWp ppZ`{p=hpfpX\p}plx{pAp}plp{pAp}pl{pAp}pl{pAp~p}plp{p|pnPp~ṗp pp pp plp pLp pЎpopploptplWphp }p`pIp0p0}p(p}p p}pp(pp\(p`p\U~pHpEpTp~pG~pZ~p!pctpup}pldp|pnKep```````ᆳ1) | `/   P!:0@" Р q-Mh__!_ ## 'FB3Os$$z$$$( mON  + +  O +  O J  L  "  K  $  @  $  @O$)! ;cDD D02DR#DCDsE~~oF(O~`F 2 5 %!Z 8@ ]8 ~O8O~@pGFI ~@h]pF(H pMNkho( )hF0F4,oio9P? C )P?o pG_KJgpGwsH((ИK_ JBt_!HHF  xs<,sKi_ +JR# pGp i pG pG Kk_ I_c_O2b_Zb_"cpG6n pG8UgF HxF 8@ H 4PD8P@LFc8@Իnn-Ml`F6I0F3 ^ `8 "YFF9F0F,(F9F0F9FC p8+(#QF0FCFJF(-Ch3+#D%05#9Fi #9Fi (OEFnnnpG8F Fb0?"3@SB#@BؿO)F F8@>?DpGpF FE0o)F F?8"#F6@BؿO)F Fp@6?D J pG6nR pGpGXРР"t440 SxPР </q ] _/_ РP/F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡC?  pGpGpGKhKBKhO0pGBSYMpGppGFC3O#aOOp qK`` `topGphMFBѽp@Fٸ@# F p'VhG J pG8xOR " B#iբh KS CkGFKF D R[h *0ս@ ӿ@FKF m R[hpG J0KXhkGcpG0 D; DIB @BH+ 2"F n!ݿ FFFؿ8(FF*F!2 F8@pG0%%`hF0`GhKBo pG )ۊCjB pGhDDpGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o]( o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO1hDDCh`pG7F F!F(F4( (,o  F0(O48hFDD F(` F8"8hFDD F(` F8-AF#FF FT+O4 F+!F8FF*FAFXs]+*F@!@Fs]@+!FjF8F.FF F@F  F@}-MF FF(Fڸ%%BF!F0F]hF0F xB!F0F:FQF(ѻ@(F 0pFFF*F8-h0F Q(` 4 FpFFFFFT"FF1F(F7 JF F+ )F FJ +h0 oos FIFFSO3F*F Fpo-A xF/+ F5/! FP(FF!F8FF88F(DFFBBРF04/+/!@F.(F4F)FBF8F(F%o8FF F!FF(F8@8FF F!FF(F8@-AF FFO0 Bo BFB3`B@FF8F(ۄB"]pF F)F Fp@#:pK3pFF"O1(F Fp!F(FB"!F(Fo-EFF (F@FG%G&DBO5 F1B0 E ظBTF5:FAF Fd(oFF0 +`$ FDB-O3 F1C#DB-o-(`F?F;(h(o ]o JC o oJC pFg +h$ FFYHBo #`O3J#E0Iu@  ppp FFPI*FF# Fp@'pnl *HO0l l\(p0F#FP0Q"0D"02BF-MFFF(o(F%'DB +T;{ B%YF@F!oYF@FO3RF@FICB BѻN%O1 O1XF(( 1`FBT;F?5F FF:FT Fd tFر0xC#DB 1FFF!F8F(`O0-AFFFFO0AF F(۝00 :F1F F pGJl "x (@l -AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FHBpB;?+pGFK;,FDB K ,FɲxFBpG*FpGFFx3)pGFDBFx2,8F00F$ F8)FBFًB F3 FFDB  F9DB xO3DɲB FKBFeOzrF33hFF?pFAKM!2[BRO(!EE)D @0 p4ׂCpFF0F F$EbEBAppFNB%F(5F(Fdp H#FFF砆#0 h]By۲C +40"W"hDL` p#q0+F `hZ`ppGF-MFFFF %)(FhGFFsxO -+ x660+;O0O * ! 30 ;0 *"l+;/`i+*q %+o+лFrc+fd+T+* +`-#RB 0p;ڲ*+R#+++++T;;+hZ*`0"p#+qO 0J(FR-K OѯT;3 +`0# 0O OR(F4 Oє; *` 0T"+hp+hZ*`xO0O  һ?5)?0(FhG :AF(FhGʚ;RK ]pG RK"p]pGx0+ Cx J\D 3۲x+#0 ` h # `pG h+# `m Jò\D D 3۲9+Կ0WpGOppGm F!F&F0xB.`F " pGhkhGo%pGFpGo-AFF FFh,<,3Bo FhBChB@(Fj-AFF FFw#hk;F2F)F FFA`Go%osF FPoh,<,3B0Fp FHhBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% wh,<,3B FhFB BhE8Ft`\Fjڣ F?!!?##?A!!/!!?Ea4%%a`argD``𵍰FJ FF!ChF F)F;FmF0h F o n8F`#"#h\k+h<<<43B8 FkFF)hk `ShG pG7F Fh gh#`hkhK)F FG!F0jh*h#Fo0F##`l%Jw `!F(F0]o0F#JIb##`!F(F0]otl0h#hkhGpGF0h#hkiGFpGo%pGp FFph[hksiKb)F Fsip@GFpo%F0h#hkiGFpGo%pG-MFlF(#EJEI)% BBIl(8  CF*F F:In5_@FF*FSFYF F[orB(6B_PFBAFPF&(!8F<Fo F;FIlfFd= GEU?s[FBFQF FosB&BB_XFpXF)hL( ]ojooo!`  pGjpGh,j8" FFIl!F b(Fe#%`ca8MoFF F hF_F!j(cjCCFpF!FF(FFX"Il b"Il`b0Fp8oBom_JR\@+9 X_Jh_ $Y KXCHO@o@B6n F"E*(G* D*o@B@B0_2#Y K* FF0_?06nB*FFC*0_0_#Y08FhY!F@hriI*@*7o"A+Q#&&&&&9&&9&&0آr*(o8ҲF`h8@k@B`h8@F.F`h8@ch_!1H$H6nlsiFz+ FЗ+*h#hFh(hiB і*ѿ_O0  Il( I@_Oo<poorr8FF(F`` 8 J I` XOs`OsFC` ]r}r8L_O %`hYh;C#CCC|SCp#_CQSh;CCCSC_c`Sh[;CCCcCp#_ `_O`88YF _(`/0khm_lh-h_OLS! FJ#e! FJ2_sѿ_ Kcf_ K0_ K#e8 ji1s38F F_O@3! Jep2_[ տ_K#f_K0_K#e8 i11?-AFh FGhF!8FiFM,3@, ,S',Fo(FA +R#***G*G*9)G*9)+9)9)9)3*<,o%ҴS,,%ot,@BCorDcKBl_KB ^KB&]KB%o[KB$P`_O@ "+eUK!(F22_ տ_OK+e%$$ h)FVf?(!FH)F(D^#E,*G,D,8@CCC_0"F1F8FAm#@B@B8C#CC_08@CCCh)F0D B,0CCC,Cп_0"F1F8FAjKC#_0H)F(D8@@@__! H1FIkZ'@/(j05n6n8?0 ?!F@ SF8!"F(F)(F8F8@ F-M0FFFF#0xhF8P! *F(o (F4Ccc,bc `Ca <dO3cdad bCh[lHd;kk cl Ccd9k(Р`[hkIcl Ccd( a3hk3j[hlIcl Ccd(`k4cc#d` FF(hc[hhclC@cd FG(F3hj+ FG( FG(@os4#KFhFFF4Fl_ O3(F#/oO08F(FCl-Ԁi(%hjP#j[hXk0bj"Yl8`bikhPkj[hk0j#)lb#hiùclCScdhcl i+)lo 8al* FG(o8F(VCl5h(DѠi@clCcdiS F(7ѣikl+! Fh(,+i+. F(i{#j[h[hT+ FIcl 8#j[h[hT+ F Ih[j+ FG(cl#cd FG(ovhpGipGipG@jpGP4?B #<; `pGhki42B #<;` pG#0`P4?<;FT<_BojdhdhB `0<ipG@ipGj[hXhpGClCCdpGapGAbpGF#illKloC !!pFM K L%DB$ Fp0F!hF(D4笀||KIFH[DB pGAhBH0ЀЀ-MFO %NK\'"FF@ȿ#F`O"FF@#`FFLVO,<,Bo lltB F,`n,`jF##`;"FF@ F!F@hF]# ` Fq0#h#@F2 F #h+oFF8UO,<,Bo FB F<`@jj,h`3bc`iFj[hi G(#kjS``#b#cjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@GF #`C`-MFF (FOۧo F(F'I(C9F`F(F(9#J !lF)FJ 03EJJ  (FICp(FI>FP(F I8<`$p$$4FFo oVrdrorhB1P1 pGph1@P1>>>+R\Ҳ_p ph((RZ_RZRZRh((RX_RX`RXh(( _RX oF F!]7FChjFF`ch;+   0+`00hBRمh@Ni,%%BG-E ip+`p)Fj@ ѳ* ,dk9Ld!!&CBB@r"(FFh>FpOtOtoOzrF!(FbC{F&iF(FF8Rod 0FfBom Z#0# ] -MFFFF@hF`(Fz6(*iB*H&0F Fao(2FAF FWFFEUF(]F-4""!i bo## FOF- !! FA( Hi9F*FBbo /Dѱ"pp#0##Or# ]0KBhPB} }0 ?$?!F(ѕ 0BoI 0Bѕ 0Bѕ 0B"R(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oF-AChpJ?C|BF}À ?%?)F_(@0+Op(Or)F0+ZJR#ZKa`B@0RBR^#C3BOPpPK( bB0j00`Z*#k0 f 0i.D g [0#00[0#F0 x,#,'J` #K`݀.CR3#1aEѕ06Օ0ѯ#"F FA#0#iKF [CSR #0h0 }0+#0o o?$k@@-EFF'_ i0"#!(FC F(? N1F(F5F(F FBhihB(!FB8Fau-EhFF+@"a# u F%(sj#xsb F.F(}#of#a F*F)F F FF(g F#r0#h FhHK@+ #Os#*F((0+@Kc`@77#"0# F(9)#0##hbhhREOCC F+ ?FOzpO`#cs#a#Jahd0B2b`%(F n) FZ ~F)! F.F#k+ 8Fozd 5#0omHo^FpFh[hCSCb_ FI0`Hoz! F(#0pq-MF` %(F`@F0+^%0P+^#",0# F PF(@6"T#,0d0*F # F 8F(@ch"+:0 Fd0 #,0# d0  F(@!eahOcddd@a9)9 FbF(Ў#kP+ F(FF! FVF(@Ҁ#k+ 0Fz>d OCc`#ks#a#d0sIa`HA\HP#0'KC!%i#gf0Cppc@-3|CC=F"3@#5CC@ZC"5*D 2Oq"#ag"#$#&#(#*#,#hckZ ", " F p#O ,0d0" F 0 `F(F# Fi0F(= Fz FF(3chbI+7#H0d0Fb F1F`5F3#3##O '?`1F FF(| #`HIBHI@HI>HI<@sCs2W+.BHOBKFUc`HjbhDCSb=K!dBV !,JlF(1%&OB V%jFS &h#FFFF`<8F#hbhh5JIHjRhRhT*h!Fk[kG!T 8hkkSo%!T (!FGqqq rr-M} Fl0\Il9+o }x+ 1FBO  P+A+hh[hB/l#\C0Yh'D[iո ;Hj+BF9FG((Fo(F )FF(P ":H )  6  (h0)"Yhk+ F9FG(g)FIYh[k+9FG(WYhkoPsk-AhO $ pB ѧBih`iz`*zp|EnxB4-AhO $(pB ѧBjh `h `$|EnxBѮxB4pFFKBFXPB(Կ  JBXYB#ɲ!p+`0Fp (OԿ&&rA#ɲA#ɲ-EF F|l"hh#F,,O7^i1,RXWhh  F SF!F0Fjn@D@!F(F :8F( 0@@oK@ S+B*0(opGFpGllK S+B0(opG`m-MF!FF^Jl 3xpo'!Fl VJ!0_( F FFO h 0!@YhQE+0O`hzT`!DF`zAE7aii/Fk .F))Fc) 8FqF)aF8FF)F2ek''=α-4%%D F8D $jB$jB  l2-4%%D D !aCi\|B!pQn9CQf4 !aC_j\|B!pn9Cf4oNss-E FFF, O FXk 0VhhsOw5F!cBX\B0d˹9F(F"@#D9F(FHF0Fp'#@*-E FFFFh|hPh+9OwFF, O T!cBX\B0d˹9F(F"@#D9F(FF0Fd'#@N F-A)#DFhFXiVhh FFi h0D@Ԙ0c9F0F= #"@@C9F0F"F)F@F~(0F( 2@hkhGo%pG FC 8:F %da0Ta(F8ph )F Fk !)F FhG 0phkhGFpG pG FܿpG8 *PD8(F R hkh"GpGl`.U0F4I2F0F2IF!Fc ` 0Cs0 :!*F9F0F9F*F0FnF(0F8FF,#X!FHc(-( HL1Fc i(1Fc S(c \shsps FpCi ```h`Zh"shshbsi#apFUF(FF(FAѨi(3op `"Il`"Il`"IljF``!(FعhF_ a"i2Il a(. ## caOO(&qqqMohhDh@XX_pG!F@i`i@!o  F!@i$   hhh#D@_ZP8 F!F@i`i*F! 8o  F) *+J@iV HmpF F@i!! @`i`i!`i"!2F`ip@!8 FqCiFi!QF(F 88F F!`iXB"!`i"!`i|`i!Biw"`iFrk)F F8@8pF3F F5FiHgO( FC 0` FO1ha(F po ( KZi_տ_ "`KZi_տ_`pGi9KZi_Rտ_!Y`_"a_ `_ `_ `_Y`_`i Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-]ᆳᆳᆳᆳᆳްn"v*v Kttu$ui$a$a$e$tttttt QV  d@ @ '@B@x}uu@x}e tc@GP`ppp@@@@@@@@@wwwwwedAeemecvw0wxuu,uAuvvvvvv vwavyv     )[]00 (((((AAAAAABBBBBBalloc space exhausted %s.%s/chosensame-as-splu-boot,spl-boot-orderspl_early_init() failed: %d DRAM init failed: %d SPL: failed to boot from all boot devices clock-divclock-multclock-frequency#clock-cellsassigned-clock-parentsassigned-clocksassigned-clock-rates regclk-uclass not found %s: %lu resetting ... #address-cells/aliaseslinux,phandle#size-cellsstatusokayMissing DTB MMC Device %d not found ### ERROR ### Please RESET the board ### compatiblemmc_blkMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d MMC: no card present #(-27x |a`M`Hw Nw Tw Zw `w fw lw rwxwddGbugtqu8i$(Hiuiuli$(|itlj2wpGOjwcHk[fdxkqSukq'(Y' |xwZk[bX|IvCTl]YX-XxjwTk2^ m9vtlk}rnxaue\ueUue{pauU$suCEvGqSuY@wTZ~wZ4vwcbbtl;rn= 8 ('firefly,firefly-rk3288rockchip,rk3288&Firefly-RK3288chosen,/serial@ff690000(8same-as-spl/mmc@ff0f0000/mmc@ff0c0000aliasesN/mmc@ff0f0000T/mmc@ff0c0000Z/serial@ff690000b/pinctrl/gpio3@ff7a0000h/pinctrl/gpio7@ff7e0000n/pinctrl/gpio8@ff7f0000t/mmc@ff0f0000y/mmc@ff0c0000mmc@ff0c0000rockchip,rk3288-dw-mshc~р Drv  @resetokaymmc@ff0f0000rockchip,rk3288-dw-mshc~р Guy #@resetokay'1?serial@ff690000&rockchip,rk3288-uartsnps,dw-apb-uarti 9LVOWokaycn6power-management@ff730000rockchip,rk3288-pmusysconsssyscon@ff740000rockchip,rk3288-sgrfsysconts~clock-controller@ff760000rockchip,rk3288-cruv{;ssyscon@ff770000rockchip,rk3288-grfsysconws;vop@ff930000rockchip,rk3288-vop U def axiahbdclkVokayvop@ff940000rockchip,rk3288-vop U  axiahbdclk[okaypinctrlrockchip,rk3288-pinctrl{;gpio3@ff7a0000rockchip,gpio-bankz TCgpio7@ff7e0000rockchip,gpio-bank~ XGsIgpio8@ff7f0000rockchip,gpio-bank YHsvsdmmcsdmmc-clk ps sdmmc-cmd qssdmmc-bus4@ qqqqssdmmc-pwr  lsypcfg-pull-up-drv-12ma( sqleds gpio-ledswork 7v=firefly:blue:user Crc-feedbackpower 7v=firefly:green:power Cdefault-ondmc@ff610000rockchip,rk3288-dmcsyscon abcd(lmnoY{;f}s~BN  $  @ CH  `@0Ud''Z syscon@ffac0000rockchip,rk3288-nocsyscon s}configfirefly:green:power #address-cells#size-cellscompatiblemodelstdout-pathu-boot,spl-boot-ordermshc0mshc1serial2gpio3gpio7gpio8mmc0mmc1max-frequencyclocksfifo-depthinterruptsregresetsreset-namesstatusbus-widthcap-mmc-highspeedcap-sd-highspeedcard-detect-delaydisable-wpnum-slotsvmmc-supplybroken-cdnon-removablevqmmc-supplyreg-shiftreg-io-widthclock-frequencyphandlerockchip,grf#clock-cells#reset-cellspower-domainsiommusrockchip,pmurangesgpio-controller#gpio-cellsinterrupt-controller#interrupt-cellsrockchip,pinsbias-pull-updrive-strengthgpioslabellinux,default-triggerrockchip,crurockchip,nocrockchip,sgrfrockchip,sramrockchip,pctl-timingrockchip,phy-timingrockchip,sdram-paramsu-boot,boot-led'V,cQ+pzU-Boot 2023.01+dfsg-2 for firefl` @ᆳ (OР iHMP  H4P { OР iHM  H4P m OР iHM! H4P _ HOР iHMp! H4P Q OР iHM! H4P C OР iHM0" H4P ? hOР iHM" H4P 1) | /   P!:0@" РpGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDHF !Fh a a8 DBpG;?HKdKaKaX-MF F+M,OEE+K`M@0L \%KB43B#KB;B*y*KZ hDCJ 0!? ? #9FHE]5"[Er BR  NB~F9FHEAؚdpT  7%F#h#`0F90OoBдB  4kHBHA.2`B`A+*h2"D"`K` I"K`-E"MF+h iFFDB,3B#`##`%h F#FAFX$#hB$##`P(F-h5BO :FAF(FB( ,#`-,-A FFFH)*h(Fd!FB)F8F++  F3K,0hZB2` (F"8F FHHFFaFFVF H(+"\ȱCh;`###hhB"`- 1K,(Fo FHH IM h.hB($3i( ` 1K,hD79D![R3aD-h F*i:ha-M`O1F`Dc  Y D)D!DO1z`F "XF*F F ` V P2"D"R*a :sha H K!hiP 0pGHpGHpG.F B3 pG0j L;:۲T#0 ЋFL"WB{:D3LD?C@۲T#0B V[h@ŲT%P%T  ŲT%P%T  CC%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdH8# XDas U-BootPPRUNTSERVdPeg#??OopGpGpGpG@pG@#???OopG8F F90?"3@SB#@BؿO)F F8@>?DpGpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF  ޿8pG/ J pG6nR pGpGР7Р7s1>PРX T@K((0 S== @ /`ؚnY  _/_ РP/@ /0Od@P TP  Q:< 80QR:/pp`z# kl#iF#]pGs0F[k`H F/H!D("HDUKIt,FHDIO@O`0;  FGp0kA(pGF H/03 F HCH F@"AVpFF(F0Fpo!F(F(FO6F`I@b(^H@}0G%@$0C#&@CC'@CcLBLBH^ )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHD (oboxF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYkk Hf HLa HP\@ORHCMYbisP L P :P pGOCiF< Bĸ9L0J3 `pG@pG pGHCo-EF"OI1kkMH%lC_ pF TkT kYEHCNj"kakCHCH#jbjjAHCB#i@HciiiC:#h=HhchhC2.N!n!OZ"z"_C#c#_ v V 0HC#l/J0HFF@F")M )K+FP<'HC&lk $H''%%oC||Ʊ,H#EC5 <9F@FC.$j9FPFC4,U$ }wØGאrAWv}˃F4HCk F;c-k"<F4HCk F;ck8F4HCyk F;ckn7F4HCek F;ckeF4HCQk F;ck6F4HC=k F;ck*&F4HC)k F;ck/&Dù@ FFHC  fOB @ R@ @  @ @ pG0AQA@aC pG 0 k lk SB!0?CS?opG??#S?opG0pG%E F!0_ #P?0#S#?CY?OU3??C?o?C?o?[ O$OopG_KJ pGs<7 Mh,<,3B ")F`hBPjF!`h$9 0j,< IHC5(  `HC!@#FFF׹L0_0__ J 2B2B IH kIsBR>F@ " &sO0 IjFMN,op)F F( FIXF1FBL( FMjF(aI F(C/ Ih` F( D`(F)C h/ pGFPHC_ FKJ H[s BR_1 +JR# HLeFIHCR!FHCN!FH щ 0D@< cP kBd0-Mh__!_ ## 'FB3Os$$z$$$( mON  + +  O +  O J  L  "  K  $  @  $  @O$)! ;cDD D02DR#DCDsE~~oF(O~`F 2 5 %!Z 8"D ]< ~O<O~@pGFI i&@h]pF(HCD pMNkh=( )hF0FC/4,8_ % LT_`!p J?X_Y_Q_Q 8_OKL"_ORD" w_KJgpGws pG7KFy۲_+I?L HB0!F K(F J?OF$ F0FHCccdd-EFF,MFF*F#AF0F $H='0KB0BؓBK1F;BF#PFFHB0BғB!FHCj&0FBB0DBB!FH/ؚI|nF, F-AFFCBBBFog!F8FB#H.p00[(c]8FIBFEF !BF*F9F FBa"@FIB\f51F`BN FB DB `:F FKIC. FIB6*7@PpF/H.-FHOPF0o (FpBv_#OPF()FB 2FOQ FrFh!F H F F%p F o"-MtF0CF 0ղMOr!(FH.]F#F1FA#0cBл"!C-ڀ# 3-р# 3 #MFF00(m1FHC402hKBЌHO 0+]шHO -𠀻 30FH0Fk}H0F{HCzHq)xHB.г+ ++@0h0+lK!0FjK@"F1FB4gKCl#kdeHhdHhPF(+њ000000 0 @D0000+0QJ! (0 MHqMHo+kl+RЫi00+ 0 D0|x?@ RF(A3H-2H-—F(@o  F%HB<$HJ)!K AԒ0++#BFYF wF(PFؚ'Vjtjj `ܚ0Qlo` 0 01F Oc0FPF0W @PFF& Fo oVHBVHB 7CFZF iO:OHB?1&?!?0 { B B BclC"0+?H* >H&RA0Fr0FF(A x9 0ՔCXBXAF(HBN-?*&#FBFYF@ GF(QF HB<#FBFYF GF(#FBFYFOpGF(j-?#FObAFXFF ?R?[N5k2QpG-MFJHFF-PFpFO 0FABغ"@HB#FZF(FM̼F=) b,f*!@FBMO GF0HBoT0):(F(F9FHw)F!J?3H-Fб`AC#D+F0FJI^( ?DIFHBy  F  HBk F H "m -AFFܽDU FA7(hAB'o FFF!H-P!B,F #:F!F@ H!FBG H-pF(0FAb 4="o-E FFFA"0+(O -.&FW(A0EED0F #:F)FF@H!FB3FQFJG jF!PF+H-K(FF A"0oF I(FB#h5,F0kF" 0!kF"F Wp FFF-z0H- p1F(F0Go @H!FBdG  wpGpGFFFF+F1F:F FG0+дpO0 KS pGسhx *pG3`hFBhHB%xq-AF xF/+ FF}{ñ#0(FAFAD*FHBo# }Or!iAV)FA] HBBF IB FehG( ;`eeWsFF FF-h!BU( 3F)F FpooF@h%h" i`iii j`j F@ -Eh FF9FFHF;3 *\ԚBѪp `P! HB"h#U#c`Sz\ 2Ҳp13-A F!hF a`F ) )#)#Fkx )"3b`+` .# "*# "!F# "!F&OW6) hA0c`6пs" FiFFh( !h2FHBop+`窃F"iFFh, )h:F HBo "!(FB0`(FC F FH-H"F!BO(o o)FHBoCFHCQ0 F0 0 I00Bn oa b-M% F K")FF @")F"! F:#b#k ckB{H-&F`iP aObuH a (FA"F(F h#ahlHB:iPFiJ c[(aheHcH-4!FaJB( #PF]Jh?(ahZHjYH-hFXH-dFWH-`FVH-\3F*FTI!Bj QIAE!3(#d0jei0-YOr32S(FAF!ADA5Doai#!HAo8F'/a@:FF ~ +++)F "3"+FRD(F2FHA F?D F(jD"!!( 2FHA Foi<ac"d`" " +ǀR#6{8{8M7{8{8{87778_8{8{8{858C8Q8{8o8{8u8"  + +khc`h@?h`8o J*2FUHA* 3QIh@F(@0= a(1F@g#3pFBI`i@ !0F@1FBFa@Li/^i+YFi+N#j+G cj+@$#4#c(#c."P +QR#}839=96396639393939398c693939398!@g4 lF$hhl`/|@3"+FRD&"FH 'e抃F}H FF@F F@8D"F I HA 0@FP)F FM(do VsF F*F F.(opI`h@>(ahB0F(+`U-MF!FAF@FBF AF+HAo0Ft(>%(FF8BF9F"HAuoh,<,3B{УlBj! F|9F(FP(XFXF( K2! J0 A (0 (V-AhFk F;hF[hF0F2F)F F;hAGo%F hB -M hFF F0DH@ F#;hC;` rF(h!F(eУFF [E[E3H+/F(;?c(o(F5YF 5 E(   1F?"I?F&,o0F(E'E$04YF ?F"AF(FK>DF#a=ba(hF(0oo 2F!FH@m^v<5B8F Fh#he` +-ihH8@@OChhHYhH8@@C8840F FC!)Fh8@o F8@F@h88" F!FO3%`b8Fj k@FF%ci4l3"kѥbh``#h%a i3aiiB;! Foj`j3BbR#0`1F F(l`a&#h[特bh"`h!i3B`#h`%a*j4Pcbbh""jR#p8F(9F FJs FFFB)F Fy Fop F(Ѣj#kS"0`40 F1F FA(l&#h[`a1F F]F FF pFF!@"F#&a%bbpF@jj k`k@iF3#S``#`C`hh FS``#`` F@jF+jU(o oF F jHZhIj@ FFFH@ F3@hqw'((H H@h_e'(H FFi,dpGhk[hGFpGhkhGo%pGhkiGo%pGhkhF`Go%pGphFk FhSF!(FL)F Fhp@Go%p-MF&FHiV (F(o8F!0FF(>$ OKFO BE[EO bQF xBhтH$ 4  ,CjZМBb#400lbo pFKF*F!J@ k?5 c,1FF FAPc#b(F6po FAfFkFB!yF"##F0k,F((Fm F#BB #Ubucoo o-AFFF@FOFAF8F F,*hBAAF8F`"#1F F#,+`o} xaCa 8oFh `h iB 88AYKh(FL7F TFE(` F07( iB08-E0  5ñ1F .-KLOK\CdB{h+ 5D7\JI( "QF@F? O3RF9F#(м~@~ pGp FF"! sjfk# J TFop1F(5NsF FF!"Fh@>OB"`F*Fp;K`  F عci i$fiF0F Fu/F:h1F F KU`W?+*F/Fo"O1 FsF{-A FFOF"!0Fj4# J1F(FtF o AF(FF(AOsFF FF!"h@F"Fyp-E$FKFF  BFIPF@ "!F(hMXhFQ :hB;` ooW(H F+d(E"!@lFQF8c/!?`4"FbjUJjJ!+FJ@?(c o 0F7#b0F(9F2lcO6rAfF#K` Gp0KkJ2!@d!-(o]KK` Fui F+X/I??&F?!(K(I F? F'I?hiF"(F F`O2Oq(Fk4F8(i !lJF@ )k" ?/! ? p0F>( 0Fkk*k F? Hooo[emOFH F@H]]-MFF F( 'Hk:F%H@5 )F# FJ=Fp)F F=H)FJ F=O (2 OCFRFYF0F>( H.ZF;FH@{)F F<(bBr-MhFFF+{h0F;0>HP ;HP+@WF@BF :F1FXF>~.E1HOR9FXF+>F0+H>F(?R?2!F"D&H@%:F!F0F(F?R;?21FHs`2D@4F@p H7c -EF H! F9`& F(6cl+FД"0+B!hIH@jF! h+5CH)F@(F;-(t@HZh@%.ݨh(!@Fm((Q7H6  !F4H@ Fe2H( F0/Hk  F+H+H+)H (H@ PFUF;$H,&ih6BVE BٓBH8QF0F?5F!FH@9%F)FH@4Pkh;`khBHYy !1 pGFF FF ( BH?O5AH?(F F (#D+F F4J5I F 3H*, "!@u(/H?p0BFԱ"F [FF&H? F(! F 0˱0c`!F8F> F  Ft(%*Fklk!lHlXlilllFFFG*pFFT!?FF H?M{"Fq(FFH$?? FpO4&&-E8FFFF 3Xh?xa:)*#)( "I`hD`hJ+  B H? O0@!1F(Ff8 #KBF@sSF3ؚ FH*?!F@tVFFH? F("Ht"hKBHm  FH F H_ F H HV Hjj'Vjjj j*FF Kh@&$!W$? 4(&B0F/sF F*o&`KHhV?jkF"1F F.p/7ML#d FIFaCH04s~m۶4s*̿XhH?A"iF =?3HH 3]@@-MFF FFFFP6ܸqbI`h>F(@Fh?YFFh?YFF i?FCF9F2hUH?#FBF(F1hQJQKFBFFOH?` "KIBF`h>qF(?Ѡh?[FF(Fr4`CH?"BI`h>[0(F1 "9I`h>NX(F1hA(9F6H? "4I`h><O0(F(9F.H?+I"`h>)F(Ѡh?FF(F("F9F#H?}"I`h>F(Fh?YFFh?YFF i?FCF9F2hH?_#FBF(F1h+JKFBFFHh8FhRc} B!H`4pFFF . jhx-*H?O4 F p%`)FOzu7 H?$=I-AF+ FFO0" Iph(ChbB-hKB)FF3A`G 49p8FH*F F()"hKBHF 8 FH- FH+H#l@ Hh0*ѽ8@H'Vlmm$m4mBm*!Xh?F!FH?Z F@!L8 F"FH?HF#H"?>]@ZHk#lk!WH#kUH#"lTH!hSHahRHhQHPH?OH@MHT "KILH?@FJH?II>N*SGK(FFEH?DH*GFCH?CHpAHt@Hxx @p *9 77Nh7O,<,3Bclbh 3F;F0I1H?cl FFi#,H^*j#*HX!hk@*'H'I?j,<p ==Y<{FH?+5>FQ[g}ppA)!:*-AFFW I"Xhb@hCF:F1F(FFA`GO045*8F"XhF?"FFh?FF(F*F!FH? 8O0TH? ]8ML(h5 h5#J+``J#``8txpl#sF F3Op6TFH?(F68H? 6C Fp/tiF0F1F/Td$A H?)H?5V0 Kh`Kh `pGpl-EF00FBFFJhDB~"AF F55vK@ :F1F(F35 K`F(zl2DQ||C#||CCSc FH*kXEH*g8DH?DL Fh!?F @H??L(F;y(_=Hk@r'lhc$@TG$ DT37"FkF ! &5"1FOPkF"F ! 58(H?'H?'Ljh)F8F#$Dd6 F4C|`F!FH F3K F3!F H0`F(H? 0l+O3 `qiq:MSMMMM MN#-A:KFhF8L!h)8$2F#F Ft2#FFF2I1F)F/H?E/-I3F*F h1+F/ı(H?2#*F"I1:F(F5, F0F2!hFH*xFO18Dd! F@FO2AF8q!F2F8F5F00Fk LF1FFtx0O@O" *-AFFO4 F5^F0 A4H?$,Шh?I/KFB(-Ihh>EhF/)H?$hh>F"H"I>IF>"F!F8F?F(O4(F!F"@F?F(!F0F $ KhB9F H?h$ KhLI+pl-EF##MT5"FCFFFdKhiH !?2H=]#BF!F0F0k(#0#Oc"F1FCF8Frؚ/ IF=h F I=P FI=|8 @B  א**O0Xh((( @JI(FH> * *pG**O0Xh(( ( !JI(FH> * qH>~ A-MFHd,hB TH,HI#.#O!.!@>WNOH  V+ZEPF9h>IFE $hu DU pG B!Hd8/  !  e -AF+ FFO0" Iph&(ChbB-hKB)FF3A`G 89p*FFIXh=fF$&FW&6xB ) $-&sU-;\h!x-)5axp)s)0ѕ/!0h>10(=6?H$cxp+!?)FH>1F(FGF H$> Fp$$Kh?$@h/*FFlKhlH lH)kH>X !!Xh>.FeI`h=( @()F`H>?!>F]H)F(_[H)F(FhF= F=FUH)F *|RI>DQH)vFOI >'MH)k (jJH)d8(HI F><FH)YF( DI>DCH)NF( @I>D?H)CF( =I>D(F?78(F>F)F)H>* G%HOK$H>z#I>} F"I>xF =8F=FH5/O}"Vpppwpp +r<L*!Xh>ֽ pG$*e$*~$*$*p$*$*B$*[$*pp*FH> "p#h`h Fh-8+F2FahH> -M!x!$*m$+$+FFqZ, * I+Z(  pG(x:8\( pG3-EF9H F)!>*F!F0FF2HC%1OBܽE.H:O7-8F20F/0F=95D0F=40D'ѼB"F1FEH>nH>k,4OpeEHE>\V(E:FRFH >RBH>J O8BHbB:FBFq] H>:5މ<A 8 FFH>K!F`H@)P|-M*FFO4E"IXh=F(p FF?/x-+!>qF-4 .3@F2c+ q+%?+  ?&p0 $  n(FyIzH> F1FwH))JhB-FjHFF;-(:TFeH>dN3hcH-"bIhh=F(7/rFh>0`0F (!Fh>/F3h[hFAF0h;:!FKH>W!F(i>2hFRhFBHH>H}@F$$"DIhh=ȹ/4h0hh::F)ЧBHzQ4X$ x9!!!! "|%""""""|t##Y#"(F>*x?* 2`23R*)FH32x )Щ[**3MKx]*0x *24X$ B\Dx])?[>K2 CF$= E@F=*D4S/BD7hhxg+@̀#/2/њ0s+))i0h :0n+s+H/F!F0h:!FF0h:w0Fn+/!hi>FO5{BݓB 5n* ]E !F"0h:F@Fb!F0h:Nښ0s+@Fi)O;KH> ZF!F0h:F FI(P*Nݚ0v+>/ "!i>(F F)Fȹ-"h9I.&. F=]7D F=X0>DB!F'- +OBYF9F>f6%Ha+F$I>[s+rF:9FHp+#l+@ЀO/6/4hQF0h:)0h,Z)F"F:?F"FQF H>KO 8#|3#A#x|###;j$-(!FH>$(FqH>")F0h:EF pxK)FIH >4,ݙH+J,?cэ ")F0h9hF 0h:EkhF(KѠEsIwH >EoItH > pH>gIoH >EԬlHA"kI=1h0h:]/0h h:*B:JFaH:8:@F]Hhhxh+h/ѫhxg+$VN)iV <4 ,єX$h (MH P>O3hJHZh,F>G3hGHh >A3hEHh >;3hCHi >5!FAH>13h@Hi >+,3h=Hi ># 3h:Hj >,3h7HYj >0h:F3H> 2I"<F0h>3ha",Ihh<F(T"Fh>"FFh!F>BF;F0h t":$˃:##! $$$$$+$?$Z$v$$$$$$$%%3%J%a%""\Ihh<5F(^ѫhxp+(0h:1FUH=UH=TOEBAF0h::BFNHAF8F2=na+"Fh>F" FFAF(i>?#F:F0h:`:F9Hd+EFh=F0h:w:F0H"/IhhD_E  K`K`K`KH=3 ^*H $  H=tH!))\)KK-AF+FO5(F!ph=!Fh=Fh8(F(F=F@{9F;F!h=!0i=!Fc+ #NF0B PFF8FF F;-G @ 8 (Կ  (̿  C1FPFz1FF8Fu-! #XBXA  B  BBB  4\E)FH< *FFh (F(3 H (hahho@ #O0,(F (KS H< Fol|qF$ N(FV{;t9FF(F;R F4,O0l*sFFZ\h" F-I;; ; *L+M p hi F<Cl !H<y(F<|. FF!FH 4|LP0;4 b( FI0h;*FF!FpH< F!BF@zK~H`~H<}K~J`~K!`}K~J` "}Kp#"}K`}Kp}Kp}K`O3yKyJ` ((& F _ 0B@ qZ ?S_[ F` FZ FT_V[XD?۲ 0BDѢ _" 9ɲw "+ F+кDD7@0+@4K`@*h3G#0/  3D? 3B (j #+N'3p##sp7q 3pN#pK 0x0qsqqJ?*@@KxB#KhGܧ1.c.i././../7/uԠРъؠSvJh F tHB8F`S pNҲ@#nI `mInH p#!mKpeI hB3 ` hiH+e~!+1qc!!+qqaЁx_O 9ɲ9` !+qZx`@(HXH+pO@qNXH+y O-1rEQI@y+pO#qr?N!+r=1 +r; +1s:"#ss #s~#'s3t#3p spY#O p{p 0T07Dp)?(A@'''''' ' ' ' '#3p##'spY#pp7q0 00qsqqBF Kh Khd' C `Ozp;,?&"KH`1F F2F1FH<1FH'c!FH< K`$ؠĠ/v/Ks.*-MFF:KhPp!0h )ph<JhDh<F!F ?;F)F"F(F:j K5DPp`O0   H*L!Xh< `!hH0Kh'`hx<0:`(1FchYx-=Рh 7 6-h 9-! i;->ѻ7"I:p}H;wO;XF!`i;Q<0i+F-VF&$6@pOBO B ;!F :H;0!F :!FF&( ;FCF!F\K\I ,(F!FXH[F; 4r+Zѝ6pO K`>K8 :K`:K`~Os*F>0!F >*F!F9H;O 59EҺEаE3H;4䲺EѰE*F!F.H;>,H;5Fw+!O 6@'NE8Pҡ*F!F0*F!F0F;O 59 >0B4m+kO 6@ONE8PD|( $Sh10)0011x1˃11122#*F@0!FKH;W!F0F;S)FH;OO 590B4䲯@0#>  @C*F!F@06(8F"pI:(@Ā80 +؝90 + hH;O #F6p EbM3F9F@"F9F(F;#O 64 ⲓB +VH;{߲TN3xB BAFC3LLHh"F;#3BDH;FK6B #uhCHUk@CF;j1*Q@)@06J7M_*F! "3H;+H;30J*)!F(Fk,ID+KF*H;Dт!F(F + !I"J+F!F(FqI"I:(-lh112252x1˃~2X20020o2100ShsFFF";FB0`O0p x-* HJx:"!;F #`x*-M*FFF@n[hxKh Kh KhKhKh Kh KHKFhhHx:(1kh[xx+-Ѩhkh 3ChCj w.[j+gr.щH c #7w.=/&U'!;.GF#r.7/PU'.!@F:iF(;Р ZFAF: `  # #` FA( F 5ڿ*F Kh@ * !Xh:K!hO0XI-M!,"FK!h(Ch+ڶH $ F+@$'BlۯH +H JH 8H JH 80KIHF: O NTFh4F!F+f@F:$F(?6BO'I6B; (A,;!Or#"% NO)F s I+F* 2F:F:Y"95- F"  H:gO0 }ODF  7A<47!7$F!} FF!FOr! +=jF B !}"Fh:FxùF D(//JOq :. h h '#FJH:O0W7|q-A*FFO58IXh9wFع3+hh ( . iH(F"+H:%)I`h9U8"A$I`h9HF8"AaI`h9:"I`h93"I`h9,F(.FH @LKOXF(1*h! DBA`F@H90F?I8;(0F=I85(0F;I8/(@𪁸+h10#( @#x++4 F ''9FB?x+ܮ(h?1#Z2D[B#CBOAG F"I80(h`###Gй H9@'8P9-199c9:I8(@ҀH.h8Կ#K¿2Osb@  X u aM)FH9$ CD 8#F SEp5 X DA !F8F =\d\E (\F8d( XF= dyH9(F8 !8FF =6F y&h"FDQFXF8( #D D'D9F!ȹ1B"FQFXFX9F![K(FSFYMYM -q8R FQH9f@FOzqF F=KM FE3FJH 9S$<$"AI8"=I8(hF:K"2I8(.(hF0K0H9$!F/H9.H9`9G(?î+h2FF1F"H9,H90FI8~(YU 9 H9FPH9Qo9Q:5:cn:Mb:{9v9:: ::;I88@I82F( (hXan\Q#G=#FGo^/;-MF#bN3hF `K3`_M)he]HLpxh@9XKx`:)`@P9x.+09x@+090`!h9(`hDHx)С0۲ +١7۲+١W۲+ ;H9$ F`OdMG\۲;CCT42,K!h,K.Jh#F98('K K9F Fh2hN(#JK)hFFOl+hHH9yFH9q@F96瘡@B9t909>9T)˃N9-E*FFFPF E 9IXh8F&=4--4H$HF8 -.H$F-Ih8,Ih8F*Ih8Xh(H9\gi!H9F%ch!h@F9(AFH%#QFJH969F(H9+2FF  <r<$<`(<~7I@<FF F"!hF9g:hFhxh%5`"#1F(F#%#`-AF )F829 LF8OM\l|hh8d d @(, N(W,9it(Y, F?H81 ",!h:H8% "/U|"sT#6U!chF;+0J1JR# 1/H[8@F7( HSFBF)F'H8)F&H8, й[('H8PF7(0F7(ClF<( 7()F F\#;p8B}c<F "!hFiF F8FiFt xClhF(ClnGаq ?$?Os"F(!FH8fP-MFSH8Z1QI@QJ F 1NIOCMHNK F8B1SJH8<(FGH84,FO1CEBHM8'?H8" !=b>>====>>?J-M*FFFFj*0!Xh8R-F*ѱhO 8F t9F RF(H+F8#FZF dXE *FQF"H8 $L! Fr(- FH9 Fo h ?YFD;PBF 1 2B FyCS K@F`1hHO0/*sFz ,FFhh8!FFh81FF Fp$O4*Fz  pah FiK8  O0*-AFF4O4-[xzl+ s+?!ph84F?!ph8F4&F/4F[V?x-*)F@F(+I`h7u`*H8$ F%FF$I`h7c/"`h88Fx H!FH8HF(`HW$!(F (1((F H8I!  Y8  "!p$ N M+h0hB#3`+`p#i4笡h0!D 2h0!D -M*@倘h*Fh7IF(#lLlI#`7F([#F@F Qg:!(F7([i'[O !h\M (h(P"h(` //` i`TIPTJ Z`.F(;!#hPJ8#-h" U/ahBFhQF#0EHi8#h3`#h0FJ)F*FXF8A!F8H8$F0F6@$ F$+K*F!hh w@-H8$!(F$*HF(H`'HJ<&&O%H@(F J(CH8(H,H1F8F8x@F7> 0HO4]' ??S?r?????@B??? @-MFTKFFSHh# /F'!ph8/F !h8/Fh!8F F(]"F)FDH8"hCKB BH8 %& Fta(F(DуH7H7рH0(HiAF2F;|(F F@F0F,uI`h6*F(Xli[ !F;`D?4$?@4 nF  G AF(F$?B_H7o!F(F FxiZHF7aRH7[0(SHFNHzAF(F#F +Fi@FHI`h6(I#iFO4DJ{`DK E&11F(F 0GF`xh$6i8H"S(Ri6H"L(K1F3H"9(D1H$s(<.H7 60B  )I`h6z(F%I`h6q(ޮ(F&i 0FD+H7'|'''c''~5('(B(q(~(((((((((|q-AFFT I"XhXChBhCF"F9F0FFA`GO0KF16!FFH7m VpFKh6H7`O4 Fp*"`hF7F0FBFH7Ko p@Ͽ"hF7)FF0F?F()FH74 F簡 A)A;AF KFh5H7 O0(F /F"`hF7F(FBF H7o @(F!F!F H7(F3h I[FhF7*F!FhF7 簡 A)A858-E,Kh>+H7O00F Fqh&H7;hhF[F#I7$0FZB H7 !F0F =!FH7(F*"!F@F7)FhF7 #!F@F7%;hB H14PF,5簡 A˃<-E "%KKFKHK7\U '&FO*0 i "iFl8FCF76,&FF,,,, ,*8* 8]hI(FF@)F H7 F8@Kh+H7O0ZhlH7簡-AFFT I "XhXChBhCF"F9F0FFA`GO0K&O``F8h FF H7 ` =(`0;h HYh7 $h+H0F F紡F0h!FFH7 V"hFFFFPHj7 F@ٿ F"hFF!FPHj7i F@ F[FhF"FF.8F Hj7G(F@)F H7= FFFhh7F8FF(Hj`666sFSFZBhFZAFF- Hj7 (Fp@^)FH7 FpFFph7hFiBiBH7$F(бjH =sFSFZBhFZAF,C Hj7 Fp@!FH7(Fp,ѱhH6@d "phF7FhB2iB ڔF2i H7%FDF(бjH23@@[@^@@0" $KKFHK7o\  SM 0F iRhj"F(F[h7T J,-,! *8* 8]hI(FFP)FH76 F8@o M(h( H7)O0 +hYhHjZhH7<[|8 FF!F H7, F0"FF H8@6*F!FH!F8@H6V-A" F(U 1Oi O"0K /K i[h,K,Ish+K+Hj*K6h"F)H)i"F'Hi"F&Hi"F$H$#H)BF:F%H)BF:F0F"FFFH{&FOB F8Fhhm6 3x+++?++O+-+++++++,,-MYI h)G*?"rF(@eQHj6<(F"OK(!!MJNHF (F"FFJH(F"FFGH(FFshh"h:Bmњh@H >IXh5(. (Ff+O?+#F9:FAFT4U(%O5P|a!8 *-AFFW I "XhL@hCF:F1F(FFA`GO0O#0 FFJ 4,H6F F 0 ! H4ISH6,F|aSS*-AFF[hx-*[xa+!<5, '&DB?+f+_H1J.h`0kBF(F,I4N 0 'Z'570BD FLF!FH ;F &P+:F)PE&pџBKW# 38Fh+ K)FhH6O03P|ail;0*FM00 M0hh!+FȱOa FJ6"!FH(kh!x J#A"iF C p#"iF O0y~(*FF")O0pGKhpGP K0#0Or x3iF ]iF  ~(-MFh#FFF 'F^F ;-`h x-)4!6*F!>4/OP"9FV:H3:7K8Hh69 s)b) c)O0t)+S '+OF#)dF+EO PFM!64FI6Ho ;GtP"!H3H۸9]* 8`1 H!;F"FH|al;P pGOrF!4t@ H! "O1G`H5'>vOzsXC5ûpG pG LF0@J@I` ?HQ` >I` =I` Q4t2IY4ZF)FY4 YDO[DZp(F4+FnbhSh`? к Ѹ6O q /#CF# J`6R&0 F F (.d+bF*.F4=!F4VOp0F0!XY_F!0[YB0F50XY(;#tJ`**׀@΀OXh/@+%F!/F!0S'0B00F;07 0S'0 F  F( *kTHpXXx0+(;#  D# [/(F4 #+T(DBp!(F(F?Kh{o93 #oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H3t F }F1FH3ko")Fp.$ e7e8BhF* F#1#f1 +g0&+%+%IH3Ao@!%fg+*"HOzp2b@+# f8###"B-EFFF%<@x#hn"A!d# F#A (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F("#xcx#Ie\B3ZB\\+#xB F#p#(o3+8FOEY(M)` o89=+Ozp2o3 TopG7hn&A!OsG"#AAF(۴#I Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H30o"p1FH3(`xFFʲ!q#pp#&QwBH3o$ED&1+ 3nhC$Os## "DAp#d#0hn#D$!# "DA00hnD$d%%C# "!#DA0-A} ?FFFF$?˳³#p(z#FF(/#x+,O38c9#FBF0F( #?4ZB"F*p }Bcx+#x;4F?#oo"-MFFF(Ozp21F F?@ !?-F;FF1F Fڴ !H3.(F>F0F5Fo `ix)ЙH3<*x *FHO;)FpFa^F1B!9xzx*T0**? )ІH39BۃH1x[E3Дa.~H(FJ%Oz1B&O @s F19Fp# K%1#&1;xDr#C&!2&!) )`HADB^Hs]H#sC%ݒXHl %p D9F D"DsD\HxB"T Jp)HHuBFHwpк?DHp# p F D9F2F)F F560B5l#hn FA!d##!AA "PFH)+H3$of gBp2Q( "1F@FH "1F8F1F "(F! #BF FV! #:F FN)?Ǯ #*F FDIi9\#-Ah`FFFRF0 H3 F1F(FZF(Ѹ(FFd#ih/`#"(FAA H3Bp2.(FA/!(F)F(_ pGFFF,Y(F eCh+h;p$9 i v(H3a#;p3p(F NiFd#0hn#D$##"DAb0d#pA, *%)%hn#D$-DA"#ACpd#0hn#D$##"DA,0pGi wv8 pFnhC&d#"#FA#AF , 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FFb۸@(F"1FojT9F(F(('O Ozz (?"1F(F@< 2BF1F(F(۸@ 7/O O41FH3x#"1F(FTco"oг ""1F, ["1F(F8 F@"/-MF:}, % F&?(L`"1F(F('7x1F / '(F:F(:F1F 2yx!C#q #r" "! yy3+r@szcsx 9y"zC'1+"!(F#<0`@// /+hn"A!d##AA(F#A((Fk(&@, F(O3c&gz 9B򪀤H 0"F3RB8F 2d/d0&`azp a 9B&O 9BT0+@#0KhBT 9 ; g#? J BД 2L{iB1F(F ^({ 2<;iB#ihS``#2z+"srzbszsA`/`@h#1+?X@##dS@4S@s,9i8F#c1+l.+hnA!d## "(F #AA/(S :}i66"1F@FI61F F_! %(IH2o `D`{h `z``a6`O  C F1:iB"ihJ`` F`#a3h ;I"1F(F Е1+"1F(FAF(F"1F(F}+AF(FAF(F["1F(Fg?."1F(F^"1F(F!i2*a1F H2l#0 \oY(Q I@9i "a pGFhhnA!Os#"zAA"!#R(#h9%H1] hazhA!nCA@AA H1L hzhA!nCA@AH1= O0IpF "!(Fo@C h0hnA!Os #%#z*FAA!#H1 hazhA!n NC1CT hzhA!nC1CI(F p`-Mx hFQHh Fn\BO$ kzD4 CD@DD#&BzD4 CD@D0+b !F(hFO CECFFOs !FSF(h F(h 9+LЙ?!F*h9 E&+h9*;&(h"hnA!Os0+zAA!#_(hI hnA!AA+hI0F  E 3ЛF  Dѵ#sa# F%0$0F j hOzuisBp1,=ѣi3H2ao #{+ 3x++ 8 @Bp#++O0 -MOF FGFO а G&?)F Fk{F+@)F F+ L0+M0+ (Tл +h9(FjGoPk{+< "!0F #3p0)F[sp#0F3q0@0k{F)F0Fe+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x2:O0H1lF:FFo(ۙXpLF "! F`##p0)F[cp#0#q@0 #0 F+kG`p@-MFFFF*eq F`F !/Lz `4POcUE(C+ #!Zi"HjC "`?*"p"pp qO Rbp0YF0 H%rGȱ XF" z;ѧ ! 8F  DD@-MFFFF*e FgF !/Lz `4POcUE(C+ #!Zi"HjC "`("p"pp qO Rbp0YF0 H%rGȱ XF" ;ѧ !6 =8F  DD@Oshn#D$"#DA-Mx FeI ư W *F'?H&?4 hzhC#n` CC@CVK3`0s`Y0`O3s0)Fsss|Os  #2F h( FXO0FchA01 hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1FzUSBCUSBSst % N0 H2  pFAh0F2 F5"K`pG(H2LH!h2 h(̿  @B&R-AFFFJ&!1+Cі"1;+>8"AF F7'r%`"1#s#1+cs%P+&?J?K!QbF#"c !B ܐ"(Fczzc{ zk!{ +-1H20J0K0H2 +!*ё*a6Lbrr+!*ё*!r.!% 3 1zѱ%0+#%0#h(FhnA!CAAA!bK$9(F( ?O# I# 0])M,)nK)-MFFOO °~L *? hSrz0 "! F##p0[cp$#0#q1F F3kGF`lH2O70FB0+єL0:+єM0L BaH2k{+х 8FB\H1 /YK@Ԛ0"+# ks{"E t "Zm#O $0U0^0 "!XF 0"[cpO  01FXF3k"pGF(sh GC'?s`"8FpO # "!PF%""p Rbp" 1FPF2kGx;!H2OshO4b#s`Os#;h{h2?!!?#""?A!!/!!?4##'a G@ -MF +, Y!FF(F#(f0h'hn _A!Os#$?3zAA#"ABؿFOȿ;FZF !1#Os0"I, t#cF.#FCrr1F(F(030F  F( F(7GE$ IF( (FjpF BoS @B0-MFF0eF$,!04F0~F0PF F,!V 0 F(#;]F4`!XFkF@F8F@FPF0F [F!F0F( 8F(F$ 4BPFp@Fm,%JKR'S'B'`C'@UE@F[ !F0FX% gBF8F\5-M'F"F[&B AF0FT@Fo)5 I0!F(F0(F0`FB7!F0Z&Q'@,4 F0$(F F0EAD@F F(@Fo  F]-MF#FF B jx+xC#BrSCs#`c``)yxOpn D xpaOD+z @rO D @rDyoyO plDypb:Dz0 0 G aa#bd[Dd&e>Dbe abbb048<@Defe'fgffk|@3fj|RLCCfj| Osf!F G5yp%sF0BAC H#DB x\ *! FpY3FO0|+"I00(ѣ|+|(O0 6-M) [FFFFo0FF(#} #~+F:F!6P|+J|+G%}5"Pp ~0+иݔ0+є0;۲x+ @EB+#p0~0+иݔ0+є(#+܀0+F:F D(іO5x# R *)"DxB"B B1DȲ#o%pom-EF@F8HE1KD||H1zzHC!1#zH@2 bzCR@3@20P 1c{%{E%{EE{EekЙI0WyEI0P(U?eI0E(YEZE)FH1b|!|rH1"}M KIFK+FH(FN.FO/F FAH1|#~I~KHF1ra}}|H1m ~{J  F)F@ F+F *FuHuJuHuJ1UuH1R#0 rH1K#0_pH1D#0mH1=#0kH16#0hH1/#0YfH1(#0cH1!#0aH1$0 ^H1$0_\H1 $0YH1$0WH1$0TH1$0YRH1$0OH1$0MH1%0 JH1JH1%F&HO$'0&?B)>Л ;۲+Aj>J2 JC2z<Կ # #PFR 1&5E2O;4a]DrDDDDDDDACCCDD!D1DD?DCDE$EGDE?\EQEEEEEEF4FLFdF|FFFFFGG2GHG_GYrGt&H<,iC4<+(FHF4H1*5B1H1#+(F5F,H+(F-F)H++yx[xkx$H+x1Kx,lB"< &x O ( paaDpcDBpYCPC4zԿ # #1FBF8F1&  #GAHGGG-AFF(FW O%hBoT H,F-h(< 4`AF0((нB+h,FU Fo-MFFm(}){Ѓj+{h+VOFh  #i FG'FW ?hBѣi+Cbh0HP(+%jB,H1QbiJS  +F-hS GU ]F0(=kh 0H1)o m#h[h 3`iGF(%j+hBU FhYF0(=ooAwZ; -MFFF(CЃF[ @EF F80F0 ` FNo Z PF$h(ѺJ|1F0U(УEF#hТFT Fg`kjjb``j3b o-AF, FFFF#`Ba aG`aab](F0`8 F$ F` #bcbFرFU ?hBѠh F S 8F3F6hoii+"#aD pG:B3F FCa +Ai1 )Aa !AaL!)$]ɲ"*V.g+ɲcG,jрS*.Vɲ+T9,рDϲ/"ОFJ+Q\)@Ѥ:+3ؤF+.?JT*)ٞ+S,9,G,Ф:+F,!(F=,'O!(Fz.+ɲS,рL .DɲA (F_s+ɲ)[!(FRA,1!(FL>,5!(FF~!ɲH, 2!(F:C, K(F#DI,N,??J,? ;+(1цKh*Q`1IH hh`hB` ~}KS!@,)q!F(F/d(F/F(?*FFmJh+mI hBjH3h`BĿ#`hBfJR#@_L F 3[J[H0 ;;+K\E#8F+U/XD@)F8F|(? OcAF!+?2hEK)FS"/3h?J3+#h3`Bȿ`=Jh3`/HF8F7,Fܠ Ʋ ." .&S&N5O5OkO5O5O5O5OO5O]O5O5O]OF.G.U.%@3Bv .h#8F#pI(L,D#H#p`#O0+pPF;CE#,FA)0Q\T?!F(FF+x +}!F(FFsKD#3k3a3#`0 sEۼ C!$"(8?+-;=3#F#o\++ЫhуhhXBXApG pGFuD`A``1F(FF3m F`'aG`0Fh``h#iբh!h`hhD o L@$sQiF@hhDB#iբh`hS #-MF%O@@;`[&0BZ&0S%@ kK FG(K`5-AFF$( OX%0BW%0S$k 1FG4-AFF$( OX%0BW%0S$Ck 1FG4F$ONW%0BV%0S$kG4$0+ $0Y pc$ppGFIFFF/` FI/0 FI/  0- 59F8  !FH0 AR-MFFF$\\Z%0BX%0S$ѽ0YDjcSBSA4 "B9FXFG4I /q[ -AF F$, OB4, *FX$W$I( m cS+@A0lF F m@pGF' Խ@N R0Խ@F) *0ս@ Ⱦ@[KF !BZ` pG"$0+BF D Q0 F@տ *0ս@F F@x0]NF$ _O*FĿ$0SwjB D!O3(sbF$@ ] pd$x1K H@B0( C0#0  R B0 GpG @0 н pG8FM(h FlG#+`8 @0 pG F(j# FGpF F(j F@G(۽pG Kh  0+(( K`Kh`FpGKhpG"K`pGFFhB 8F F)FFH,'F FF(JB$P, F8HH` I` H` Ha HHa IaO3 VyVT=UIVU pG" LH!hH|HyahHtHqhq@Hj1H/1 H/ H@1/ "*GOmu|q-MCI Q` @IAH` @I` >Ia0=JaFFVHE# " FI-%,! F-0F F/CF!x x P%(F!F@H-(lBlH!F@8-(,8F(P! {F$ F8P")F  FhKHldH3dd `  `o,!-MFFmF&GFXBѺ3YF(F-a6.llNS``# FddkVHOB "(F1%H@ PF -pG%5-$ho N,K HddpG,p: F M N,0%P"!F0I-KKKKK~P"!FI-K"K#K&%j F*p#)F0Fbh.iFFfffffNwfyf{f !!KpF FHFH%-0Fp@!*F1F#!cU FF F(Fp*-AF'AF48H.% )F(7BO0 FH `!H8 V H.,v R H."!hGFH.- Zex-E FFF'8F.!-qx@F-zF#'FO FBѺ*F@F!h-H8 h-aB'F  4'FJKIJZCÿ4s~4sm۶Fih H.!hH.`i H( $ dny-M 8+F Fmы3# Э NF#!BR,.OUFF+hU/hhz``-(  zhhE,+`EѸ%!NB#;c >k0F7FJ# 3>Z%(ѻ[F !0F .5"F)FX+5@xC  ;kEPFX+.&&O 7F FF , (O KOs H0(OKhhOs}A-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F-#8@F-,F$5? U,F$ F5BU -PERF@FU-(ѧBJF$ Fo -MhFIh -F 00F-%1FȿH̿F-y(FK xF , ,t5A+FK< , ,- "0C,-OS x$+JGи D#wK!Os(8(Z0U -@F-"F@1DB/DBt$t0DYByO *lD]``WKXIXH#AC*FUH 8-?d  _(и  (NpIXF-7FQZF#2E3BF۠ lи 0U -$,"}PFU7 2UDD !H-FH-N%F\ pX HH.& 0F-'{M+ HHX =DXF)|}<4s~m۶4s\˃8F F-( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*ء7BJ;B4#*4# 4#4zCO0Pt '&%O ._< -MFFFO zL)44+.+BO +404,-l04B o0O34PF4F(@)є+4 +$ 4Bj#DB*4 $C4444+Nє)4+4+ݳB3FFF8F4v[44/D+DD4$4\- (D<+4# ()о$4\- (;48$ DB8$[4;۲B8 R \$A+. F4+#)4>(4+  C 6434F +#)4-p+4?jP;o(4+  C 434pG FL4;+        7#)4G(ڽ@H,0&KS HpGб.pJKFzL#DBahB40FciGch3r Fp4B$(;F$ F!(-E{F+OHEϽh7)E)BKRHHE-&)G1)DHEZ4t)b)C)I)|)+Ѐ)ZEzAz5H-5Hc{3H!{)NKMMMGMI-HEZ-(H-Ah'H'H'Hn&Hk&i~gio %| tC  kClC I$ F)F1.OX: FSFOH-HHHH-Hb  j '   M     ˃6   ( - q pF#N#rKM.DB FkiGkh#rp5(pFF(!zp@!H-<h H#hI+01+++$&+,H7+C+H |+ b+t+H+HH2FahH-+i{ Fp@GHHHHHHp0 $#pP0FFFqPh["F1F(FG(opo\o%8% F `iK`Cid`,I,I , PP(F8R-M FF.! FF,IF F,#,U FF F-Fx{"F9FH-o(F0FF PF-Fx#RF9FHF1F8FeF(#0oYF7(@#{+#hC+ F-M F!F`Fx"FHFH-4Fo @FPF"(F,((FI,(:!(F,F(F,"FFcT4:FYFc ZFrH-FF̱#x FnI, F-zFx*C<*FfH-o 8hz+i+OZF`H-o 8hz+%$2F!F8hF`l-f*fѥBx"1F%F4,-ex"0F},FR8hz,ТGc2F!FF(B!FBH-hi+,ZF>H-o\ [*+BiO ?!!?##?A!!/!!?4""a1F8h.$*,6 "0F"I,@1F H-QwH-M9hFJi? ?##?@ / ?4""a#>ClR-EFFFFбh۱$ hB2F!F8FhG o FQF@F,}(4O4o%O3ҿ-MFFF FY#!(F,F((F,"cTFFBF8F( RFYF0F* FYF H-0F BF)FSF8F[*F9FH-*I7F,hFb,C,, KJ7,Fkha3 I-a0 KJt,FJJJJo}rw-AF FFhF<08FhBbBAh8*F0F0!DAGo% -MFF FFhF<0@FhBbBAh8*F;F0FF!DM`Go% -MFF FFxhF<0@F{hBbBAh8*F;F0FF!DM`Go% FZM( FM@V -AFNF(FE(-$O`!F0F :F !kh-,AFF(F2*x"@K v 4, *-MFFFFF3h<0{0FM((0FGhWDki:F#F`0FCF"FQFGBF ki:FF4F FWFo%-AF FFFd#h<0k;F2F)F FFA`Go%81FU+-ѐ1+)#FrI  34, " I6, 8"IR,( O0O0  Ci#s#@3 ?%?+F"!F(FO0F(F(cn+1+fff-MFFFj0?#?@ ?#? TH-O07F[F"@Fy`_(yh FKH-!U(Ѫ*FEH1;c rF |(x@>(y(;лjB813(1Os`j+@FCC D#`ꉫ1FCCc` .I,++y,ISBSA*x[*Cd:k3FP-)+yu0 A(y8(65eEy-(2bEXF(v%%`0Ic`Osd`,+pPPRCCSD)FFFhĄRF"#F*]-MFCi?3#?@3F F:` PH,7F W$?#F"(*FGH, F(!BH1bx{DF!y)c-=($#y+c4\Eј0*+Ѹ 0PFAA;hDj:h3F- FEѩ)c"BBCC*D{`)|-о*`Fc"BB(C C{`HKTF j1F{hH,N-6)H*+єhĄA FH,+"#F F2J8 @BpFFFFF3F"(F(JIH,$ Fp(FO4&,X*,F@i Fci-MFCiFoFFгvM"+F! F(+x+'2FahoH,O:"mIh+S@/3FbhiHi,O 0[0E +F"YF F(+xk"\I]H+.F/3FbhXIYH+/2FahVH  H0G"K+I0 FKKJ0KkYFDKz(/3FYFbhGHRFYFSF1 2D*+/2Fah>HU++/2Fah9H9I,+1F  F@"! 0 +{Bш+/?hbh,Hb1 2op(D+/?U1Fbh#HN0+"#O4s0 aiћ0 PF0Oc#Os*0Tl…2RV#jF!]𵡰#!F0ahH,! H,% N )F#0F5,#)F F01T# Ip" F M0#\.#2$*;#$0Hp3Di!FF@04D?4$?@4 ?&?#F"!(F(?.JU#!Brty+S@@(2B 8FO0F`"!hF"iF F+8 FC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : " $0"Caw&0Oa+w% p#`'01 005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCbQ# tctCtt-EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@Fb{#{!FC#{(FCC{Cb"F @FSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PART-MF HF(|,zFi@1F0f?6&?@6 ? +? "[F!(F](F_#FQF(FU(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF F*iin"8F8 "9FPF+h#"QFkfh,Q P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+nff>QF0F/ @ F(ii0F/I0HFA!J0KAAAaSF2F(FBPFyQ P0UC#R CCS CcT B"VBBWBbZCQFY X0C#Z CC[ CcBA  IGNOREMEFm Fqi8F/+F"iD0F( ;F"F0Fl~ O0O08oEiF H< )FO0/b)F/^(8 8di8!F/T!F燈s#F"F F( "i# FV:CXBXAp-EDiFF!F[ F/*C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`si`yJF ! ,I,+Q"I F+i00@ @[H@"dP+@FQ yR-MDi!FF[ /%D?4$?@4 O&?1F@F `6(EH,EH,DH,DH,3mhB7F Fi5(Д!0 B""0BB#0Bbz`%0$(K+&0-KK'0Kk)0A!*0AA+0Aj,0C#.CC/Ch F[F)FzhH,S100 5B"203BB40BbC#6HCC7Cc,4!F H,0H,+t؇-ADiF F[ !F/D?4$?@4 $ ?(?:AF0F|`z(F )F8+xhc F7Fo-Mz`FiQ0FP F@ R0F@@S01F@`8/1F@/f?6&?@6 ??*"?F{"!(F;`k(F;hH"!p;`!JU";h&!"ơ!a*i1F:! !(FRF](FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh;#Y0Cb{Z0#{XC#{CC{!FCb[0F # tctCRFQFtt#F(F(Fo7FI0HKA!J0BFAAAa{h(FE F100BFA!20(FAA30Aa1{hEc~!~~A!~RFAAAa#F(F(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbAi/\E W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(F"E+{FF"0A !H0 8DB0 H"n9F   B Ppx75Q2FD]"qoLoIoFE# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww siF;" 0! B" #0$P%P&P'Pi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/0o"() B* +:F0FLPMPNPOP-P.PP0QPRPSPT0UPVPWP%tetttXPYPZP[P8*@ @B-MDiFF[ !FFF/D?@ !?F"F!tiCp!F/D?@ !?F@(Fco  F"F!cCFZF)F0FFxSF:F)F0FF(:F)F0FF8F>(F;#F"F F(O08h'#! P%E%"2iEE#:Ee$A!&AA'AaBB0FG8O0-EDiF!F[ /L%D?4$?@4 G *?  U"#0FF2i G;$?0F+F: 8#JR3@BHh3 +HxFF$N(FV4*@KS4`s%(F4 ,t.O>&(h,<,3B FNChFB ѠiBB F,(j|x$F%F)F0FA P;z;4 8F^5, 'F({+K FoF$ O!F(F P3{+!F8F+w0FB487 FF0)FH+c. F0&7F FH+T F)FFЃ H+Fo F0((F +{+o7DhkhGo%pGFpGo8F F )F F8@׾8Fhh F!F(F8@Ⱦ-AFF F1Fh,<,3Bo FghBChB@(FjF h@9(]C ]F0!F@-EFFFF(#hF<0#Ci:F3F0F FCF2F9FGBF ki:FF Fo%-AFF FF#h<0k;F2F)F FFA`Go%-AF FF#hkhS2F)F FhAGo%osFF@3F*F!Fp@posFF@3F*F!Fp@po F!/#`o7 F((Fb%`0sF 'FPoh,<,3B0Fp F[hBChBFj,<(0 -M ?FFFFF,/RFAF2FX4F% h,<,3B FhFB BhE8Ft`\Fjڣ F?!!?##?A!!/!!?Ea4%%a`argD``-AFJFF!ChT+*EFرF F1F ;FiF0(F F o 8FF(F- F8-A!MfF4FB6h#pE qEwErEDEӤE ahq``!!`)hL`,`, J Sh3S`!iPi Jh3`dUPU-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0Fap FM F(2Fi #aeaHJhL``h2`PUdU-MFFO OXpF&U4O<<<B0Fp FkD<cl F$:)F Ficl F8.! Facl F"! FS FFi+#lkS``c dcl`h FGF((F8o-EFFO U4OT<BPF#hB FF8ahH(jFk4F< hFj;/! F#j[h[kC F2! Fi{hRkj[hkC F0! Fcl#ScdFF(oCl$ F" F(F2F(FiF/h;l oB3B' ZL(FF({i+is;l _KF0(F"kl #kd F( Ooto(FGF(jh IH(hj+(FG(jhIH(oootj?-EFFF'ozT4P>>>+R\Ҳ_p ph((RZ_RZRZRh((RX_RX`RXh(( _RX oF F!]7FChjFF`ch;+   0+`00hBRمh@Ni,%%BG-E ip" FF IlH$h``O2Il?C(`o FpiFlF+ F@׿ 8 FFKD*Ob C[BB_#j Z`8#FFF!F FJp7FF F(b FFh#jpYhl h#( jF)FT 1?0 8F_#a_ #`_#a %Fi_տ_# a8(F%d( %om-MF`F7 @+ ܿ_#a_##`_# a%[Fi_@_ #a_ 0`W,W <W, FWlF ox[sCsC_`_F`f_" 07`-; .FO !#)LC_#`__H# a%Fi_[տ_@#oxai_._#a#T! _O !O " 1)  E3B!CXF%d(w %F(v6. .F(O E#FFF0(B  Z#Fr E _@ 3BD, лOO F_##`__D# a%^i_Yտ_@#oxai_Zտ_# a%Cd( %om(F%7d(? %BiiFB`ii 0+ИG(FiciB*#aD y0+ FG(O08F F"!w 8@lhkhGFpG@lhk[hGFpG8FihF "0%##`Ked#dKPcK!bKb8@ɿ[-Dl F#hmk"@P0h F@Go%Dl F#hmk"@P0h F@Go%F&IFl(`l0(`'o`IlF" I%/h:F0F I%)F k`clCCcd #|qאsFF; ȹh,<,3Bo FhQ(F%F(2F FpjhkhGo%pGFAh) F hk[hGo%pG h;( ox8 FhF,,( $$!F(F8@ox8o%FhF F F"F F"I|lFlcF O,  Fm#FF9F(F@( FSFqFFFF:F1F(F<#0#FYhkh K@ @BCCC" F#cFOzp%" F FO`% F7F))&$ao*@ Fa 0(*1[hP1hF$O01@#"~G$ F!F( FH&8| (KS HpG { #0#d0 F#" H#`p)Fj@ ѳ* ,KdkAL,Bd!!CBB@r#(F"F0%OzrF!(FbC|F&iF(FF8Ro d %0F%BomFpOtOtoOzr FJC!FI&O(FwpS`o9B H&oE,6Ozp%4F4F,H&}om@{|0c#0#" ] -MFFFF@hF`(Fz((*iB*H&D&0F Fao(2FAF FFFEUF(]F-4""!i bo## FF- !! F( H&9F*FBbo /Dѱ"xx#0##Or# ]0KBhPB} }0 ?$?!F(ѕ 0BoI 0Bѕ 0Bѕ 0B"%(@p)F F}!+ #"!0FvF%- ?%?)F0Fp K*F F }p#oFQ-AChJ?C|BF} ?%?)F_F(@0+Opj(Or)F0+JR#Ka`B@0RBR^#C3BOPpvK(&bB0j00`Z*#k0 f 0i.D g [0#00[0#F0 x,#,'J` #K`݀.CR3#1EƳ 0B0D021BS262 !i4##"F F(F#00[CSR4#0Օ0/ѕ0,Օ0g#00g#i0 00h0'8F }. [CSR&#l"D33o o?@@#"F!#"!)у#"-EFF'_ i0"#!(FC F(? N1F(FqF(FV F-M} o*FF&?1BhKDJB ٦H%o{ F }f0ўH@ HOh/58F!F)<F90!FF)4)H%o+i[FO F !FS;0F)F  9YFH%B k 0# C˲D#tH1F(FxF(і 0B0DEQFjH%S{ 0+ՐLC  "OP zFF J_* (њE Ж0RHIF0NH%O4?+?<0#"F(F(d#00gO O"x!(F۲ҲF(W  O't!(F۲Ҳv(8я'FOZFh!#(F۲a   _73/ќ"!(FJh+?ծ0SE#"F(F;FSF"!(F3F(оF?yyyz>zkzzz{BhihB(!FB8FaupG-EhFF-@€xI1vI*#1# Fa#u( F(@O`$r(x FF(~#of#a F*F)F F F}F(h Fy#r0#h FhRK@+ #Os#*F(0+JKc`@77#"0# F(J)#0##hbhhREOCC F+?WOzp$)F(?z 0?wj#xsbiF(?{(F #cs#a#Jahd0B2b`%n) F $wF)! FF#k+ 8F$hzd $5#0omH%qo^FDyPy]yFh[hCSCb F 0`H%Ooz! F(#0@|-MF`h %(Fb$0+_%0P+_#40##" F F(@v"T#40d0*F# F F(@^ch"+B0 Fd0 #40#d0 F(@DahOcddd&e@a9)9468: FeF(Ў#kP+ F(F$F! FF(@#k+ 0F$zd $OCc`#ks#a#d0rIa`HA\HP#0 KC!#gfchA+FV@&i5cg.݀;|CC&"3  #>CC ZC"62D&2#"(#*#,#.#0#2#OsBԿagcgBgmck^ "4 " F %#O 40d0" F 8F(w#O F|i0F(j Fiz F|F(`chgI+C7#P0d0Fb F1F`F(H3#3# `1F# F'?F(/;hcyhCE :+:JHOJKFUc`HjbhDCSbEK!dB)DJjj@AO#xx@KBH@H%?M#`e>I>I>I>I@sCs2 :K/KO Gܠ'?#l0#@# # F t eF(ihjCb"W<7O WEuCP110Oscgg F#CsboF?!F?#?A!!/!!?Ba4""a$aoB+@d(BB]I+ab0\0W %m_ VIڲ"BT E%mNICZR%#`%+ O #0##CK GJ$@##%? F"(+iSE?"!o F!f OuO u +-JR#kBkA! Fb)I BG &H &Kb  #I  FCbHj FDCb #!o"O NKB)FH%V< O< _E"6{{@C{pp{\V<, C B>VE5 H$ o Fp(FF(0FF(FO@K𵑰FFiF)F8F'h)F0F'b Fi@"hFViF FuemGo@^#HAFF!`G#HAFF!`G-EF XF p(FV"FSF8FLG( 0D0DJz-oBo Fh1BXh8# rF Fy 8 JBsH#+r)Ff( Kp z  Kr ~  LvLj wJ[BJw~ vBvzBrxBp01+ + C۲C## pӲ#KQB&qaFO0O7F"# F *F 30p `H#H   (-MF #I?FF(F#B 0+ hPH#omlq F7G(($1 ` ;F:F0!HQ FGoCԸ q8K0"BO OF p"# F :F 30 #H#H  (۝p0*й0ճ hH#_0 hH#T#P!FHQJI# hHJI J I?];Z?WJI_ԛQq|-MFF$H"0F8Ft8S8 0808~hF(.H"vo ,K !b+K,Jc3F0"6*K(Fkcb}F(xhA:FO180^Fj#s bAj0Fb,h&F(0y0KnoH",po ^   y  #%#yu% sFfF FF F(`l`0"Il (aIl( ##3" F I3oH# Ilp@5 po # 9 I 4,500($@U-M4XFFh*h_B_*`,(Rj*2h_ BB"B_ 2`!s@:F*h_t9FXF @F 1# bPFOCFL g aBB>@2B`8Fwa_ pOOp8 a @BB@2REa9FXF̳__O3+`i_C@_ai_CSC_a,,Fh%HYh" @F!PE!H" om(FH!8s3h_ihHYhJizd* CiCS Cc_3`jJKi(FHJIi,FH"#CCC@    Ao0 0,8(iKh_C _ `pGopG8FF Fo)F F8@ٿ8pFF(F\F(F1F F@ F+hG Fp@p S_O@9F Fjj";#CB JC_)jjCCCCSC|_9s0,8[id+гz +Ot D@t_I O@t$oF _ KH2jj!C3C:"C3oCoC_P2@A0,8[id+гz +OT D@T_HB O@T$o _K4F jj";#CB JC_)jjCCCCSC|_9s0,8[id+гz +OT yDT_I OT$oF d_ K<4jj #B3:"C#CoCoC_@4@0,8[id+гz + $ 4D@_ ;hFYh"H" !O  H"#a Q.H"oma0Hoa !0F%8F""O1(FFLP0!$FF"O1(FadeddpF"O1ckF+Xj "00baa"O1 Fs"FO1 Fl HO0"O1(FOzp!LGsF FFhSBjh!h[hkH1!`fbpΈ-A !O1@FFF{F0BF9F(F"FH!pFF F "O1|"O1(FuDC(Fp@ "O1j-A?F FFFh )j;FAG7iA&CN.*FF FAQ"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1o-EFl`( FOl,9F FB+AF FEFC FF#F(F I( F( FFod\lhkBlBBBdKk#opGFpGFl F(# F2I(F!yFx*> !,J!lF(1%&OB V%jFS Mh#FF2F`<8F#hbhh!5JIHjRhRhT*h!Fk[kG!T 8hkkSo%!T (!FGvq|hkkGo%pG"hk[lGo%pGhkhGo%pG8FhFk[h;G)FF F!- 8o%hklF`Go%pG-M} Fp0\Il?+o }x+ 1FBO  P+A+hh[hB/l#\C0Yh'D[iո ;Hj+BF9FG((Fo(F )FF(P ": ]H )  6  (h0)"Yhk+ F9FG(g)FYh[k+9FG(WYhkoP`-AhO $ pB ѧBih`iz`*zp|EnxB4-AhO $(pB ѧBjh `h `$|EnxBѮxB4pFFKBFXPB(Կ  JBXYB#ɲ!p+`0Fp (OԿ&&%A#ɲA#ɲ-EF Fl"hh#F,,O7^i1,RXWhh  F SF!F0Fjn@D@!F(F :8F( 0@@oK@ S+B*0(opGFpG(K S+B0(opG-MFT!FF^Jl  x6o'!Fl VJ0%( F0 FFO h 0!@YhQE+0O`hzT`!DF`zAE7aii/Fk .F))Fc) 8FqF)aF8FF)F2ek''=α-4%%D F8D $jB$jB  l2-4%%D D !aCi\|B!pQn9CQf4 !aC_j\|B!pn9Cf4oNFS-E FFF, O FXk 0VhhsOw5F!cBX\B0d˹9F(F"@#D9F(FF0Fp'#@*-E FFFFh|hPh+9OwFF, O T!cBX\B0d˹9F(FJ"@#D9F(FF0Fd'#@N F-A)#DFhFXiVhh FFi h0D@Ԙ0c9F0F #"@@C9F0Ft"F)F@F~(0Fd( 2@#` -MFF1'F,8F F;F F(=#   U Uj(FF(F[F(F!F0GF9jq V,dBH D$ (FFoo%-AFF*F`iS8F,Fѐ$05j8FFiAF8FGF3j{u 8F(1jKD$^ Fo%o &   pF Fj#)F Fp@Go%pF(j F@Go%pF F0j#)F Fp@Go%p#sF F `\ )Fo tXj0F0*F!FYp!F FF\ Ⱦ8F2F F&20{ $0%0[+h+ F8@!A Fik&(8j Fhii) F(j Fi(o{ F #`7F\ F(iF\ v F0|F$hFsF&DiI" ]iJCii\(JCii\r(K?3OzsXC!Di,̿$$F` `0#Ozu L4+jCB3?+o0pGAiL?"a\0ig!F FlIFOI(l ''GG+F"1F F" Il<`" Il6F(a Il,(aڐ hF  pG hF FFo% F(FF02FyhH F.(i $h)8 FF7*FF F8@ҿF,F F@CF0iiBoo4F0ihBoo8FF F @#`)F F8@JRo8D g@h8 pFF]F(FF h6ch3c`Xp ch;c`((i hhkhGo%pG F3 8*F 5%da0"a(F8ph )F Fk !)F FhG 0p8hFk+i+! F+iG(88Fhk FkhG  p8hki !G pG@lʿ8ElL8(F@lͿ@l׿@l!h8 @BphkF3hF0P"!hF[ah ":# K)F KhF K K K  FG(pMMMMM FcpG8 *PD8(FT ]pGbpGgpG R hkh"GpGp`.R0F4IF0F2IF!Fc ` 0Cs0 :!*F9F0Fy9F*F0F\F(0F8FF,#\!FHc((!c k(!c F(c (Hk*8FFD2 8 z FBKFа_аOаO аaO а?ЩFH  j!FH LP0@?LP0% (`3LP0H 21.TpG FwCi ```h`Zh"shshbsi#apFF(FF(FtAѨi(3op `"Il`"Il`"IljF``!(FعhF_ a"i2Ill a(. ## caO(&vhhDh@XX_pG!F@i`i@!o  F!@i$   hhh#D@_ZP8 F!F@i`i*F! 8o  F) *+J@iV HlpF F@i!! @`i`i!`i"!2F`ip@!8 FyCiFi!Q#lF(F 88F F!`iXB"!`i"!`i|`i!Biw"`iFrk)F F8@8sFF F=FiHO( FRC0`iF FhF; FO1ha(F po ( KZi_տ_ "`KZi_տ_`pGiAKZi_Rտ_!Y`_"a_ `_ `_ `_Y`_`ihFkF{icGF]#F)hjh hH Fo#F JIic1F(FGF(E#F)hjh hHo#FJIq|*8F2F(F`chC`h`#` 88F"FIl ` 8-MF0PFkF0F+hDhñ䱜B(FkhBѫhCEBF!FPFl`;hS0FMGK,FFFihk[hGpG0i%h$jkdhdhh,h4F0`Go^0pGo%hh޿hhFkFiFGFU3F)hjh hH 4 F3F JI(F3ohB$;`+q|sFFFjFh FH1F+`#`p-AFFFFh FDF@F9F"H FAFFR;FhRh hH;FJI{l 8F&F(8F`8FFCh#$+`7`8FVF(нkq|-MFFFFh F0F@F1FHH FAF7F?ѻ=YF F(9KF/;F&C`Cl F(@K`FF2ChF[/9hSE;$`瘱R3FhRh hH03FJI &FFF@FF(.!&0+лBRF9FF(@Fkq|pO2FFl1I0`0J1Ilp`/Il.IDlD+IlD)IlD&IlD$I"lCF+DtI"lCF+DdDDHDT` pDTDD HKT]isȜFlF+ F@q 9)HpG*@_ H pGo_oOO pGph F"0FIxع+z#0Fiz+~+"0Fi~`*jbZB0F)ZA@ p  x Ԋz Ԋ~J x+ƿ pGhFi F$hk$i$dh#FGFFڿ-MhiFh Fk(0F +ihs!F0FGF0FtPF7Fej-a#jj+]ШF% z#x"~DD`3c  0(L#i{`ciFCyh  @ + AA ; 0!PD%-##hRF#0F"F(Ѹ-#ajBF0F+F(ЂFO #0hFi Fhki2h+F0Ghaixz~*DDBo0pGj("iBYjBZbYbj*[j+ ZjpFF@i ip$ Fp!LF(JqhH!@F(JkF@i d( b ^Fi W(`b 8FP#IFl(w I FFH FFhahHo<Il(b F,IFlhwI FFH FFhah Ho< Ilhb 8PfqFF FF#iB B *FshIHho!F pF FhF")F FKX F08)F F3hp@Go%p-EFFFF(FhF"9F(FKF FFRF9F(FhGF 3o%@7 FFF HH!F *F!F0F_h `O2Z`FFFF8FXchBHo#hh_[ #hh_*`Ch@+`_ #h`o} F,ۃh[hB Ho_"h`C(_h`D` 𵋰FF(Fe!F(FFhh_F O3(FI{`QF0F Hr F )FHf,F5bsatbǔFF(F$F(FF(F50`0ih HAo<#`:h :b`D b ``hRh@;#a瞔 s FFA" F~ F% F2F@(Fp@pGFJHۿyJWFJHпFH̿ys[H NF @! K Jh! H I H!F" F K#F"F!F F@V#V8K(FF)KOa`"K`K`pGKJhHx fs[HsH&HfHfHf F F( !FHSCJ @? s[2fH F !F@WH@HSf\fH F !F@CH@4_mfH F !F@/H@ x_{f F F6 (!FH  G!F ;f0 FF(xF"(Ib#F (!F H)0#F(F (!FH!FHffsf-AFF(HAF@!J F@F1FJHhFIO)FW42(1F0G4 ,1FHOW[Wys[+gW Y FJIh h[7 FF(H0@`"K`KF`(!FHR0 KhB!F(F HP+F!FJ H sA AAyAfH F 0!F H@" IhF!hF!F HA F!F @H@ Fm!F @H佽@u F[!F @Hҽ@ؽ^-AFFI$O)FW4SH0K1FG F4 ,)FH1FHO4+WWKhKhpG FF F1NJ0hhAB)F@H|JFh"F8DK3hD[ TO4`OTF . J!0F" #+p -W LF Z!hHVK!hH` #J#`` W FpG-M$F FFFFBPF KOOKh HGsiZF)F0FDDD HGZF)F0FV|^]hhĿ!FH{+HH!F aZuZ-MFFFF01FSHoWQIe(:"OI)F:" '!(FHH(A:F)F4BI@8")F H:IF7IFб"XFF"8`FPFx`ci "`)F C$ F (Hz#BF)F;F!H.!&# ]%1FHIIF(FF F'1FHd1FH51F H1F HZAZZ<ZN[Z[Z[1[-EF FF!x" F0F[I F(WIWH)F@RITH!FSHm)F`KIOH!FNH0FMItH F(VBIIH(F0>IFH!FEH)F08IBH!FAHZ?H!F '40;*h;KB ,)ѫ+&7K6K 5K6H *F#F1FX!F#F0F ()J:DHB@"LEF1F"Hw!F!H{!H+F:F@F -BHd!FHh 2FyCH[FEkIeEɲ FLI%kBɲAj4, DO`o 8FFi##f#cfeC  e8iFFFDji|C/ hkhG pG8hFk[hKGF (F2#r F8o%0hFk FŰñhE0@G[hOrG(KF*FE0o%Onz FAhahSh"h+OR[B@`#`70FjhF0`#h(F BihHRo0#` + F(0@hF x  @"h  !F FhF++) Fo@ "PCKXKh@h@ @ !AC Kh\XXch*h CSCC CC 8 F-%%!!2P1F)Fb Fb8hFkC F0 FB h+ИG(iiD?1!?e8F Fh++i!Fi'iiDB(F8@!ǿ#KiiDBCKFtj F@п𵑰FF(FehFaCj3h@H3Cbbcj!SC(Fa}(F!khJ.J!8F(YF!i(F)9FFxFP3|C#o(F#I, Fo ,,@x ]Cl!H@mBؿ1mBؿ2CnKCCenZCo#epG8FFi f8 " F `8FnFnfl{ ! J##`Ked#cK Fcc8@I,vvhk$hF`Go%pGhkdhF`Go%pGhkhGo%pGF|Fixanbm#o DF#ebe!mBݦ  "!(F&m(Fj96 .o cmbn3ce!agi@8 FFF$egEe8F F;oF+ 0F3oF/8-[-7-An@m!\#o m!nH0!R#g g {gK'D[]P#K-g@-٥A +R#GtGtGtGtGtGtststuf-Zm-ѰiFo7'D4B FD)))ѕ1A(F1b #an`m!#oF m!nH0!A- rF-"&q FC-DD-B-DiF0 ; ;+Wi!i#ce#o#eJiUFz+>an`m!jF0F3%) )j109#Cɲw(9)?^20#Cɲ2 iPP2(F1b(FbC --_+\R#suuuMvMvt-Ig#0Fv3hkh+?0FGnm)F! Un%eBԮ0F^0F3hFkic+m*n)o#B+e !i 0FG&0#cgm;SCjn+ekmH#ke30F+FBmmF0F 0F"+F0Fbm!m(#mnD#eegBDl FMi@!˼8FL F(F<(8Dl Fi@!FFFhFid{n9nC;-;B *FBF F@0)$xp0)%Ѣxax%0xBa CB)ѢxpbxBp%0p*%cxxCSC`pcxCpxp#p0||D$}DDE}Dd `}}A!~AAD~Aa`AB"`0-M Fhp F,#xB+cxM+!FHo F!{hL,h@) С؍H ԋH*#HO0B *!( )*)<*0GwE@p@ po 8GwE@p@ pDE6n8DB8F6zz*@ &{i@@f{@nnj*@    <D3 C# CC! Cc+@ #O hz z C#"{CCb{CcD;%x-kfx..4./;F[jD/s8D0l/|8D0uxDx8Zj4SDkC3iB E ٛE,5F @F/F#F/ %u04D4 a D?SFZ|B E#FxF*њx"fxx3B E,.F @F7Fc / &vD4iD % D?'+[FtDB! M  6DBkjTDD7D &F@F8 F*F!0=)F`h8@yF!0/`h@dsF)FFFJ\ F)FL J3Fh#F(FIF FpXCeh @!GsFF$BpV$!44-MFdF F`F FIFxTF!hbh hH0F@FJIFP,F!hbh hHFJI FP,F!hbh hHF{J{I 3F1F Fh`wIl( (F0 Fj FVlIEh8FF8o8FO2bI}F@FAF +@F"YIXF(WI(@@FUI(@@FRI(@@FPI(}@FNI(OF(@`@F(#hF(@|! FsF $F_3+## FFh Ff' 3 F 0- <9 * 6> " "HBGChAF FG FChh"`:-OOOOq| :dJNtSZh"pBBR`hO 3i #C 3a D ܁D DC C_B 1 C_ DDDA !A _C C_1_p!_t1_O FWIFԱF!hbh hRH1h"pBBBh"pBBR`h"pBBBFGJHI' 3<;ON CC_d9<- D0CD  C_+e8K L_dkCc+BM_&c o?زo>زo""+k#CBCFF.c_+d_#+`( QF#F(@'3SF`! F^ _c""o%F#o_dq|KC` @FLBh$i#Ca@BhDh hC` F 9_O"3I FF F@V<8 FF*F!F8@8FF(F K `c` K `#sKc)FdJ82 8 F( F[ F O0pFFF0Fllh_O!*OO\_\")F Fp@F@ S F@FCjF!@h((hFIThF: F"I F@`T-AF KFhFFGK :F0FEAhGxZtZA BРP8(  pG pG{++pG_hTpG_hC"pG-MkFFO~"P!0F(#QF8M{G b+hGGb F+ha{G3F"Ga FOBP! F+hGGb0! F+hG FG b1F+hGO0F& Gb+h FɲGGb+h! FG @0 FGF@ F+hG0Ga FGU6. !d + ( F"G a; tZxZ-AFFFMOr!+hGC! F+hG!C" F+hGC# F+hGC&! F+hG FOOq;h FGF F+hAOrGd 0FzӽtZxZ{++ pGh\_pGhS!_pG-EF F'O#O@QF F#"O@Q F#@"O@Q F#"O@Q Fch+Ӏh+π#"O@Q F#jNFO@Q F3hD! FG3hD! FG3hD! FG #CF F3hC i! FG F# "Cx&O<`hYKhCEbEЪBs" Fh-ch"3Dh F&ch"3Di F"! F F"!&OD8F0tGp 0*D!8FGODR!8F0GC!8F0GC!8F0GODR!!8F0GC!8F0GC!8F0G# ahJYB3+tZ+PB !#^hC"!8FhGAC"8F0AGC"8F0!GC"8F0GAC"8F0AGC"8F0!GC"8F0ᲘGC"!8F0G@!8F0G#@F8F#"@8F #@F8F@!8F0G@#h"@8F#@F8F#@F8F1ht0l_Jh alC _h ahi_7l_hcDyE@_hH4 D d Y_l#psCS#CCC_h(FQ $pF FBcjDchBѣ{" jdp j(B F@"KIH@ F@#d*ѲyyR"і )B 2x` ""RB! C!!rx *4  02xr FxOZ 3a2x!7J`"l* FiG(۔1o12x*ry*HH(" 1x1x")))" yyB"*P"H  "l@D Kh_+h)_ J+h)9_CC_*h9#d(,L\BP!2yBLy(R "z3x +hxxR+b0;h9_+CCC_:h9#d'ISKh_+h)_O"+h)9_CC_*h9#d-EKh_+h _O +h _@@_+h #@Fd<@FY"5KDp4K`P!2yBLy(R "2x"*xxS#;h9_+CCC_:h9#H0#D0Kh_+h)_O"+h)9_CC_*h9#H0+? F~l+􎭲( fphFi*%BBBA )ST 9 FT oBp%"150 pF&hj@ B @xxR"عEph7FW(/@ @B6j >@ 0(0@B(F$0ն/#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@ @B$j;F2FQF(ݷ;F2FQF(ݯ@0;F2FQF(ݡ0+@ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+3xN.chh3y D3q p#p #0#0  #hhiG00000 0xxB";Os0+@h&h F/F#FST/ RFR B3hi+?@d!0FG; B𭀡 + hhSx+@𳀓xC#lCd1)@3hi1I+?0FG+?!3hi 'd!0FG8+6h*h~p/('+*h+.#Xkj:F1FG1+h.XkXj'1FG+hphbo^h*++00+ 4ȱCkMGF%3CT(@8@FS@oBSi+FH0+BѦ@'9F 0 [(?f3i+Gi \/*DjGO F3hi+?d!0FGpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-AF~ F(Gh+D*FRT? ;FQ oB''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h,b0F~BЦ !j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`o8E\L#hBH##`8\8FMOr!(F!F(F8@"5F  pGpG-AFh,Ā1N(F@s m䲈@s0Fh)H@(F䲈@4tt!@ F8(F1o  Ft"!~K!F#`@###vK(F` F(+hHj|(@' oI 8F3s#ss;h[i+!8FG\\5=diHdo^pGKxpG4"KppG4"KppG4K`F"F FIH FX\QdH-X\Fh"h!iiGh` j8h2hLiуh[jG#cac`#h28 j8h2hLiуh[jG#a#c`h28$F%FOh2+/D c5B;h+$!!H;h4+ #3 ,;`Fw%Kh H H H#;` hooLP8F FK! KpCHoikh++ѫha#k`ijұ8#O"C B@ ikh+Ѻ F(|(J[jh"o ChFO[!AQ+hFR G(A!q FCs[\2[\2BFH8#JCiZj[hB?(d2Cd2$'!1\[A pFoikh8"rCd2a+7"D0;# F$(pd"!;#[*hI`XQ`\s` "+iZ`+i{oAs`hH@KIo+ ###m+)i}h aUSBS1-MdF)xe0f@g ]$DDC8# S"#BATrO[d/Eз? F(O8#SE(Fish+Lј#oa XC7KOX"AQ\0`DF3hFG\2@ p\23iX`OK{@Es`-8# S%J B@ oD$h DDi Dd$K8" Uo0(FY(/3i{aAshhH31imha@KIH=K\$1!h!iGFm 0 m!hiG-M FeF1od2ѐf0O? (K8"ob0"(F8"b " O Ozp,p+?+K# "!#pbp#p##qcq#rcrrr 4`E۸3"+p*pkp9$-M'FFFeh-6ТF@ 0)mhhG08)(nhhG8 EѕV0 mh[hGV0oV0V0 (nh[hGV0oAV0d2oEd2Ʊf`#hmi8Jh8I`-FhGFXeh-єd2eEd2V0.MCV0#h0ni+K`*Fh)FhGF(іV0CV0+yjyC#@2m #e`m!ho hG(a(?i0n!hhGa(?`*h`)i `iUa*iUa*i 5U,Bєd2C I]%]]@]-MKhD2+@ch+:%F@kk+ch)kmh[iGk+chknh[iG 5BmcmkDbk DB F( pchV mh[jGchV nh[jG%D" *3Hbebed'+F(FO8go B,*DO4*ch+:Am"e4ciB F7o FD2D23DRL!DP3`P:*! F#D2@MKNINH;ch!mhiG Fhxd2 F#(?oikh&`@r0F9F 7D~i^`i{Cs`hx@1K2I2Ho F(in+@!K!I"H F(дiPpjhX  [j+2hKB X0CX0#ok`s{+3{XѲ{S+ٗd2`@FT1USBC:fd 0+O LhP2#L2s{gshX2#k`D2i+ؿooؿD2ayh9d2d # /*d2* *a&ITbH2F# F!n_F(@8#EO#0x FB(Ѝ+Q#aaaaaaaa?aaaaaaaa;aaaa# *S"aaMaaaaa U*ˀ=C*D*5*uTOs" ! FF(2?.[Li))t)@d2@ch+?jn}`h~(u**7Z*7l k0 !C#[T2"Osh0"T2!# FF(8"o=ha!ёd2$"Cd2(FH#+p#+q$&L2+T2B(F;i^`#{`\2\2F"(F+D.p0![#kp#pp#+q:Koh3Ori5J6Irh0"T2!# F/F(W8"oSCBI#DO"?(O6i^`i`{Cs`h(?0+inha`2`2iZh*`2+. FT(1#FFT# 3@ F0FD^^^^^^x_^^p FN F3hF\m hF3he`l!Fh[iG3h!Fl"hiGF p@Hepd[FF F@ҿ-A jF Fm-6Kh+3 ?'?"AF8F {KS5B Kh[!hH1H 5-bjahB !hT!F0FG" bbh!F0FiG mHHpаL ?#? @`F !snPUSBSm ?$?" F h{H"!`h m+m ?$?" F h"h`h m8M,hl!@ F$ F8"!(`*P-OQ@ (OR)Fd8FKF`KFbKCbKbKcKC`(FEFH F"K`(F8!9}!^dpmFF ?$?1h" F #|J0Kh[mah"`hE mpd-AmFyF ?$?1h" Fchkfov˹m`8FAFg{+ BF9FH"!hn m|a|2FA!|oAA#}Aa B*nmH"h"h`h F("KF#a@n@ݾ8Fno, ݴ_ - F)FN ,Dd F8 OP-MmFFF ?%?"(F1hzkhcfoӹ\`PFYF\g{+ ZFQFH"!`n m|k|C#|CC*}Cc"fo[i"gf"hhhK8F3ap`-M FF F)hkjno AF/HR`nM"!IB(F2F#o|3D#g0F0FFnPFB"nmH)n"o3DfnBKBF+aOSk`0AF`n0l"jbh)F8FMiG8F)h`0 BS0 Ε=-M]*ĀEo0F^moB "F,Kr`3a@n ]Mҽ_(OU| ?'?H(D;FFFnXFvPE "nmH"!`n ]n*FDfo9F+Dg0hlKu`3a01Flh[iG01Fl"hiGF(Hd [-MmFFF ?%?"(F1h6khcfoӹ\`PFYFg{+ ZFQFHN"!`nG m|k|C#|CC*}Cc"fo[igcg"hhh1F8F9pmF`F" IhF G%? H1h"(FkhJcfcmhFa mp`O8F F7ef8 pG-E\MF+"!Fa!H' WX%? XPF˲B#7 / H1h"(Fkh Jcfcm!a1 \MN˃@H𞻟@#FFFM8FFl(O2 IB#rC#O2IlC#`sC# 8 1FUO,<,Bclj'FW4P<BCl\k0F<Fz_zVE%BMѧ՝zzE%BDf{_{ֈE%B;%{_{E%B2ՖzyB,Ѧz]yB&e{yB y+o'P{KyBՐ{yB ѥ{yB`|xXBXA  0 hkjGo%pGFJ[ xppGhF0 hkh]$`6F F!FGpo%-M0yF:hF8jKt pF(0ZF%Fh7L܀,>,B"єh,<,B5;h+?Kv FHB'H$Kx< Fqh F0FFH75j,>H#50cl F]Cy Fnjh,<,3Bcl FHCy FYjhG }PepF@F(FiFi(F,Y20 i F#`p@ݼOb F a,Yps FFFd_(3F*F Fpok(#` 8FF(F4ThIl ^Il] 8o0CECpFF(F0l! FX=+hjhhH0FpJI4(FT"&@4#sCs@4d`L!mlUCq|8F F#i_+ (Fz _# #auF#i_ (Flz H8@-MFGF(FS#q(F>4LAF(F&Fи G@FF8!ml8F(F6(FTB: ` FQF(FF(𭀁#l_J#S#B@#(F\2:T p_\2+𬀚^2+G'_'@F 0'TG_@F pK 0_]"# # CS_ 0H0_+z+ &##_0]2+ O@r" 0C 0l{(_#>4#4l_տ_Oscb_sb_#1#h#c#`_Oc #aF#i_98Fvz3 PFUPFkF(?N8d`p=;F)hjh hhHp;FfJgIGwZ'W"# C:C } _# #a5F#i_ 8F,z y ul_"7MH7B52@CCB5OH5  C@C55_+ z @Eci_ @4_#.CS_@4(F7'I(F@P!8l (+hjhh!H@4LP0#sCs@4!@4#s@4SSBѲBFci_ H H'UoR TOUCq|?qC}C@BCF FFpFh_8Fgo  o oomh_#i_As1`+p -MF 3TBcFF KS"0FOs@ B(FAF - ES+CCrCCRh*C3_5_#5Rh*@$_/  33 40CCC_5##F_B򚀸E0AF8D+5C35+@4_o  +D >FxGCsCC_5?YB??XJBSD*lFPFo__Cs55 #`C#@CKsCCC 5 T PF?JB??XSBQD=2FQF=5_*8ZJ4_ +nܾB,##5D_m#j+?q5#3iO t:FPF  PFF&.4_ FB8F5DѷB5DBO _# 5_O2XF%9YѷB5D5DB+o <-M FhFF3X2!BFO@uO Or*k`ѮHqTF F @*0+^+Ӏ+@$ ,T"Hܴ<, ;$#BԿi9I#,ЖH>$##@$_QHCHCHCHC!HCs/CsIHAHACC;`$#)Cc 0C# 4B( ,HnH$FBв@вQ.3F#EFBFbI8FFEԿi.3F#EFZIBF+ РF.3F#EFSIBF .3F #EFOIBFNK .O0O 03F #EF8FBFTFF$4 O VEԿi64Hz$1Hu$OzpD$@#3Tr BB")дI@#Bдڴд HM$o-дo*$vi@4C@4**@4#sCs@4LP0#sCs@4@4#sX"BBY_@_<__ )0##ZF)FPF F(/6#F0ZF)FPF9 FDD(cDF#'0ZF)FPF FI&IF p%43X2B#o9p4O tT4d-C{-A FFF3F*F!FA-EFF F F0p+A3Ozs B,9S h Hom J I *F!FSF@F /q|-M FxFF(U3F*F!F($M0h ih*#FO4Jh@$@"@CC_h hP0N%7FDl1F`h8#wP=5- F"%`)F" FOzpl F)F"@ bl_8Dl"%h F F(8@"-MFFFF): x+7FYFF x F O)F"x3**F0FFK]=+a5)DdbBE(BF8FDEGD2FAFH FO4>SFFF F@7F FI F*WF,F0( F!FH@IF#J P@h  "1( F |a7 FF(B(F0 F!F#x bxCxCxC"yCbyC  0 FFPI*F! F0oT8FF)FH, F86b8 FF(*F8@! F8wXx1( Y(РTXBXAO0 HCXBXASF  #H(  FF cH#DdAIHPKHh@˿s B  BB fT|al; #BbBIAH]|apFF"ZGr1F \BH!o)p$#FGr1FHF80 FC0KHhbH)FtonS|al;vSS$GwF"F!F HB K Hh8 :F1F F(` F|al;,H6nS-MDFFFx$+hCx{+*6%E#+F,FP)F0F-KFй"!FPF)K;E(J)K4F`#J$0 F+86h;BDCE4C{8FI78Fh I8D3F$|a)Q VQ)  pGF8JIHRDB AhB0ȍ&O5O1F F0%uo4P#ah0 @B!h8FUhGF0HN4` F*4ѵ?5F6S  4F@hH2h2H-o F#`h0@ BHGF FHH;TXTT.T 'o&9F uFXWJF( ", Fki[GFkh0 C00 kh0 C00,07+oo-M}FFF{ # +IBFhFiF8mF~(C 23FPF ]FF[FQF8`h F(FN0``)Fh0F@0F`H1F FwF`he`o FoHio秏-EFFF(V,!(FF(F (H0uF o (F)F:! FF(#;F FF()FBFPFGF Fu.% PFu >F(RF)Fo# 0 Fzw%0Fʱ# IFX{(FE\Y F0ooM p@ x0,LxX,1N DB F%x1u] D`p3F `pG8 FM I H)F"HL")F FG 8- m |a8FQXM!x(F>@8!xH SR8F9( Max(F%@8axHt SQ8F(FKS C88#0J F,"` 0 F( F`|a7F%#!F QBТB"x0*bxX* -x:(\=8 @B0O0-A%K`xF00hOPP+HXP8`8h@1FH@1F((n`?alQ-MF FFhzٹF\L ;++Me@UK)F*v 9FO3!F x-c-j-1FCH^O3!F xRB#x0+cxX+8K1F\7H"FrO0#x1+Y+ E+0+cxF;۲-J"f;۲+!FO # pBлx.*Y ;* F(кh1FH.  1FH@?v0F% KQF(FF H"F!FPF(?bAR SSRARRRF `pG M KFh$ F0F!hy(74B'L簍@@8 FM I H/)F"Hl")F Fg 8m|at#J Fr,"`  FW( F(Bh|a-A%dhF")F0O+HP8`#8h`@jF1FHq@@jF1Fi(hF(hFi(Ch`apQt-AF$HFFF!F J  jFH(%OAFR( "!F2@1F0# )` O~H(F0y.y pGFȹ FT Kz FpFm"FFC HHHHtZo>oo.o-MMKFFFH&H$ F M G'?8F\FF0FQF@*FIH0FxF @ 0QF \=UDFQF T;FF2F@FPB H$$KFxC |qASt-MMF^F(MF8F(C8FtF @ 0QF c7KFh$j(FGFc- FKmB`0Kh`KhC`xl;F Khk FGF9, KdB`xl;FpKhyCk FG@x-EF`Kh@B!FQ;+HL6(FF((F2F9FH= F +PF67@F#.&7Fl;b%cccKFh$k FGF FxKFhk FGF Fxp KFhF1Fl(FG2F)FHO4 Fpxb*7FhXhF$ F0iFh(HO4-MF+FO4 F@*!hhhHF qH$h " hFBx+Ѹи'FF bH`!FF_HF]H!\N!FhiF!FiF"F'F:F APKhe iXFGF(> 1EA(ڳ a/Br;F p  1FF B 9H( YF6H!{ RF1FiXF#GF+۸hh6иh5*i 3Fr #!Hϱ H 9F   Ozs JHH1FH H I FJ ,-ܧD-x`----N:h˃$+A8F+F* !h`h`- hHQ8 8O0 珙FF F@K -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF 0*F1FF@F#tTFPF!.F#H3ͱH)FOzs J H H%FOO48-N:h˃pF+F"hhh7F Kh.Ahh] FpHO4$x|q*F hXhHh8 O0 *FhXh8h hH O02*F hXhP!ih8 O0 H6&$ MO> H, H) +hC,,!:!8Fjhs4D5k&a7 7˃HpGJhrBЈBʾpGh7%L#!hq( HC !hq 0)F+F*F!hq hViF@ ]¿ F2`h O0 KFh(h0" O0h "!rFhc F@-M&# h!FK[lihi  D @BBOAcC.+sO0BBr;B22*= @ @+5O HFOs ""O3, E3SFBF(#`Z`g 1F1F YF   ZZE;U5F*1"  BB '*8FZ*BFDA*D;D  3 C #F5F1F9SFBF5(?<FE#D 3 SFBF(?%"!BFFO40F Hhh HhP EE0O0hd-E FFFFD(QF HO0X2F F+F'VphFFF+ChBуhB F{)F@ [F `@*F!0F Fk pf`` 牊F@)OhjFpG-MFFFCli@ 9F)F:F!Dj 03 F CliO iYF 7 0(ki>0FFZFQCSDD@#F>(Шi p 0 9FF(AF FjF0FfFQFQFD0Fh FOCHi 0"9F 8 -ML#hFiF 3FSBli2j^Յ #h$O i(6 3@3FO 23 B.O2vF2B XE*! 1Ih"F@F@`FvpBhEF!D@Fz Hk@FqoE ڶh@Fc0D2  V+$@F,OlM ZE\ۺ)!F@ "F"FQFaH'O0O2^K`^K`tm @B+h."F!U(WHP BPFwO1O OJ@ `!F"FQFn+` HH@m@0+h K S+x 1YE ΀%!F@ F"FQFC2HO2,K`,K`m0@B."F!+h (H0BPFO1#J@ `!F+`0#F"FF @m@0NG!F@ gF"FQF HChތ`\hb](XO2K`K`AFF[ @ FB3h/"F!| H 0BPFO1#J@ `!F3`0#F"FF@+hS(0@03hS*H3%!F@ F"FQFlхHO2K`K` 0n0@B."F!+h }H0BPFM>!F@ 3F"FQFO24K`4K`AF[ +h@BAF[!F"F!@[(3hS(0@0+hS"p0BPFsO1#J@ `!F+`0#F"FFk?Q@Tdb%T\hbXPL`bL hH8#J#``O2K`L hH+#J#``O2 K` L hH# J#``O2 K``\hbXTdbPL`b8 M L(h8!h)q##+` h##`8@dh-MF0F FF#`hhB!$#O 40F[FhfXEۻs)FzHJh( +irЭ `h;h0F[F8(3ی!@ F"YFL3hh#`i+k+@O O+G~O F0h" F` k#0pCOyDHhhBH FFhD`e O/9HOO6HM4H-UиOeFl(Fqi i#F*FEp@ؿJDx B\D 3۲;30 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)D B F|pF JFh FX Jh1 LJ$h&DB H5O0p*F-(|x#{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-MF FCh + +LOsBW!F6H 4KB# FYCXF FiB'hB(F (BRF9F X(akh+2 +, +*hDYS[xP\ H o +ч FbGCF燊 FGXGCGF+hS$+h3O0oe-MFFFŠi;?2F?1!?F1F ?(?B F 7F BF!XF{`(FO00FAFDB F2FFFXF@EѪDBCDF!?2"?F2F ?%?*FXF(F"F)F0FF*KFhFFO4 FYi@ ?1!?F(F! (O4(FQ@")F F㊻ #@!F"3`8F3h4 +O!F H^$dB#$4 HS #$3`"!FHI(#'0-E F FF(:`h (`b 604 `30C#b+Уj7J Shb00.h+Pb ,0hE%-0B)F)H_C(HZo8F?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @ b@D #a|\B\c\-M?FFFF0F?#?F3F ? +?  BF 7F)FXFsZF!0F{`({hFO0 FDBF*FFF0FxPEѸ0DCCDF !?#?F3F ?(?@F"F)F@FjBF!0FQ(F8FhhŊrdiiCDh , kCi!Dy H}o8jdB(,FicC)Da8iF "!(F#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IF(F8(O0+\.+oOT)F0Fx0FOq F,!F(l-EFF%@NO., ,!FPFx# Ԥa+@5B(F_$-EFFFO O#FEFxZ-B F8 DEх/*\*FFxF/)F\)F)SFB L#<`DF;#x%F +.+kx[.+ѫx;(FS"8(DB5`K;`x +.+)-MChF+FF[ + +gф@FDDCF#@FYCF FiBOh B(F8 2(?ۨZFAFPD(7a#skh+3 +, +-(hD/00OA@/S/"pC 0+h 3C# @FDDCDF+hC$`+h#`  0(h00C3 0(hZ!R)hZCR۲ 0(hֲ00"C# 0(hZ!R)h 0(h 00C 0-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F%4F;FpFFL!F(F4(F"F1F Fp-MMvAh )!  ÊF D !  AC+ͱ-ch +mKB 3B)F Fch +OS +OsBOso@sSC-$F2F%WO` 2B ahr )&Op@|)`FE0QF F$chF +!+@sB(@VOcSE@QUFF8FOsB(@@Os@E(@86K )M)@ OpE[b2F3FCBAHQF F BF=bh *)*@rB4(ObB@FF )Op@w)8F HOrB(݀OrJB (ԀBF !B A  ` b B s<  c C_ФO:h*ZCi#X@Ev*.@@F @π SC :FYC SCB[DfDXN2h㊘BFBF9F0h2h㊘B9D1B1  CBvbh *Os@q* FBOFFRO1@ 8`(kXHO0c BAMN2h =㊘B0h:F@D`2hG㊘B cXDD@L6K9Fh=3Kh#⊐BfDD3 BI#'KQF FYbhF *Os@q* FB)F Foch + + +opE*FQF FK@uOucv7&1F FX6Ktch +3 ^.:㊧iwp3DZKhB+XH&QF Fbh *Os@q* FB?QF F%FFQF F=5FIK'iFFOzWFBw i F(2[A2ch +Y+Z +opE*FAFYAF FBBEF/i Fr(!G!aD-ch +)+OsOcBWF.F(bh **OrObBJFJ@uOuKx1Ci?3#?@3 N ?x"0`$?H"F! (#O53`(FF"IpxF(" I6o("IRg(|\  iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Ff(#hsC;`hci`"hSh + 1`ӊjKCB##aiD h(`#h[h ++OsOcBKiFa [ ;0ix+;ai 3a-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0F#{!0Fl#;q7F;x6":p,1+Aх,!<1+A }iF& F  6. Ui6 .! 1) & &  ?RAFkF2FF@F(F"F(?@ZFa+#,1<-MF FFz+x.FF5/+\+0FJ8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(< XE8XF<FF0F{P<1SEBFQF0Fq(iz!F F pF Fv F@(F<v ix p<1B1F(Fh(-EF'F!}Q 2CWPB߲OlFEF "! Fq#`F3iBFApp!2+Qp3+" F3q"Dss!ZC*< #F 2 * 2 x"wӹ"!"DwQw3"C3B#5%prE@gs#p(F- 5w#*%prgs 4pp2qZq!F "iJi= (F;5` Fo pFp F=(6Or!0F)1zaىB1dي:1!X@2! z !#`i`#.`poF F@pG0F dFh0(F0 I04 F0L]-MFڰ!F0"Fd F>F( O 8FF(9F9FXH$o $@F FXFZ@ OIF(gF(IK ` F"WF FDH FFHiziѶ??iЪBAb af*Fb3F>(?/Ho FFUD9F F m YF F&xi "!8F&0 +Oѻ{ # "8Frei9F F F(liH FFao ^o [o Xo ^a@x9aQaja0  EE0-EF0"! FQFvHKo $ F@F(FiFQkI8FXjIF(hH(o@ eIF(yF( `K9F` F"jF8F9F[H o F9F 9FVHizN 8 0")FPFl@ KIF@Y(FVo UF!F[żŜ#L@ YC?1!?58FO35F8F@`&8F#-)F.H5%hijhY *(F61D(Fv(#HoGajhBѣj"jaaz* F FF2 FF(+xs&@> FF( F(\A\@x9a])]ja0"-MFذ!  F@F( Q8FFP9FF@9FH'%o.F@ }I F( uFwK`QF"0FeFFQFrH@Fs p0Fm(Fj FX0FF8fH%Fosi+:9F0F!F0FH(@,8i5h "! FHkh +OѣO0 "ca F FpD @ WC?!?Fȹo DI3(CI.(o9F0FF(Ќ:F! "8I(FT "7I  L+riʱ# *#kO{"#QF{  'Hc] sh * 0 * QFC k "#{ (H8o00FF+FFO4&F}a@x9a\ \\Qaja-MFFj ?!?@1 Y9`A DB 7F>H Ehhh2FcCoi# h(FGFy- F FFF!Ehhh2FcC/i# h(FGF\- F -AF FF(T.Roi/Q F% F(#L F`MHg0FH F 0 KP-AFFFFFP(F(9F F8HWBhB hB #$S`F` `L` FAFHpFFF3F*F FFFp-EF FN3hFBh@q 2[O3B(jCR! FEнFR9FB?hЎF^FEE"F 01}Pc-AF#FFF #`+` KB*F =X+hBF9F0F#`HsFFF@*F F3FFNFp-MF FF*4(L> F)h(VF0!F" F ,&FFREN+h3D+`IP*O iF,BFҀE (h 8/FQ 9`  L0-MFFFF*D.# `#FF[/ ZEhѰ+;2HihBѼаB-H! #"F iEh2`! !(<+j(bC``0hz3``.) )+#iE"i* "hhqFj)#$hhBhREiB Fi0H -EFF FFA񱞹- FQFF@JKBFF F- ---L -0-@F(8F(DECF:F1F3F-MF@FFF(60FF(𥀏(F2F9Fټ `\` F hL FL8FFi*F FFhhB#S`` ``` F!k(F8-EF(H&ULԱ"AF FU  K FF-Ix+L F8"SF!F8FF5,6>FRZh8hL0Q ]pGQK FFF@pGF&UU, F56>FRZhF". HhB# FS``!`a`j pQ ]pGQK FFF@pG02KhFm F(~+IF0i*k+p%Il#$IFI)abaPbFhKh4K`F KM`#a=)FjGF3k"Fo#FGF  0F(FF##I(FF!#i++IF0k{(FkGF) F!I #O>Khn]@-MF#F+7+2PFH(,0+',@!F3"FIF@F(tXF0O8F F(]@u RD BR!(Px @F0 GFWW  RD BR _ 0@FGA/ @ F(\@rD (F!FBRe^KBhX# F`5F5FUO"F(FTIh+F(FQI(8,AF(F-F.m pXFGF>KB@@r !F CS0F r( XF` GFg *JAF(Fh,&J;FAF(Fh `!J3FAF(FhOJ3FAF(Fh/%FK2F)FhF\@sD6 (F!FFR/P J` O @ -A FF!g#F(F+FIFBܹWBF9F0F3hGF6LKBF9F0FshGF+#*F(FI) F`-MFF@FFF(z%" ;IFD7L+Eձ+x+>'F3S/O &7FO E$/S$ FR*hB !B*h*F@Fw7  !EP*)*F@Ff7  FZE,F[_E;i 1F#*Fh~F!F F?hL`FFF"F(FFF:F1F(FFH"F#!F(FRn F-AFFFcy## F F'I FT&#i++ !N F^0FKhBѥifj` + FI0F!H #ji`9F "j(#j:FAFh9ifj`##b XL8LOq"F F J KDh LBb Jb 2bbc H F}(F84\c@pbcXp#"IHp !0J 002F I `F pF2F<(Fv!FyFFQa!!F@i`aH "K`aAcKp9 8F 44 *(` 8 B  FZ,h!l!H Kug FKc-AFO FF~h? #sC JIhBXBa Hj hb+pB@+x+1+R#˅Ӆۅ(H(:0(s1+?nR#~(8 l j&8g'8@84(2( ܠ0+?!8~( P8 J F BKc`#Ch"hB hbhBsiHG6h2 \cc 8F F} M+x F$" IK,ph<@ F8LL \cS@epF FG-B,@!M~)xA F "LM FpJ0F+ + + +Y)Vhz &&B@3 )`3SȄ$K,ph<@L \c1@#𵅰%O&K&N'J'I'H(KFWF(6#H*F"I!HfF`F!OpJF(H  FhM`!FJHFH2"#!(hF(HHhc@\cc`@P$0IWIIIIFF SF0"FC 8F%$#h F.>(('( иid(v(C(Ѥii%5i#j[h[hC+5i 58-MFFFjF9F@F0_+SO.OLO`,!!p!ap!"q0Fp!arAr!%r#t-atApr"sbssstt"ubuuuO!bpO O*q `r@r %r#t`t-@ppr!sassstt!uauuu0+##(0d0+ +"0F)*"0F)0RF0Fh"1F)0 f(9FH ApF F) hFX>(d(='(Аid(v(XC(ѩi FF(F-4 F"9I4 Fpi FF(F##p #!cp%#F&pp "0F&"0F)q#%4 lv([XFF lmF(Q/@XF(X&e%F(F F%=FXF[o8F M9FB(F x.+0F @1FB(F .FCEF)/*@F ,AFB8F   XFZ l( F"#XF#g&#XFI#e BaaaA8F(lh$d(n(F F8$8Fl FH8)Fh(-AFFFF"0F0I r(Yh/!0F FQ/K2BOAD1"m CsR BL FPO1@Fl0F AFO21F8F L8F+8F' FF(BBLLL p FFFHA:m;m& hl:Hp+h1F0h#(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpFFH6(FhGF=  FFd#x+cx+&'O O #x+cx+ H O hGxxE%-=(FeF(*F!gBFhGF@F- FFhGoL"# F#F# ` 8F F)F FF F8-pLF F !FO:O J`FaaapJhFBh pGB pGdxBxxC#C@pG8F Fg|H8JhFBhСBѣh+`n dMcHp FF@UHp-,MH, 8FF';H87H-AFFF/9h.L, `L `bEр8` F . iCE0B$tFE+hij d-MFF;C>X@FOEFLO@<SE-=5E 0F"Fh< d-EFFF3+'H\@<SEH"AF 5FXc|"|B"3B2r Hh8Fwg(FdpF%iBp#S```E`pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`-MFJ| |C#|CC|CcB$x + [; + & + FgD~L F! ^F(Հ"!F0ia#` FH'cz%zE%zEEzEe%DE8! 6F(|9F /ha(\Д,0- .C#+ `(NO /aczJ*zJJzJjDE3FS/U`#h5aB`+x[+hO1F@75EF0+++ji FB+jiR+ O1F$ @   O 2Lhhi (FX*L*L ;P+&L FHO`@```by#y C#Esj ubE B* (F8(F(FLRFYF0h J`;`x``PhS````#  dpF F )FFF0F W0(];(а@ p  FFF F1 H;h# HT_BH0Fh(-h -EFFF 0F $HhBظHFZ_UE8FhxhB+iB٧9Fhi9FqH*ihi?!8D$na@FF(kiD -h -AFFF FF HT_B@Fh+iBjiC;R#P-(F"3hFB0`HF)F4` -h-E FFF F H+h#H'FOWE+hEH v0D%iO;4FB%%pn(FBh F h Z-hD-AF',iDEѽ&#S``'`g`#i`iBh FP&6F F F#S``##`c` F@Ѽ F FzH F  FFF&M(F( `KFZhX``#B```aCaaa bCb M)FF( F`4`d HFF0F (L F&Lc|%|E%|EE|Ee%DB!F0F{Fx +; +R#      +8FD0F0F0F0 )F )"# # +H "#"#P-MFttPpEEѽhB-h"QF iXF aj9j:H D ZT9jBӻj DB Ha N9iH IH F6hPc [OfOsO}O˃?)EM#BkB XDPSB `H-MFF!FFF8JR;SHH $@FBѪD("JCFBH "0 :FB@ #)BX+kPF\7\00F,0!k0 FnH R RR DB8F(:jD(000#DrD Fm>Z? F!?w # @,0(`0 PK*F@ BkkPF\\00F,0!k0 F(ЫjD(000=HsW ,W\JBW ! D*FWW  DD8(?DB_h/? cF<+h D  *  bZBbR?bZ*DbX*DbPbXR@bPH @r!A FBRNONcNI NN7 FFI9(iE0H -AhF+F HJx xC#xCCxCc`+h;+`Jy yC#+h;+``)h FI9&hC2p/*h3B*`BEDAF F`(+hDD+`8F4aBBЈBA pG pGO0pGO;hBHpEqF6FV$EBqқhHKBKAB cFd-MD0,F FXFCMJ0!h 3`],F1,O2# ##u1bu`qbKhKB!CBB@'J ShIV`#J`$Kh ,""OCCCS$ J#CS @Ez𓀤Eph)@Ez<Bs'FAF<FFEz-ӢBs#S``#(F+`k`O7aGWC3xh$ DT qqC0! F Ǽ0000O4hDT Ckh0P c O3C SO22(-h(,?O2O<BRB]EQE+ѥhhB'jjjjBBH k e#S``#`C`kF8FKhBM,hB jX" I]0 Fn $hHH<dP7@u RCOC `BR n0-MFDKFBF~.|(O2@(i(tO>;HhFBh9Hh)E-EU$ AE~ #c# FeE hШh(E-EU$ @B~ <FuFeTEuE * F)F(HHod sF"F FpT N"F+F I H  Hp#2FF)F FK(FpL-M@vFHF,## - DTEU-O8H x=J:8@F Bzӷ_"F (*F(CA;K {Bl 6aA K6 FV V22Fy*j j R O1AQ$Ke8FFF  )`@s@1@ FVkF2F9F$ (JKdL@r@c@#@1Hʑd}F"!@ TeTK@E@uEBBE"F I H $ H"#D#!2F@ʑd}LFH$th bE("TC`` #+`B")(<E(џ rF4(ĕKh;`Hd<&``3F F2F hFKFB9h*F(1 9`5F`FF)h8FF(hW.` F-MF x@s"d e$%A Bz9"O f O;K[. ZF(FQF,Bx  "'(F'QFZF BxOOf BR8FAF H7 d$! 0klm EA07@s$!PM< @(@:D BR!F#F#H J(@*@!F#F F0! $F(4'%#&Gpp"Ipp8D##u#cuKuu KO K"FK8FKIK KKKKKKj;ha HظЭ@0pcpP@ NFO64hB j"9Fh F --#FFF9$hP+H !H! `"H"ZOsK`] pG-MFF FF.MM(F'-)F F "GKF`GKF`FK9F`FB-* @DE,;FOE3#B_F:hD*j%@@:i@Dh7Ka=W5H6Kb6Kb39F FUh3(2)Di;1 FG$hBiBR$dH "Hh OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33PpX >(8-K`O0d;M,h,nnF(fF(a3O#2J3I3HF(QF-I.H-KB/"###%J%I#(HF(8F]FF`F@F QFFF;!8Fp H#" IC HF( H ,` FdL &LFO1FFF0@O2!FB+F!J O26p nKFF&_%DB (.(IA`_#&;+Z0Fp))H;(z#j$FFF) KB 8](@83%0#%0@,4z F <4@R pFF>=65OC Fp=F(9B$O4 F<4@ C@7+"C  FhF?([(*(7(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-B%hFB8F Fp)F FF F8FFFF`#(F"F;F1F.F#h#`f(FFFFFC,#"F1F;F(FFL FLpF FF&2F)F FF6 Fp FFFF& L F,8L;F2F)F FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H|F Fp HDTj~M-AMFF$FO20F)hX"8Fih8( #h4,  -AOFFBFFFKB(hFh+FBF9F0F( F#+`$ FDF8M$,h4+hiDBch[  3+*"h2D# FK8@0"! F M!FOB(`"+ha!#FE@ JF@F!J HF F0UbEfiVa`L#h3 H H#z ! Jch h"C(H dOOO#-M`OA F(qFDF'K EJ٫:F 0F"F 1F<)JFB0@(F%F0F "F(ch2#F#`3SD#FFK"#d# #AF# K@`#CKUbEfiVa p"kF;Fe"#e H](#BBLH> F p:QGQ-M2CFF1H&0H/I/KBB"i)F :fiB#iDB  O18FFF+hS "9FPF ##QF28F9FH QF8F@"YFPFFkh+h3D&PUbEfiVa`QOA F(HHOB#!F#H"#F(#*s H F iBBH FO(I :QPP-MFL FF PN0F *)*"FPFr@F&@㱵OXQF8F nF ,5qah)m۸ѩBOOahi@1A-0Ѹ+ Feh>-A$Kh+=:*<Ѹ9( 0 !" ! ф* 2k.##h*FQF8FF F.k (&bN`N^d8FFCr##"Cr## 8HKcKCcKcKdߺX70@=-H#FFF>@8QFKh)K#!p"#HK!#JHFHW FHhQF FFF*F$! F0$":`(h FL-M, L @ FiB;؄iB6ؼ7'#\E2"C h  `24 B73DP@P@@@ @+HH 0#F Frm++i+% %#i FbiFFo F0%LL-MFF F=X0++ 0+@ف/΁$((/ŁR'*F@FSFBF($ F ''\ F@𞁶 B B 0B  ZDB#^FW3E˛E04DD\F@e B_ BX 0BP' ZDBH% ^F<CS5CL;E74DD\F@! B B 0B ' ZDB%J ^F<O[C#5C,;E74DD'\0@؀` Bр0 DBɀ BĀ B/ UD#BD E#[B' '' /"J  C   2E4D35D/ S "@B"@"@b" \0.7гhѶ0 B_D BX BT(PO ZDCEID C  ^F (xUxxpMpp21  EDD( h5SO0 LQLOr$K/S')/S') '1-Mx j(]kFh dFe3+FGx! F8(Hk(KF F%I("HY!J(a JeaJ$!"bPbb". "eeh'cѺ#OccK@<sO@Chd#bc#OxAccOc##dI LQA?  -MFFv! F#F(M1F(F/hF(\XFNI;F(V#F#FF(KAFPF g@F{{h;;l>K#"fg7K"o8IYF8.3+z+0 "!@F1Kcb1Kb1Kb1K#cck{D0#E0#djid"e@"b` ( FbXF! g+i;7;F1F(F((1F"o(FnIFg F(F0"b`Kh2l*h`jhrZ`HpЮ0a  d-AFxFF(SЄh#hBKcy+J"i:Fh 3C0D  BBA2ikL<@&8F FU kM(CF:F1FU UF KBF FU WCF:F1FLLLL -AFxFF(XЂhy+NhBMSy+Li9HhC 3C0B  "BA4;ikL<@&8F \FU M(CF:F1FU +FKBF5 FU CF:F1F<LLLLL  IXi(hy8 ] pF "F!FzF, FI(i-MLh F(  Fh%+- F~iFCh!ah8H!FFP2JahBF0HO0!F(F0(o(F%FU4O<<<B F9!( F0;F F5AFF(i;iahH6:FSF(!F0F 0oJ0Fk<<KK0K7Mh(F(!(FMF(Fh%+o"M!(FV F0M( !(F0F(O4$ ]HpGHpGHpGHpGHpGHpGHpGHpGHpGHpG )p FٱoN4h,K FhFDcBX\B KhS$KhC$P3h33`pX\d` F#lh+ M/h K N3`+h7`C"clCcdKh< @X8eLg}HF FFFY'3x+;lh;+ "!F(F#+p^#lppsxpx+qxkqO FLLL%;H1H'H8Fu+lhl"Kldh<@+l` F8LLLpFFF`#lh+cl3`#cdK h*`$` FpLLLl-MFFF2-t+q.o+lh+m+m0+i7O܀9h R! {J{D$,)"d +"F #"FD %L9h"h0hR! B "L2` F "d0S!;h"hR# 32`ZBXSB;`0;03"Kh< $kl#kd L L L LX\d`L-MFFFF(-D,Bжo?+lhB9ﱻ7к4кB2Ѹ x"YF F"AF0[#s#cs+lh۱+O!F2F8h1F8h K`$klCkd FLLLLhl8F+lh+$"Kldh<@+l` F8LLLL8Fm+lhc$K`+l` F8LLX8Fp+lh;+ $_K` BU+l` Ln F8"Kldh<@+l`LLXLF8#lh*"`F" FFF&< FLLLHpGHpGpLF#hFOb! ho2F)FOb h Kh@pO`r `(Ob!h$ pT-MF(B( aNOM0`0Oa W8`$0h8h4`+h3+hY4,(hwKwLhzvH?0 ?8`! 0(`($O`+hHY+4,! cK`(0hB0hbIF(@4h]IF F F(@0hYIРXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFhx# #h02(!F? =O07 F F`0(=7 F$ F0n(4=(ݰo4?447FFh# #hp0G(!F? =O0(ܠA+ 0pGBXpG3*pGK,d(ܠa+ 8pGBpG3Z*pGK,dpF$B 5`104.pO1`0@pF0FF$ Fp2F)F$?&: F5;,\Go#Wsw3 ap1aAp?acpp0$)F Fk+;o F g??{cCpFXAoӣ\Ao?# ap?acApp0Fh* #1@Bр3`3+?#`o F0M\B0K$5@`@z(@B}(} KS pGHpGHTphF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a=0F#Z`8F1F Fc,a F0D7痙FhF F@¿"hFF"!F F*##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`ϙhFF"!F F"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(RfhFF"!F F##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`ϙř-AF0HFF(4h"!F F=##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF(FII`v(Fvhh3bx3hD3`(F Iqx_ϙhFF2"F F!##p0#pcp'p``#+a#cq#Oq9F(F@9Fq(F;##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`-MO6m #*IlUF%FF"4$! Fs.3#0F9)F[;GoEF/D$" FI%#"0FIeq!a0F})F`u Fx q=FS,,Z,_,pG-MFhFO 1F l0 +;i Ka p1F8F FiI:FHiHGO07FH  0 BHe0B{iH 0 + kh!h2O HC3B * JC;+D/8h& 0h[ABBУigHh ch DB\IcH iaHd!#h@ YCF(Rѣi\HGo #h2[DCkhDD Fd*(d""hJC  F GBF= DIDHiCHGO6 "hD   *F0 0h3BУi2H!h @ YC?1!?Fi+H #"h BC h ch DB?n%KF#3 [BFYF3F F G B5[FIJH_iHG0Fe,,,w..,,-5-W-{----- .DDB#h2[ CHcBs 0F  D{ UF3 AYFci FGkhDD 0hB?iHlIHiHd e.H.d.sF p$%F0FX(-@$ x.*@$5&-0F$^7 FP6 px+4B p4B0#!DB Dx#@ @C0K#DOsB  -AFFFFlF5F2F)F8FG(%`-h$h-&`6h$h.%`-M hFB FFk% T"!PFch`#hcFB0VTl%F.EFEhF"F`[+B.%.F#H'FT<AF8F"FK,65FZ& "AF8FF6F1F8FG(.`u`6h-h.ѽ+`]`-hh+.`*h8FFG+h]`-h+h+,`e`qFM-MhChF:X+C0oo|O4 0A;Y`D (8P,< 04 LPXTC ( ؑx@Tx2@!D D0 )@!txv@^p3@R4FЈBTx2@%D0O4@%4D@@( ؑx@Vx2@1D D0O< %!~x@@B VxaE`F5Dx2 02O6@%@@ >DFE@  aE5҃I!O1T@\ @B2 @B)s%4308< >dEADqD5FDD qEcDY'aE:>F9DADBqD4DDDF oo BDBdyBqF;FF,3F!FFo0F&(o;OG   D՜Yp3<.#F#F>F>.?GKN %9D I LO4%1DI !nnn-M ! %FF%1)%k!B&$4>h$`OqVh`V$ `N 5P1E5@l6%@l%F!51)ѽ2P>'7/3.5%RP%745D-$B&ѶEtF(4FBO8 F 2 **@𻀺o  0 <EO0 5PUE5 | % @4"O2O  FbF5{=F5B=FBP5P%o,uD /popo ED%O`} /DA <@\=,@\5B] 5B1  E+%*"F%D BB3%@D-Ѻo\h ,hlphPFs"&J&Jd@$J$J%~%`%8P-0OE@'O@O _R 8@B"!F' &EFpH 8BF>@h`رiʱ#!aAcOACa`aQaaF`S``bbbcccfedpGopG8F F*<x1*9<+7o8#ajJbbcj Kcb!B0R#jjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo%-FirCjcQk"jGj"cjiG ao-M*FFOE xDOsBD<%DB٥E=D@)*DBOsBDOq(F<VD@;D%DVS>< #D DDYD D!D !D [D!D D!D!DD!DLDDDDDDDDaDDSDCDsDcD D D#DD2B FOq(F FOq FW7ASB.?g:F1F)&D>DBP FOq(F FOq FK < DL @ dD+D D#D LDD #D D LDD #D DLDD #D DLDD #D DLDD \ D#DLDD+D,D9;D%D -MF(Fi,ChCh+>#hk + ##` 00k0#"($&0FJ/ !bpt{o1o hZ ##`/#;?@D5-ٓH3B"FFP"a ,`I#^F]Fa#`##a#jO2ch0! !K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ɀ;?@D5-+&a`O@#j"`#i"i ,`a%#.F#`-@Ԁ#j^`#i"i a%#.F#`-@ɀ#j#`#j2 `#i"i ,`a%#.F#`#icр-@#j&d^a#i%.F##`#iX-@FgE(F!"jzihQii D[DBbDRZFQF~#iZFQFi~a#l  D#d#l+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFiGaDf 0p0jccK"h0*B}Pkk+@^"ij 0(Ghc(@Q##`oK/;?@D5/;?@D5*/;?@D5?"i ,`aAmkmmm"j*?8a5"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiaDe##`#i- "BвKh"j*Sb/?Q+?@D5%.F"j*@#b"#jc"FF{a4 # /?3;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+? ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?xE(FE(F?QFZF  D[D#l #d5/?;?@D5 -D!31"fcfeO6+AK|#f##`m/?d+?@D5-Zf7J=2083$ nB!0Jn+cfd#ce2nR E*@+0ѹK0##`#h+?xcfd #T<{cepl "n  (UЧK/??@D574 1= EC739C9#/h{  E@1" E@ 1 /?q?@D5/?g?@D5n n"e"eX@bn tK[##`/O>cmloJxBF#0+/?1;?@D5 0p0@Fcc 00pkk#+"ؚO3@C3@@cD #0 E /?;?@D5F@m@@;?Y:K#d##`lC##`O>m moJxBF#0/?;?@D5/?+?@D5BO2!l@&D!d@+"ؚO3@C3@@cD #0 E /?z;?@D5F@m@Z KyKnennnnd#D#`l[BO2al@&Dad@jDblB ١KN/?;+?@D5##`+?.clB!l1D0E?j cDsD( B( F`kDB(F!d9˃B#l ##`D F+?"l+:""`h##`h#i+J##`#/?ҫ;?@D5-0D0iDabiYD#ia4#i{3iB WK0##`H3F%.F/?;?@D5-iBGK%.Fj+"ij+c@bbpjBhk IӉ#+cjbP]0 *D  2D i2Dahzv D#i2Fi+Fпa4#h ;ZBZAch;#k.CD,0++o+k E(FD9DRFS  WD2Fhk9DH.c+kjSDB#+cjBSDgnnnJC F̼8xF+x,HO08`Czz 3 H #xF3-DDxF0-H0BHgg-IF&K %KF FF<#o"JdFHFHO4 F 3h ! F+ 1cK ! F)+ HO43`!// /,/FFFhFFe(#"F+F9F0FhIChB Bi*قi*o pG IB BjRoBB4FopGopGopG /(((( $ pG pG pG@i$JhFB$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?Ds`opFFFF"FF1F(Fp@pFF1F F( ۣh F!Dp@#(p-MF FFGh(0(F_ki+OkjAFZF(F2F!F(FOSca6cbf` #(F ((+j ( DDE  B ?/DB Bo'F[FBF9F(FRF9F FK6#`OScaOSf`ai a BF;(h(o ]o JC o f]JC _F +h$ FFHBo #`O3| KS"pGJ#0I@  u`-MFFFFFAF(F#I(FWF(F(Fo.!F(FFB'x/.$D,9FRй1FPF0>FQF(F'@E C0F!F(F^-AFFFDIF(FF(FO7F,8FjF!F(F2x/+D<[BF1F(BF!F(FF^p FFPI*FF# Fp@5pp :pH=O0p p(z`0F#FP0Q"0D"02BF8 ]-MFFF(o(F%'DB +T;{ B%YF@F!oYF@FO3RF@FCB BѻN%O1 O1XF(( 1`FBT;F?5|+ F FF:FT -MF TFF 4f *zC#DBӻQF@FF&!F8F0`F)FFO3-AFFFFO0AF F(۝00 :F1F F F#$$-M(FFFF!F(F!FF(FZF9FF(FF F F"!3D BO4BEZF9F(F!FF I8D$0F2 pG! J Hp |P "p| z(@pȌiq)-MFF;*9$JHRD4BtCF a(FG(Fp E)B ٲDWEI*OT F hh hhhhp(h FFF а@((F@ h(F8 (F#F)F0F@FH7 v-MFFFF%} UE$ W%F@H F } ѳ0FW% X50FW% ($-A&FFF4FDE0FU$18Fq&E$4pFFhFGphD"#UCO2`#hZQhD`p0 FFFF(FF0`G0pGp F h@&1F F.B 46)#!l```(`0 # J`p# l;Fȹ" K`X+phh5B##`%'l;-M FFFFO F4khB"K`#F +h S 0+ :F@FIh0 F+hSD33`4l;-MFFE%QF)8!MC#hFZ[Ys+@'hE@ #V-XAЙB%O ah0F95FKBchB##h S 0YMѻF@FQhn( h+7/5  (D"9F0G# F#h:FXAFh#@# eJ``#h+Dh #h8F#h+Dh+#h+D30F`B=@FQh#(7 h++WhF;PD"9F0G(#h:F AFh#(#hSDh#h8FSDk`#hSDh+?N#hSD3`k(F#hS 0+U+_ѢhchB?8]FO #h@FC `#h 6ЮE]$O  D i E DEB   )iaE8 `` GEќB<ЬE $ D`E 8GE5B iB $D`EEO0$,AhB !t,Q\ 9BMahE(O2RE  *F!F ( #*F"($ F "poBdp FFF 2F)FH4 Fp$r#FF F "chh{ DB DFO (FbEOF F!!QF<2 F !bQF)F +hZ*`x)+!K2! FQF/+`9F F+K**Yx ?) "3+`1F F?)3 "+` " ""XF(+h FZ*`xg)a@S7% RRRRR x!^SBSA 2)FFxx+! Fm F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pڱLC+B &\\D 0D 2ҲBѩBFpF3O2ڿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFzFFB5*F9F0F#lsU F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F00F$ F8)FGF 0\1FXF"@ PF11F@F@" 8F$!"@ "!% "   !(F"  F!XF" PF!@Fo-MFFF"@F FIF"IKFNOFO*zO- 0 F\1F*J44-EU))𵅰FF>oF(D@&=F66.G ѽ0"[ CC[00)F?C F0t0 FFhF*F!FhF0FhC3SCC`pGHrK`pGr H#FFF5砆Q RHF &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '8M9N FEO | ӽMO @ H@1L L  A AA %H"  O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@Fк ! &+RBcC)𞀺O -'< !q+'<)>R>O  '4-'< x <!x_ @K1   #B B@RR40#!0 B FFOEE8/p5EE<0#+pDјECX<k &0&"F+F:1$s<DF+F0&1Rк кz-'<  XF CE83:$s<D"F+FO FCE8p3CE8p3:B@(D FF; )@"FF !:,BE8^]8lCE8p3-AF*K*FFF  F'B<"pB "B0Bp;2B+Bȿ#D#F !!F[(CD? B B"p7Bp<3F%KF*FFF0FF("FB)+ &"F`B*B DB82B۫BԿF!ȿ"= DD"FO `B88B8p2 -M FF(CF(O:(;xkBVE83psE<# <%+VE3pt$F-*A0*Y0: *JFO F+0 (Ox.*hZx_0 )\9F# F+0 L#s9xh)X7:xx*b*r%*X*VE<%#3p;xt+EspDFzx{+* г * #* **O8DDD@D #"0UD"0**џU;FO3#z)k) L)zFZ)O1Dl@l)xxl(L!7c:*P"ERTQQQQTQQQQTURQQRQTQQTBF3F !SE8p3:*ܸ3̿F"ODDVE8U;83p !#FFD* ܸ3ؿ#D&F7SE8p3l)U+QF40FCFFg)FQ+yxU)I)M)RD) и? OD D! i)pm)@a)O hDa#QF0F#B4QFCF0FFF6F(FQFCF0FF(F_vI{x\;FRFD@!O:oM @ @\O (\Pp) 1F1)А!$@p4 CFPD@x$@4){O F  F <9 һ FO.   "*Txl*B*L* "" s*  F"4CFQF0FU"".I o  F+h4F`5VE82pD  D L)5%Fih[+0F FQF]FF? l) Z) h)*ht)z)!*h*h-h*E13h l FhB ` F S+Y]pGF FoANR]pGmF F@AF F mQ ]pG#F M Oku5 F !j#F$01 +.FO0Ft;7 F"F x x@ 0x0+ Cx J\D 3۲x+#0 ` h # `pG h+# `3 Jò\D D 3۲9+Կ0WpGOppG3 F!F&F0xB.`F" "#`FFF"Fo:F FBx*3B *(` x-,н@0@B F"hIx\D 3۲k+m+g+рS#`Sxi+2"`#hxB*3#`3-A FS!F FFfB FC1A8 F"hMx\D 3۲k+ m+g+щAQAQS#`Sxi+2"`#hAQxB*3#`83pFF})KB J \@Fl;]v `!p@8B!`O0p3"տ!-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0Q-EF&O8 jD# uB ci+#kHh#CЩh@F!D #BB!@Dj(??1!?6pF&Bki++kHhpj,DhC#Cch+!s!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@D:ii(??1!?6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? s6+Bۨi!i)DQ&('KhFBHw +H ELF#J`J`J`J`KJ#?`pGAAAA;A-M KFhFF0F@I "42TO &F! apppqqRFIfq 2F RFAF 2FKhMοA}Vep N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`ALedeA`ex~KhP A1JhB  L#h3+#` Hi#"#`K``AAA4e-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQFE B ѣyyC#г6@0Fg#q#qFBFF4:F!FPFBFF&I:FYF FF51F*F)F8FMO;h+"KhEN0h"AF#MFFRF FLG"AF(h!h(h#;`#`3`LeVeAAABAKh8 pGA-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H(b"!9H(\^##p#'cp#5Hpp'q F(Z(Ra#cq#qq:F0F4)H)K'F(FF@FA<#;FFAF`p8FL7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FHK4;-AFFB!x)ѽ)ex1)^С3ڲ*SH$U+R#``O``___O`O`______O``)S!`E`_U`__]`_____e`__O`_`")H5,D"&H"%H- #*F"I#H':F@F~#0/F?- @#*FIH?'d/F"HxKp"HKO*F8FRO5gde`e\e%] 8FF#h FkiG"!( 8 !F@h>( F@IahHo6U UFCl hki㱀lW FyByCyCyCzCBzC#h FkiG&ah@HS(ah@HKUU-AF%F(F#3`3qOIF"lRF(QKI"lJF(I+hki+XFOlEH 0C yC C C C#yy>C  CC"zCbzC"0Fm`ih1H9F2F0H/H"0F(F` "0F#ybyCyCyC"zCbzCO(FG zgz C C C@C2FlHy E#y H#C#ql3Fih?^9^  EUnUUBUUsF0!F F' Fp- 50F p"!F0hF+!F@' #h+pFhuF)F' N0`0!F' 0`%`$h FpBF $t`ClK`(BFbhB #FHIFF0FX%O7' 2x$ F0FB5DiF(FzFh,<,3B FFj1F`hj(B٣lB } z"0s0Cl#`gdlO0!H F H`I1@< FFhoFF0Ho F5FoOkl+h(FkhG (F_#`#$qO  Fp+hkh+"F(FG,$oo-A' 4$H F"H6F(7F(2$Ol[l@F8FZhl.BH,[lH4+H d%}TTT2#` FFFFF1F(jFhBa}#}}C#}8A! H[IhGDe@e8e ssLe~~BKOsB @s@ B  pG pG spKFOsBFd"(F"I@s rBӲ" +sjsp@to~)s!ds$ iss+tjt sVe8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuVeE"Fp"[p#p0ICr Bp[#q#cq@#q#h#r0`qiFrr "u" n! Fr r)2"J?FOb)F8F F*0 ZF1F8SFI"(F 4$K`K`K`K`K`+ FO6M O0oB}x~AAAAA$$) x"+219:*K? "+#ppG;:!H8 %a(())+ #@O_ O KhcH_ Kh#HKh H"IH(CF(H H H: m}He}Le}eVe/~}~HIh (Hf"K @y HB" K` ~H @H}Q}U}4eo}("aK-M`#"xx00\N]KF`7h u\#03`(F@h(o7` F#0IK`- 3+;> T#CL0( ?K`y0"@2CCC5I x* ##3]#@$B& 0M/+(hI>(hF(h"F9F0D+h3D" U M"F9F+hO0o{m shmF_C#DBFF)/*0pmObFFhF^.JhBPR#+L F mp+&M(h# $Kx)$BJ+hh"FD0KhB`+$dBIHOQ(h)+ ##3]#@ $ O4o{ms s/ a: FF$JFhM0`"OpJBb`J`BJxO@p-ea a*FDK-h0*F!F8DKB3B KKhKIh h H Mo"m sBm|mxmmPe]lFFqOrOS##F333#bbb ИBF2F"RjDr`*F9F _.& 3D"F!Ha ]0]lFOSOr##333#bKx "I ."F! H6 ]0 MI*h cb+h #D smm-E]lFOSOr%#KUxUU%b "I uD"F!H ]8 (F Icb0#P`` smm-M]FOSOr'#7KFxwww 'b. ".I D оB3F+F#S3kDs`2FAF{"F!-%+DH} ]ORIbb "_H6&(*F"S3 r`2FAFF-%+D"F! smK]h3KhOrOS##jF333! #H% ]]mm0Kh;+ 7>CJS+K+Jx$#Or33OR!##H#jF]KJx#3Or33O@r3Kh]5]Kh]KhKh]]_pm shmlmmsp Fo9KJhB5JL#h;+0%6oW FFEH|0###`D FFAH|0#|0;HB##|05L##`p4H03Kh!|C/H0.Kx+##`3##"#`)K`Ob(K`p@$X|0#H#M(h"K.h`0F#.`<|FO`I-Jh+D`+#-"K`xmpm~4e~m~ ssm~hmlmуL#h3+#` H@ HO`#hI@tmBiу"-A=K=M`=K>Ih>LOb(F+`!`{;O:h:IC h#Ҳ!h5H h3N0`@F #<F,H#I&J+H*I hS*Kh:;h(hC@B'H!h&L2h&H!hII$H h!"J@H!K"Hh!IO`H!"KH`K`OzrK`"A*mmHehehmLe>\lm`edea A/!уUtmPepmxm"K`4e$MF$H"Bp"I"L*h"K"I` hOb'$hJD)hF# Fh7%!J!ueu[v#vuu%vevTK6`uK u(F` K`@ݺmBAx~LenAAA-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF"`"YFPF[! Fr r%uuuu u*FFD9F2F>1F(FM0m4eLeKKKNh2h:*S]jSSwOrRAI F?H0D F=I=IJhaX3`2"#K@!0F )H/nnnnnnnMb ss .$s nnn$ 2 T nAs snne 4e:*2B2F0E;B&#M(h(`p H)hOzs!XCJH0J#hIH"K`L+h"BJ#D#bHR!c[;+? HW an:N:~nAK4enn  Jh3`JhBIH@Ϲ Hj K IhO Kh+н@On s.Ci$sAn-EL0##0H "!; }H( "!2zKzHzM "!'(`)hzuHqOzs+`sHsN "!0`1h)oH^#3`@W"B9FjHS#'0hKhLh"!F@F0F cICaH#Ҳ^I " F!F\H's'FYH!TKXIQJXHXI hcWKhJ0C@BSH RLhFIQH!hIIOH h!NJ@ UKLp >!hh"DKEH`DH7E'AK!h`AKAH`@Hw@K `>K2h`>K>I(h`S=H>E"$;K F`;K`O@a28Ka`7K"`6K!F6K6HOr4K7E3nss%$s1cswHennLeGn\`edea  A/4e$ e nn6nn sAnnnnnnPes Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-BMvl BGRshCdEiDeFfFgGhHiIjJkK dJhNfKhLcNjP lRePdM!mRhSbR!iTcS"jUdT#kV`U)lW mX!cX,iY(dW5kZ*`Y2l\+m\,n^.c[<p_/k_4_\Ala6a_Cnb7oc8caE_aHqe:mg@bcQ]cTnhAoiBpjB`fVqkDagXmkHomI^i[^hapmQ`jcroS\kfsqTnqX_nipsY[nqru[sv\_ruux^Zswqya\s~rzbs{cYut|du}f[wv}mr}o]ysqYytrus[{wurw]}Y}ywtyYuz[Ww}xy~zZuVvWwxXyZz{UvXxy^YUz{VX}yTzU{l|W}XSyTU{V|}Q~SnTZZUV{WX}YX~^Z[\b|h}]~^d_`fagh~hci~jukdllqmnopqrstuvwxyxzz{|}~GGAA<'<9-:6373930?0.C.,H,*J*(O('R'&U%$X$"Z"!^!a%W~zR:C>1 %\g4 Tr> *k~W%#Q u1Hw6 8f 6 B f1禠f(akfff4ypfBfm6GurR  N fmOL4% %  %%fm%ttH; 8Q*fm> Z*YO #BmGfm U1WW #CQ1f]]i@rk%GJ #Cf YG #0#C f *fNC #C foopJ#kZY\UTooo:#C fmE   #C fm; ( #C fm* EܕE 4UtL#C fmk'#C f(*>~'#C f #' #C c 5(LQ6 g% %ȵGH       Ae|xe=.   < d j 8Ogz ԼygL50M F;]#༂Z8* j_Ew/r@& eb U9ԋO" MD>zAt6 ;G; eX5Mz* WSQ =Wp _\ s`k cH>%g s jEoB[ m3 o  q ;Xs L#u \4<w kBSy\ ]5Py N%9{ ;:  ͺ Ӻ % ᶶǩʤΫج׻ z    ө׫  ͫ  rE8׫ڬ %.^ƯVS 㺞 ڭΥ H K     ס  ` K ڞ     k  ?}}  c  Z1c L  u>*      6   HU*  Y0/   i@9  #  c8"     p  Q%      BDʬ ׷ é ׫׬#  ) שᶻ﬽ ͫͫ ج# RS ӫӺ 㺩ʬΩз ( l   kC} ig *g*xd]e`F\X#x{gSo+ HMBe^ QHW  | RAL# 4p:g*& sn *Z1ʬ(9 = 0Q%Ƭ(7db3 s ö '  S '=F2}'=)2X'=1+&=A0x'=n.'= s,&'>K)j(? s*KQ&)N(aԻ2*~|zxvutqomjhfc a!^!"["$X$%V%'R'(P(*L*,H,.C.0>13936369-9<%<AAI IR1=C.)D![NYd9ir;5<̬t@).'F%6L% uYu Ŧݡ՟!=͜nW ?m9ir;nW ?m9ir;aʓ +ީB#8JzЀQj8AtޑnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b3Dh&Zb@r(>8r(Q8 Qd6@C@Ql r +@ܳ9""9P]`FC=݋#1--'?M(s*K>;ǝΝ՝ܝ (07>ELSZahov} 0feeeeeeeeeeeeeeeeeeeeeeeeeeZoCLUZ0Z0Z0Z0JKJJK<  *w w  wW w < +w  +~E]ەݔÁo!+),, -+oHAEĞɞA         i       ! " %i0 !(", *$.)#-!+%/`yccbbfbb?bdc cb&}c ^%*A$#"%[%2Q   dppeYXOXX9mQ5Y-ݨձ]ծ5Ksi8(HTNf &8DZr~&>Kap| "6tZu+:Kft}Թ5F\lz<Sz+Wjy-[y,Mf2ERc*9I.{ @ @ '@Bm~  . @ Q c t    Ϸ޷  _  ;LLQoLQL=L%L@x}uu@x}e `;`N`[`muav`MaSf%a`aa``*A$#"%[%~uIec  @ @    @E(d;e!m OXE35 } E _#Gs'+?w i //37Cjo.> u |1   ŸΟo  4F XT   t)} ] f`ppp@@@@@@@@@;Zx0N#Wbpbxi8fiZb@7p8&@kQ%-l ",FYoQ% D@ܳdjrx~y#7FURQQQRP     B:&=@A"-x98>BKSZ`flv ?kj   ' 'I.+     bw?  / I e Tl     $<1IR^l. ?. ?:S 1    T% 1  > I Td     Ie P Pe++ou++ae  *(V.8By-AVlZ.5,,M,%-,-e- @Bi1!0F UkH[ppD%X9M     M;=|H$q^^] .- @B @ @`00lyS{5{U,I[ye5$$$0$$ ˚WQ5mא27RhbtC1I&_%|  Ʀ˦Цۦ !%* .3 :@ FN[dmsy<BȧϧէAA[>DINRϠVޠAAťХ1!(.4dRYaimqy_AA ͱ ܥ"3;Q^l  &ˡա%  0:QZs{#̢ "+DOdn|ԣڣ1=V` Ĥ!ܤ"$9C'ci({)AAxA&M4.-L@ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> %"K5e zj4u  &it ,~ 8;~ !1Aa  0@`@@A@!  @a`10  @BootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeys #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      PKKEKdbdbxdbtdbr<NULL>BootCurrentXq 9Rk3Le~Fx@r:l4f. ` ( T  H t<   +,;=[]s愣J(b__of_translate_addressfdt_fixup_memory_banks%s:%u: %s: Assertion `%s' failed.rockchip_dnl_key_presseddo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_deviceswrite_mbr_sectorpll_para_configdev_get_parent_privdevice_removephy_device_createfastboot_mmc_flash_writedwc2_free_requestg_dnl_registerfs_devreadefi_free_poolefi_runtime_relocatewrite_sparse_chunk_rawdev_get_uclass_privadc_channel_datadwc2_ep0_readcomposite_unbindefi_free_pageswrite_sparse_image__fsg_is_setdev_get_privdev_get_uclass_platadc_start_channeldev_get_parent_platfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands #gpio-cells%s %s: Timeout poll on interrupt endpoint regulatorsvdd-polarity-negativevdd-supplyvdd-microvolts%s: Can't update Vdd. Error: %dvss-polarity-negativevss-supplyvss-microvolts%s: Can't update Vss. Error: %dvssvdd%s: can't enable %s-supply!"2BQYaiq 0@PX`hpalloc space exhausted DRAM: arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Waiting for Ethernet connection... done. unable to connect. Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) snps,dwc2dr_modeotgERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image size## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': Scanning global bootmeth '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Automatic boot of image at addr 0x%08lX ... silent_linuxconsole=console=ttynull%s %sbootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] invalid device "%s", %d failed erasing device %s: %d read chip version: Rockusb command %x not support yet read storage id EMMC CACHE: Misaligned operation at range [%08lx, %08lx] drivers/adc/adc-uclass.cError in %s/%s(). Wrong channel selection for device: %s , H%c=%u%s: %s: error: gpio %s%d not reserved bootsecure%*s## Error: Secure boot command not specified ## Error: "%s" returned (code %d) clock-divclock-multclock-frequency#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-rates xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\!cdev->configsilent%-*s %s (err: %d) %.*sFirst, set the regulator device! Regulator: %s - missing platform data! Operation not allowed for fixed regulator! bootcmd=run distro_bootcmdbootdelay=2baudrate=115200preboot=usb startloadaddr=0x800800arch=armcpu=armv7board=firefly-rk3288board_name=firefly-rk3288vendor=fireflysoc=rk3288mtdids=mtdparts=fdt_high=0x0fffffffinitrd_high=0x0ffffffffdtfile=rk3288-firefly.dtbpartitions=uuid_disk=${uuid_gpt_disk};name=loader1,start=32K,size=4000K,uuid=${uuid_gpt_loader1};name=loader2,start=8MB,size=4MB,uuid=${uuid_gpt_loader2};name=trust,size=4M,uuid=${uuid_gpt_atf};name=boot,size=112M,bootable,uuid=${uuid_gpt_boot};name=rootfs,size=-,uuid=69DAD710-2CE4-4E3C-B16C-21A1D49ABED3;scriptaddr=0x00000000pxefile_addr_r=0x00100000fdt_addr_r=0x01f00000kernel_addr_r=0x02000000ramdisk_addr_r=0x04000000stdin=serial,usbkbdstdout=serial,vidconsolestderr=serial,vidconsolemmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc1 mmc0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; done, fiber modeDMA reset timeout Could not initialize PHY %s %s: No link. Speed: %d, %s duplex%s max-speedsnps,reset-active-lowsnps,reset-gpiosnps,reset-delays-usfailed to enable clock %d failed to get clock phandle(%d) phy-supplyError enabling phy supply Failed to allocate MDIO bus failed to disable all clocks CPU not owner of tx frame %s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed child_post_remove()%s: Device '%s' failed to remove, but children are gone U-Boot.armv7bootp_archInvalid pxeuuid: %s bootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHRYSTONE PROGRAM, SOME STRINGDHRYSTONE PROGRAM, 1'ST STRINGDHRYSTONE PROGRAM, 2'ND STRINGDHRYSTONE PROGRAM, 3'RD STRING0123456789ABCDEFuoinerror: overflow occurs , Build: %sPXEbootefi %lx %lxefi/boot/bootarm.efipxefile_addr_rtftpextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sDriver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p Class Index Probed Driver Name ----------------------------------------------------------- uclass %d: %s %-3i %c %s @ %08lx, seq %dset_dir_flagsget_valueset_valueVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found (not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizeVideo%-12s= %s %sactive FB baseFB copyFB size%-12s= %dx%dx%d devicetree = %s Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s ERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Trying to execute a command out of order ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported Cmdline setup failed (err=%d) subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... clk-uclass not found %s: %lu List of available devices: %-8s %08x %c%c Regulator: %s - can't get the Current! %d uA Current exceeds regulator constraint limits Regulator: %s - can't set the Current! data abort Data (writethrough) Cache is %s Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s Can't get the regulator: %s! Regulator device is not set! %s: no regulator platform data! dev: %s @ %s %d iterations in %lu ms: %lu/s, %lu DMIPS Regulator: %s - can't disable! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: ---nreadingError %s the chip: %d Content isn't valid EDID. Regulator: %s - can't enable! ## Resetting to default environment edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined Fastboot UDP not enabled Error: Wrong USB controller index format usb_dnl_fastboot USB cable not detected. Command exit. Error: Incorrect USB controller index udpusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s fast interrupt request Unable to update property %s:%s, err=%s Supported filesystems## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Missing disk guid Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_nameenumerateguidsuccess! Current bus is %d Setting bus to %d Failure changing bus number (%d) Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) CRC32 for %08lx ... %08lx ==> %04x: %02xValid chip addresses: %02XError: Not supported by the driver Invalid bus %d: err=%d -sOFFInstruction Cache is %s ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddr* regulator-name:Regulator info:%s %-*s %s %-*s %s %-*s %s %-*s %s %-*s * constraints:* parent uclass:* parent name:* device name: - min uV: - max uV: - min uA: - max uA: - always on: - boot on:* op modes: - mode id:Invalid data width specifier %-15s LED '%s' not found (err=%d) LED '%s': LED '%s' operation failed (err=%d) | %-*.*s| %-*.*s| %s ParentDriver| %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d | status: %i regulator-nameCan't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? FDXHDX10010halfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %s** Unable to create a directory "%s" ** It is not an eMMC device boot areas protected #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! get mmc type error! MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s no mmc device at slot %x OK, force rescanset dsr %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s No MMC device available Regulator: %s - can't get the operation mode! mode id: %d Regulator: %s - can't set the operation mode! eth%d : %s %pM %s not used Supported partition tables%c %s: 0x%x-bootableUnknown option %s %s%xping failed; host %s is not alive host %s is alive prefetch abort Invalid pxefile address: %s Config file '%s' found Config file not found The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx resetting ... USB init failed: %d usb_dnl_rockusb USB cable not detected, Command exit. %llu bytes written in %lu ms ** Abort software interrupt ## Executing script at %08lx Hex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction mallocReadWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: start sector is not a valid number len is not a valid number unlockpin-controller device not selected %s not found enableddisabledRegulator %s status: * enable: * value uV: * current uA: * mode id:Enabled%-20s %-10s %10s %10s %-10s %s StatusModemA%-20s %-10s %10d %10s %-10s %i-pext2fatInvalid filesystem: %s Error reading config file time: %lu minutes, %lu.%03lu seconds undefined instruction starting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storUMS disk %dUMS: LUN %d, dev %s %d, hwpart %d, sector %#x, count %#x Couldn't init USB controller. fsg_init failed usb_dnl_umsg_dnl_register failed Please connect USB cable. CTRL+C - Operation aborted. Auto exit in: %.2d s. Check USB cable connection CTRL+C - Operation aborted Regulator: %s - can't get the Voltage! -fValue exceeds regulator constraint limits %d..%d uV Regulator: %s - can't set the Voltage! gcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 First, set the PMIC device! PMIC max reg: %d Can't write PMIC register: %d! nwritten:%zd amount:%u Expected command parameterExpected nonzero image sizeStarting download of %d bytes DATA'hUh=OtUR1hPartition %d: invalid GUID %s UNKNOWN(%04x,%04x)dwc2-udc%2u %2u-%2u = %5u %sdrivers/usb/gadget/dwc2_udc_otg.cWARNING at %s:%d/%s()! drivers/usb/gadget/dwc2_udc_otg_xfer_dma.cBUG at %s:%d/%s()! BUG!Root-Hub submit IRQ: NOT implemented unsupported root hub command crq->brequest:0x%x No memory available for UDC! disable-over-currenthnp-srp-disable%s %s: Failed to reset: %d vbus-supply%s %s: Error enabling vbus supply USB DWC2 %s %s: Error disabling vbus supply digital signal, analog signal, , blank to black, separate sync, composite sync, sync on green, serration vnon-RGBno Not a valid EDID EDID version: %d.%d Product ID code: %04x Manufacturer: %s MAGOQIVSCSerial number: %08x Manufactured in week: %d year: %d Video input definition: %svoltage level %d%s%s%s%s%s Monitor is %s Maximum visible display size: %d cm x %d cm active offPower management features: %s%s, %s%s, %s%s standbyEstabilished timings: 720x400 70 Hz (VGA 640x400, IBM) 720x400 88 Hz (XGA2) 640x480 60 Hz (VGA) 640x480 67 Hz (Mac II, Apple) 640x480 72 Hz (VESA) 640x480 75 Hz (VESA) 800x600 56 Hz (VESA) 800x600 60 Hz (VESA) 800x600 72 Hz (VESA) 800x600 75 Hz (VESA) 832x624 75 Hz (Mac II) 1024x768 87 Hz Interlaced (8514A) 1024x768 60 Hz (VESA) 1024x768 70 Hz (VESA) 1024x768 75 Hz (VESA) 1280x1024 75 (VESA) 1152x870 75 (Mac II) Standard timings: %dx%d%c %d Hz Monitor serial number: %s Monitor ID: %s Monitor name: %s Monitor range limits, horizontal sync: %d-%d kHz, vertical refresh: %d-%d Hz, max pixel clock: %d MHz %dx%d%c %d Hz (detailed) None efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlAcpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS[?25%c[%u;%u;%um[%d;%dH%04XCan't remove invalid handle %p Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed NetMemEFI protocol GUID missing for driver '%s' Failed to add EFI driver %s Failed to install ECPT EFI application exitedbad file path! %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p ERROR: Failure adding GOP protocol en-USEFI: cannot initialize platform language settings ERROR: Secure state transition failed ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Can't find initrd specified in Boot#### Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Reserved memory mapping failed addr %llx size %llx Booting %pD Loading image failed No EFI system partition %x:%xCannot read EFI system partition invalid image type: %u 78ERROR: Failure to install protocols for loaded image Cannot create SMBIOS table kaslr-seedError deleting kaslr-seed Cannot free EFI memory pool Failed to load EFI variables Invalid EFI variables file Failed to set EFI variable %ls ubootefi.varFailed to persist EFI variables ERROR: Failed to register watchdog event EFI: Watchdog timeout RE is too long (code overflow).callbacks${...}.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... !read failedWriting to %sMMC(%d)... %s=%s ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment ep0-control Success%s%daddr%saddr%pM%s.%dethactethrotateethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdevDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** ${Error: %d (%s) f_fastbootfastboot_bootcmdBooting kernel at %s... status: %d ep '%s' trans: %d downloading of %d bytes finished Received invalid data lengthFAILmissing varfastboot.%sVariable not implementedcommand %s not recognized. unrecognized commandErasing blocks %lu to %lu due to alignment failed erasing from device %d failed erasing from device........ erased %lu bytes from '%s' %s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success mbr%s: updating MBR %s: invalid MBR - refusing to write to flash invalid MBR partition%s: writing MBR partition failed writing MBR partition failedFlashing sparse image at offset %lu too large for partition: '%s' too large for partitionFlashing Raw Image failed writing to device %d failed writing to device........ wrote %lu bytes to '%s' invalid mmc device invalid mmc devicepartition not givenfastboot_partition_alias_fastboot_raw_partition_Invalid number of arguments. mmcpartinvalid partition or deviceno such deviceno such partitionunknown partition table typeunanticipated errorAndroid FastbootOKAYfailed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in Setting reboot to fastboot flag ... Error %d on queue Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) %s: already exists . .. ** Unable to read file %s ** UError: allocating memory Error: cannot remove root %s: doesn't exist Error: directory is not empty: %d %02X%02X-%02X%02Xerasing#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster FAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer ///./../binmanmultiple-imagesMMC Device %d not found Jump offset is too bigError: writing directory entry outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part ** Unable to create link %s -> %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to write file %s ** invalid number of LUNs: %u Linux %-8s%-16s%04xFile-Store GadgetMass Storage FunctionUnknown x%02xMass Storage/clock-controller@ff760000rockchip,rk3288w-crucompatiblefailed to set rk3288w-cru compatible (ret=%d) usb_dnloaddwc2-udc%s: failed!, error: %d Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sBase path too long (%s%s) Retrieving file: %s unknown reset0x%08x_ayesinvalid partition name0x%016zxfailed to set partitionplatformplatform not setBoard not setValue not set0.4N/AU-Boot 2023.01+dfsg-2clock_in_outtx_delayrx_delaytx-delayrx-delayBank %s: %s%d: %s: %d [%c]%s%s%s.%s%dError insufficient memory gpt_partition_listMore partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### CRC32 for %08lx ... %08lx ==> %08lx 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! u-boot,i2c-offset-lengeneric_%xi2c_generic_chip_drvNo I2C bus selected u-boot,i2c-transaction-bytes+,<=>:;"/\|?*[]XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! %sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command unknown compression methodunknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateNo MMC card foundNo block deviceMMC partition switch failedMMC partition switch failed binman_init failed:%d load-environmentMMC: Net: %s=%s%d.%d.%d.%d.dtb./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s gpio_leddefault-statelist passed to list_sort() too long for efficiency No match for driver '%s' Device tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s Uart## Total Size = 0x%08x = %d Bytes probe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'No CLI availableRockchipunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc_blkmmc_bootdevMMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd mmc write failed u-boot,mmc-env-partitionu-boot,mmc-env-offsetvmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d Unknown modeStatus Error: 0x%08x Timeout waiting card ready Error enabling VMMC supply : %d MMC: no card present writing%08lx: %02lx %04lx ? %08x %0lx %04xmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx #(-27:"/\|?*reg-offsetreg-shiftreg-io-widthpartitions not setgpt write mmc %x $partitions/configu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-type## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,silent:silent,stdin:console,stdout:console,stderr:console,serial#:serialno,stdoutstderreth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,flushExpected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKVirtIOUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type Part Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%du-boot,efi-partition-entries-offsetCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out gpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: could not find pctldev SoC: Rockchip %s Reset cause: %s reset_reasonfdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%seMMC%s: %d (%s)YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%sUSB download gadgetpower-supplyenable-gpios#pwm-cellspwmsdefault-brightness-levelbrightness-levelsclk_mac_speedpxeuuidError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 pre-reloc realloc() is not supportedCannot set reboot flagCannot set fastboot flagCannot set recovery flag^%s$Error compiling regex: %s little-endianbig-endiannative-endianenable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvolt%s@%s: set %d uV; set %d uA; enabling (ret: %d)#reset-cellsresetsreset-namesrockchip_sysresetclock-output-namesext_gmac%s: the frequency can not be 0 Hz %s: Cannot find out a supported VCO for Frequency (%luHz). %s: Failed to match output frequency %lu, difference is %u Hz, exceed 4MHZ rockchip,rk3288-tinkerddc-i2c-busahb%s %s: failed to get ahb reset (ret=%d) %s %s: failed to assert ahb reset (ret=%d) %s %s: failed to deassert ahb reset (ret=%d) remote-endpointedpmipicdn-dplvdsdclk%s %s: failed to get dclk reset (ret=%d) Rockchip Rockusbrockkusb set reboot flag: %d %s: adc_channel_single_shot fail! download key pressed, entering download mode...non-removablefifo-depthfifo-modeclock-freq-min-maxrockchip,grfrockchip,pmurockchip,pinsrockchip_resetRequested channel is not active!Dev: %s - can't get address!vref-supplycan't get vref-supply: %d can't get vref-supply value: %d Requested channel is invalid!f_rockusbHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command unknown command: %s FAILunknown commandbuffer overflow FAILbuffer overflowBad status: %d failed writing to device %s: %d stdout-pathNo serial driver foundError get-and-setting cluster Error: no space left: %llu uuid_disk=name=,start=MiB,size=MiB,uuid=;uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: readonly variable%.*s.%.3s~%dWorking FDT set to %lx fdtaddrsetenv preboot; fastboot usb 0prebootsetenv preboot; ums mmc 0modelModel: %s Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x %-10.10s %3d [ %c ] %-20.20s | `-- |-- (effective Ops get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s (T)reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x | / - \Unknown01/01/2023skufamilyUnknown Productasset-tagmanufacturerError: SMSC95xx: No MAC address set - set usbethaddr %s %s: Invalid cs %d (err=%d) spi_flash@%d:%djedec_spi_norSF: Failed to set up slave Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) !R\248>Ž ; - set max blocks per entry and max cache entries showconfigurebootefiBoots an EFI payload from memorybootzboot Linux zImage image from memorydcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheclsclear screenconinfoprint console devices and informationdmDriver model low level accesscompatdevresdriversstaticecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structprotectenable or disable FLASH write protectionon start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writableeraseerase FLASH memorystart end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banksflinfoprint FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # NfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start.query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsI2C sub-systemcrc32edidloopmmmwnmprobeolenitestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=manage LEDs on|off|toggle Change LED state led Get LED state led list show a list of LEDstoggleload binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wphwpartitionsetdsrNET sub-systemlist - list available devices pingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoldisk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part types - list supported partition table typespinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] commands to get and boot from pxe filesget - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] - boot from the pxe file at pxefile_addr_r default-arm-rk3288-firefly-rk3288default-arm-rk3288default-armuse the rockusb protocol e.g. rockusb 0 mmc 0 sfSPI flash sub-systemsspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sentsysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'lcdputsprint string on video framebuffer setcursset cursor position within screen in characterrun as a fastboot usb or udp deviceUse the UMS [USB Mass Storage] [] e.g. ums 0 mmc 0 devtype defaults to mmcimxtractextract a part of a multi-imagegptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable read - read GPT into a data structure for manipulation gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read address - read byte of register at address pmic write address - write byte to register at address regulatoruclass operationslist - list UCLASS regulator devices regulator dev [regulator-name] - show/[set] operating regulator device regulator info - print constraints info regulator status [-a] - print operating status [for all] regulator value [val] [-f] - print/[set] voltage value [uV] (force) regulator current [val] - print/[set] current value [uA] regulator mode [id] - print/[set] operating mode id regulator enable - enable the regulator output regulator disable - disable the regulator output runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageusb_kbdusb-keyboardBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsisatanvmeefiloadervirtiopvblockfixed_rate_raw_clockfixed_clockfixed_factor_clockfixed-factor-clockrockchip_rk3288_crurockchip,rk3288-cru/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiiinputoutputunusedunknownrockchip_gpio_bankrockchip,gpio-banki2c-chipi2c_genericrockchip_rk3066_i2crockchip,rk3066-i2crockchip,rk3188-i2crockchip,rk3228-i2crockchip,rk3288-i2crockchip,rk3328-i2crockchip,rk3399-i2cgpio_led_wrapgpio-ledsMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)u-boot,bootdev-mmcrockchip_rk3288_dw_mshcrockchip,rk2928-dw-mshcrockchip,rk3288-dw-mshcspi_flashjedec,spi-noreth_designwareallwinner,sun7i-a20-gmacamlogic,meson6-dwmacst,stm32-dwmacsnps,arc-dwmac-3.70agmac_rockchiprockchip,px30-gmacrockchip,rk3228-gmacrockchip,rk3288-gmacrockchip,rk3308-macrockchip,rk3328-gmacrockchip,rk3368-gmacrockchip,rk3399-gmacrockchip,rv1108-gmacGeneric PHYbias-disablebias-bus-holdbias-pull-upbias-pull-downbias-pull-pin-defaultdrive-strengthinput-schmitt-disableinput-schmitt-enablerockchip_rk3288_pinctrlrockchip,rk3288-pinctrlgpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8act8846 pmicactive-semi,act8846REGact8846_regregulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedrockchip_rk3288_dmcrockchip,rk3288-dmcns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartspi_genericrockchip_saradcrockchip,saradcrockchip,rk3066-tsadcrockchip,rk3399-saradcversion-bootloaderdownloadsizemax-download-sizeserialnoversion-basebandproductcurrent-slothas-slotpartition-typepartition-sizeis-userspacegetvardownloadcontinuereboot-bootloaderreboot-fastbootreboot-recoveryset_activeoem formatpwm_backlightpwm-backlightvidconsole0videosimple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51rockchip_rk3288_voprockchip,rk3288-vopvcc18_lcdVCC18_LCDvdd10_lcd_pwren_hvdd10_lcdVDD10_LCDvcc33_lcdrk3288_hdmi_rockchiprockchip,rk3288-dw-hdmivcc50_hdmirk_pwmrockchip,rk2928-pwmrockchip,rk3288-pwmrockchip,rk3328-pwmutmiutmi_wideulpihsiclow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusperipheralasix_ethsmsc95xx_ethep1in-bulkep2out-bulkep3in-intusb_dev_genericu-boot,bootdev-usbdwc2_usbbrcm,bcm2835-usbbrcm,bcm2708-usbext4unsupportedEFI block driver1.5dhry[iterations] - run dhrystone benchmark - run the Dhrystone 2.1 benchmark, a rough measure of CPU speed Operation not permittedNo such file or directoryNo such processInterrupted system callNo such device or addressArgument list too longExec format errorBad file numberNo child processesTry againOut of memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeMath argument out of domain of funcMath result not representableResource deadlock would occurFile name too longNo record locks availableFunction not implementedDirectory not emptyToo many symbolic links encounteredNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorNot a data messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyIllegal byte sequenceInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on transport endpointProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection because of resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConnection timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale NFS file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorQuota exceededNo medium foundWrong medium typebaseboardchassisFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcintel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlansyntax error System reset not supported on this platform FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again Invalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed failed reading from device %s: %d HUSH_VERSION0.01( w usb,device-classusb,interface-classcompositeHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Rx: failed to receive: %d Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?USB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusbkbdnulldev%s: warning, ret=%dlun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+- %s (%s, %dmA) %s %s %s %s 2H53F6CDBA Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx Linux U-Boot 2023.01+dfsg-2 (Jan 18 2023 - 01:57:16 +0000)Error: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel ~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. [addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead A9pgAAH9p}gAAO9pgAAW9pgAA9pgAA,9pgAAcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree Dump tree of driver model devices ('*' = activated) dm uclass Dump list of instances for each uclass /addr [-c] [-q] [] - Set the [control] fdt location to fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.bus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c edid chip - print EDID configuration information i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed9p~AA9pAAR9p}AA%9p|AA*9pAAo9p݁AA/9pEAA29p1AA59pKAA89pE}AA9pQAAcIpAAQ9p]AA>9p~AA9p!}AAx9p|AA@ZIpIAA9pAAIpYAAcIpAAIpAA59pAA9pAARIpAA*g9pAAIpAAAIpuAA*gIpAAR9p)AA*g9pmAA9pAAc9pAAf9pAA>[-l addr] [-s size] usb | udp addr - address of buffer used during data transfers (0x800800) size - size of buffer used during data transfers (0x8000000)addr part [dest] - extract from legacy image at and copy to R9pAA*g9p AA9p1AA9pAAc9pAAR9pYAA*g9pAAZ9pAA9pAAA9p1AA=C9pAA=9p-AA9pAAMC9pAAdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] >IpuAAIpAAIp1AAIp AAIpAA9pAAA9puiAAIp}AAnIpAAwIpAA]8 `        e1  ?   K C  # G IhOS y ; O a   ]hXX   (Q(QnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@l 9pګ9py]AIpa_)f9p!XWAQ9p!XWAIp-dl5 Ipqh25\Yp4[o9p}Wy09p9VIpiٮڬ9pIe}6K9pM!ΞA9pfA`9pds9pfA9pm9pE 9pf (9pIV9p gYp#09g-9p)h^sIp1 l 9pLIp]x9pEkAIpkر}9pkIpckݯ9pqkIpUk09p9pJ#9pk+NIpkD9pk9p5l9p'l yIpk0`IpliIpm:@9pMxGf9pxռ9pxݼAŨ9p1WȨD Ip5yh9pʪ9p-YϪ9py|5Bs9p-fzF9pXM|9paJCIpIn9p}q9p9px½IpoxIp%i0Ip6Z.Ip%ic.Ip%9i*9p5T x݀) <^9_ \d_K{m{ :', >9j l\nU^ut ^ v4 E:DuE E#>T58pdMzmXZoOQ5kQShQu pEopp-oܧ>p]o ymYwpuoU y0Q n8?= @ɊiUU 5\(CLxVYBE m'm _%UIW&^'fi]gfD .72my4Q: q;MCGsKPYMlS19T9U[BWZp\IFE8^cNMd ֣hmuT YQT jilIntmI@ $huwvmG)ID@ $#>MzqrYx op4,ld0tptx|(PTLTX  $(,048hlptx|$(,<@TX\`dhlptx| 4\ ,0X\`d0!!!!!""""L#P#T#X#\#`#0$4$8$<$$'''''''''''''''''''(()))))))(+,+0+4+8+<+@+D+H++++,,,,-0-x--4.8.<.$//0L0x0000333 3$3(3,3034383<3@3D3H3L3P3T3X3\3$5(5,5054585<5@5D5H5L5P5T5X5\555666777 77777 7$7(7,7074787<7@7D7H7888888888888888888888888@9999,;0;4;8;<;;;<<<<<<=======>>>>>>>>>>>>>H?L?l??@@AAA AAAAAAAAA,B0BCCCCC\D`DDEEEEGGGG GdGhGlGIIKKLMMMMMM0NpNN>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?>h@l@ CDDEE EEEEFF F$F(F,F0F4F8Fhi2cMdefault*okayi2c@ff150000rockchip,rk3288-i2c, 0?hi2cOdefault+ disabledi2c@ff160000rockchip,rk3288-i2c, 0@hi2cPdefault,okayi2c@ff170000rockchip,rk3288-i2c, 0Ahi2cQdefault-okaygserial@ff180000&rockchip,rk3288-uartsnps,dw-apb-uart, 07MUhbaudclkapb_pclkuztxrxdefault ./0okayn6serial@ff190000&rockchip,rk3288-uartsnps,dw-apb-uart, 08NVhbaudclkapb_pclkuztxrxdefault1okayn6serial@ff690000&rockchip,rk3288-uartsnps,dw-apb-uart,i 09OWhbaudclkapb_pclkdefault2okayn6serial@ff1b0000&rockchip,rk3288-uartsnps,dw-apb-uart, 0:PXhbaudclkapb_pclkuztxrxdefault3okayn6serial@ff1c0000&rockchip,rk3288-uartsnps,dw-apb-uart, 0;QYhbaudclkapb_pclku  ztxrxdefault4 disableddma-controller@ff250000arm,pl330arm,primecell,%@0 hapb_pclkthermal-zonesreserve-thermal5cpu-thermald5tripscpu_alert0 p'passive6cpu_alert1 $'passive7cpu_crit _ 'criticalcooling-mapsmap0#60(map1#70(gpu-thermald5tripsgpu_alert0 p'passive8gpu_crit _ 'criticalcooling-mapsmap0#8 (9tsadc@ff280000rockchip,rk3288-tsadc,( 0%HZhtsadcapb_pclki tsadc-apbotp_out:7MH disabled5ethernet@ff290000rockchip,rk3288-gmac,) 0Zmacirqj;8fgc]Mhstmmacethmac_clk_rxmac_clk_txclk_mac_refclk_mac_refoutaclk_macpclk_maciB stmmacethw<inputdefault=>?@Argmii 'B@ B0okayusb@ff500000 generic-ehci,P 0husbhost Cusb disabledusb@ff520000 generic-ohci,R 0) Cusb disabledusb@ff5400002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2,T 0hotghost D usb2-phy#okaydefaultEusb@ff5800002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2,X 0hotgotg:L[@@  F usb2-phyokayusb@ff5c0000 generic-ehci,\ 0husbhost disableddma-controller@ff600000arm,pl330arm,primecell,`@0 hapb_pclk disabledi2c@ff650000rockchip,rk3288-i2c,e 0<hi2cLdefaultGokaysyr827@40silergy,syr827j,@vdd_cpu PpH syr828@41silergy,syr828j,Avdd_gpu PpHhym8563@51haoyu,hym8563,Q  xin32k&I0defaultJact8846@5aactive-semi,act8846,ZdefaultKLregulatorsREG1vcc_ddrOOREG2vcc_io2Z2ZREG3vdd_logREG4vcc_20REG5 vccio_sd2Z2ZREG6 vdd10_lcdB@B@REG7vcca_18w@w@REG8vcca_332Z2ZREG9vcc_lan2Z2ZAREG10vdd_10B@B@REG11vcc_18w@w@REG12 vcc18_lcdw@w@i2c@ff660000rockchip,rk3288-i2c,f 0=hi2cNdefaultMokaypwm@ff680000rockchip,rk3288-pwm,hdefaultN^hpwmj; disabledpwm@ff680010rockchip,rk3288-pwm,hdefaultO^hpwmj;okaypwm@ff680020rockchip,rk3288-pwm,h defaultP^hpwmj; disabledpwm@ff680030rockchip,rk3288-pwm,h0defaultQ^hpwmj; disabledsram@ff700000 mmio-sram,p psmp-sram@0rockchip,rk3066-smp-sram,ddr-sram@1000rockchip,rk3288-ddr-sram,@sram@ff720000#rockchip,rk3288-pmu-srammmio-sram,rpower-management@ff730000rockchip,rk3288-pmusyscon,ssyscon@ff740000rockchip,rk3288-sgrfsyscon,t~clock-controller@ff760000rockchip,rk3288-cru,vj; Hwjk$'#gׄeрxhрxhsyscon@ff770000rockchip,rk3288-grfsyscon,w;watchdog@ff800000 rockchip,rk3288-wdtsnps,dw-wdt,p 0Ookaysound@ff88b0000,rockchip,rk3288-spdifrockchip,rk3066-spdif,<T hmclkhclkuRztx 06defaultSj; disabledi2s@ff890000(rockchip,rk3288-i2srockchip,rk3066-i2s,< 05Rhi2s_clki2s_hclkuRRztxrxdefaultTMh disabledcrypto@ff8a0000rockchip,rk3288-crypto,@ 00 }haclkhclksclkapb_pclki crypto-rstiommu@ff900800rockchip,iommu,@ 0 haclkiface disablediommu@ff914000rockchip,iommu,@P 0 haclkiface disabledrga@ff920000rockchip,rk3288-rga, 0jhaclkhclksclkU iilm coreaxiahbvop@ff930000rockchip,rk3288-vop, 0haclk_vopdclk_vophclk_vopU idef axiahbdclkVokayport endpoint@0,Weendpoint@1,Xhendpoint@2,Ycendpoint@3,Z`iommu@ff930300rockchip,iommu, 0 haclkifaceU okayVvop@ff940000rockchip,rk3288-vop, 0haclk_vopdclk_vophclk_vopU i axiahbdclk[okayport endpoint@0,\fendpoint@1,]iendpoint@2,^dendpoint@3,_aiommu@ff940300rockchip,iommu, 0 haclkifaceU okay[mipi@ff960000rockchip,rk3288_mipi_dsi,@ 0d hpclk_mipiU j; disabledportsportendpoint@0,`Zendpoint@1,a_lvds@ff96c000rockchip,rk3288-lvds,@g hpclk_lvdsdefaultbU j; disabledportsport@0,endpoint@0,cYendpoint@1,d^dp@ff970000rockchip,rk3288-edp,@ 0bihchclk_edpclk_edp_24mpclk_edpioedpj;U  disabledportsportendpoint@0,eWendpoint@1,f\hdmi@ff980000rockchip,rk3288-dw-hdmi,<j; 0ghm hiahbisfrU okaygportsportendpoint@0,hXendpoint@1,i]video-codec@ff9a0000rockchip,rk3288-vpu,0   Zvepuvdpu haclkhclkjU iommu@ff9a0800rockchip,iommu, 0  haclkifaceU jiommu@ff9c0440rockchip,iommu,@@@ 0o haclkiface disabledgpu@ffa30000#rockchip,rk3288-maliarm,mali-t760,$0 ZjobmmugpupkU  disabled9opp-table-1operating-points-v2kopp-100000000~opp-200000000 ~opp-300000000B@opp-400000000ׄopp-600000000#Fqos@ffaa0000rockchip,rk3288-qossyscon, qos@ffaa0080rockchip,rk3288-qossyscon, qos@ffad0000rockchip,rk3288-qossyscon, qos@ffad0100rockchip,rk3288-qossyscon, qos@ffad0180rockchip,rk3288-qossyscon, qos@ffad0400rockchip,rk3288-qossyscon, qos@ffad0480rockchip,rk3288-qossyscon, qos@ffad0500rockchip,rk3288-qossyscon, qos@ffad0800rockchip,rk3288-qossyscon, qos@ffad0880rockchip,rk3288-qossyscon, qos@ffad0900rockchip,rk3288-qossyscon, qos@ffae0000rockchip,rk3288-qossyscon, qos@ffaf0000rockchip,rk3288-qossyscon, qos@ffaf0080rockchip,rk3288-qossyscon, dma-controller@ffb20000arm,pl330arm,primecell,@0 hapb_pclkRefuse@ffb40000rockchip,rk3288-efuse,q hpclk_efusecpu-id@7,cpu_leakage@17,interrupt-controller@ffc01000 arm,gic-400 , @ `  0 cpuidlerockchip,rk3288-cpuidlephyrockchip,rk3288-usb-phyj; disabledusb-phy0, ]hphyclkFusb-phy1,4^hphyclkCusb-phy2,H_hphyclkDpinctrlrockchip,rk3288-pinctrlj;\gpio0@ff750000rockchip,gpio-bank,u 0Q@ tgpio1@ff780000rockchip,gpio-bank,x 0RA gpio2@ff790000rockchip,gpio-bank,y 0SB gpio3@ff7a0000rockchip,gpio-bank,z 0TC gpio4@ff7b0000rockchip,gpio-bank,{ 0UD Bgpio5@ff7c0000rockchip,gpio-bank,| 0VE gpio6@ff7d0000rockchip,gpio-bank,} 0WF gpio7@ff7e0000rockchip,gpio-bank,~ 0XG Igpio8@ff7f0000rockchip,gpio-bank, 0YH vhdmihdmi-cec-c0(lhdmi-cec-c7(lhdmi-ddc (llhdmi-ddc-unwedge (mlpcfg-output-low6mpcfg-pull-upAnpcfg-pull-downNopcfg-pull-none]lpcfg-pull-none-12ma]j psuspendglobal-pwroff(lddrio-pwroff(lddr0-retention(nddr1-retention(nedpedp-hpd( oi2c0i2c0-xfer (llGi2c1i2c1-xfer (ll*i2c2i2c2-xfer ( l lMi2c3i2c3-xfer (ll+i2c4i2c4-xfer (ll,i2c5i2c5-xfer (ll-i2s0i2s0-bus`(llllllTlcdclcdc-ctl@(llllbsdmmcsdmmc-clk(py sdmmc-cmd(qysdmmc-cd(nsdmmc-bus1(nsdmmc-bus4@(qqqqysdmmc-pwr( lyysdio0sdio0-bus1(nsdio0-bus4@(nnnnsdio0-cmd(nsdio0-clk(lsdio0-cd(nsdio0-wp(nsdio0-pwr(nsdio0-bkpwr(nsdio0-int(nsdio1sdio1-bus1(nsdio1-bus4@(nnnnsdio1-cd(nsdio1-wp(nsdio1-bkpwr(nsdio1-int(nsdio1-cmd(nsdio1-clk(lsdio1-pwr( nemmcemmc-clk(lemmc-cmd(nemmc-pwr( nemmc-bus1(nemmc-bus4@(nnnnemmc-bus8(nnnnnnnnspi0spi0-clk( nspi0-cs0( nspi0-tx(nspi0-rx(n spi0-cs1(n!spi1spi1-clk( n"spi1-cs0( n%spi1-rx(n$spi1-tx(n#spi2spi2-cs1(nspi2-clk(n&spi2-cs0(n)spi2-rx(n(spi2-tx( n'uart0uart0-xfer (nl.uart0-cts(n/uart0-rts(l0uart1uart1-xfer (n l1uart1-cts( nuart1-rts( luart2uart2-xfer (nl2uart3uart3-xfer (nl3uart3-cts( nuart3-rts( luart4uart4-xfer (nl4uart4-cts( nuart4-rts( ltsadcotp-pin( lotp-out( l:pwm0pwm0-pin(lNpwm1pwm1-pin(lOpwm2pwm2-pin(lPpwm3pwm3-pin(lQgmacrgmii-pins(llllpppplll ppll=rmii-pins(llllllllllphy-int( n@phy-pmeb(n?phy-rst(r>spdifspdif-tx( lSpcfg-output-highrpcfg-pull-up-drv-12maAj yqact8846pwr-hold(rLpmic-vsel(mKhym8563rtc-int(nJkeyspwr-key(nuledspower-led(lxwork-led(lwusb_hosthost-vbus-drv(lzusbhub-rst(rEusb_otgotg-vbus-drv( l|irir-int(nspower-controller!rockchip,rk3288-power-controller\Upd_gpu, pd_hevc,  oppd_vio, chgfdehinmlkjpd_video, external-gmac-clock fixed-clock sY@  ext_gmac<ir-receivergpio-ir-receiverdefaults Igpio-keys gpio-keysbutton@0 t GPIO Powertdefaultuleds gpio-ledswork vfirefly:blue:user rc-feedbackdefaultwpower vfirefly:green:power default-ondefaultxvsys-regulatorregulator-fixedvcc_sysLK@LK@Hsdmmc-regulatorregulator-fixed I defaultyvcc_sd2Z2Zflash-regulatorregulator-fixed vcc_flashw@w@usb-regulatorregulator-fixedvcc_5vLK@LK@H{usb-host-regulatorregulator-fixed tdefaultz vcc_host_5vLK@LK@{usb-otg-regulatorregulator-fixed t default| vcc_otg_5vLK@LK@{binmansimple-binu-boot-rockchip.bin!mkimageidbloader.img*-nrk3288-Trksd/u-boot-tplu-boot-splu-boot-imgCdmc@ff610000rockchip,rk3288-dmcsyscon ,abcd(lmno<hpclk_ddrupctl0pclk_publ0pclk_ddrupctl1pclk_publ1arm_clkJj;W}\d~rBN  $  @ CH  `@0Ud''Z syscon@ffac0000rockchip,rk3288-nocsyscon, }configfirefly:green:power #address-cells#size-cellscompatibleinterrupt-parentmodelstdout-pathu-boot,spl-boot-orderethernet0i2c0i2c1i2c2i2c3i2c4i2c5mshc0mshc1mshc2mshc3serial0serial1serial2serial3serial4spi0spi1spi2gpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8mmc0mmc1mmc2mmc3device_typereginterruptsinterrupt-affinityenable-methodrockchip,pmuresetsoperating-points-v2#cooling-cellsclock-latencyclocksdynamic-power-coefficientcpu0-supplyphandleopp-sharedopp-hzopp-microvoltrangesclock-frequencyclock-output-names#clock-cellsarm,cpu-registers-not-fw-configuredarm,no-tick-in-suspendclock-namesportsmax-frequencyfifo-depthreset-namesstatusbus-widthcap-mmc-highspeedcap-sd-highspeedcard-detect-delaydisable-wpnum-slotspinctrl-namespinctrl-0vmmc-supplyu-boot,dm-pre-relocbroken-cdnon-removablevqmmc-supply#io-channel-cellsvref-supplydmasdma-namesreg-shiftreg-io-width#dma-cellsarm,pl330-broken-no-flushparm,pl330-periph-burstpolling-delay-passivepolling-delaythermal-sensorstemperaturehysteresistripcooling-device#thermal-sensor-cellshw-shut-tempinterrupt-namesrockchip,grfassigned-clocksassigned-clock-parentsclock_in_outphy-supplyphy-modesnps,reset-active-lowsnps,reset-delays-ussnps,reset-gpiotx_delayrx_delayphysphy-namesdr_modesnps,reset-phy-on-wakeg-np-tx-fifo-sizeg-rx-fifo-sizeg-tx-fifo-sizefcs,suspend-voltage-selectorregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onvin-supplysystem-power-controller#pwm-cells#reset-cellsassigned-clock-rates#sound-dai-cellsrockchip,playback-channelsrockchip,capture-channels#iommu-cellsrockchip,disable-mmu-resetpower-domainsiommusremote-endpointddc-i2c-businterrupt-controller#interrupt-cells#phy-cellsgpio-controller#gpio-cellsrockchip,pinsoutput-lowbias-pull-upbias-pull-downbias-disabledrive-strengthu-boot,dm-sploutput-high#power-domain-cellsgpiosgpio-key,wakeuplabellinux,codelinux,default-triggerstartup-delay-usenable-active-highmultiple-imagesfilenamepad-byteargsmultiple-data-filesoffsetrockchip,crurockchip,nocrockchip,sgrfrockchip,sramrockchip,pctl-timingrockchip,phy-timingrockchip,sdram-paramsu-boot,boot-led