bL  9U@ CHSETTINGS /@@/@@/@@/@@/@@/@@/@@/@ﾭ)1)  "Oo/Oo   P!:0@" $Р0@>->/@0@CKS0@9KS0@K$"B$!"B!$"B$n"Bfo"BgZo"BZgo"Bgk"BcpGDpNlF5Fĕ h"E"hFr_"K%"p4V0@DpF F)Yhh_h!h#C`Bh&K K!h$HC+hc&khc_h`0+ۿ_"i` 0+ۿ_bi` 0+ۿ_i` 0+ۿ_i` 0+ۿ_"j`!"hFhC`bhK (!hHp@B(d0@Dd0@pFquVA h#C `BphB#C`U/*p K h_;@H@Bbd0@;@WGFHOF HIF HC_O@rKhgd@FH4U0@ V0@U0@0V0@U0@Kl_PpGDh_1_ "A@%Ar Bг_ A/BBA/bBO4ppGArBArB ArBOppGOzppGOHppGOppG(ݱ4 ܱбб8 + pGz8 = pG8 pG3 pG+ pGp LT P_)e+l_"F2CҲ*޲oFA _T 0e_V"dA_e_C"dA_e_"AAdC_e_dpV0@pFF_SJR!0!c_cj_k_m_Am_m_m_ nn_An_n_n_$_BR&P+f_BB*f_+f+i#C+ah_`h_)KOzph!#i_+a#i_kah[+23_Cs_33_Cs_3_OC0_Ozp00_+kh_p нp@H!0Fp@!pV0@0@d0@jFFO _W!P0h_Kh!h_`_ODSOzp+a^#i_+a#i_ka"i_W&0a"i_Zah_`bj_ZeV0@0@i_ KS!0ai_ai_bi_Zbj_bj_bpGV0@_fLfJT!0ak_ k_ h_bo@𠀂hR*@𜀂kR_LWJWJ"_"_"T!0"_"_NI__KI__GI__O __________"_"_"_"_#_#_#_ #_#_#_w"#_#_Bf_BAf_f<sP0h_`RK_B\`V0@1 `@@ h_ KS!0ah_bi_ei_fj_ j_ pGV0@"KS!h_PDh_\ah_bh_\ci_dDi_e"V0@ȱh_ K$Bh_$h_ $h_@$i_D$pGDpG-EFdFF&KS$P+h_C@_+`+h_#_+`+h_C_+`+h_!FPFk!F@F8F_"K!F#0F|!F0FZOCh_co!F0FѽEXEV0@DOA c <0dpG pGcg pGpG_J"KdZk_*ѿ_EURdZk_*B>KZm_B_Zem_Zm_B_Ze_KJf_Jg_H"ZePDDD '  OAO@K<(00<0ZpGP,C`KJh`pGt0@W0@_"K/pGDKk_J2KFO D @JDDHvg_ Kd_+"cpGHF@3XC K Ik _+pGk_DFMbH!OzppGK$K? zLF*" zB8(Jh? ؒiD?ؓhZ*(#0#0@пpGpG@оJh$G0@T_-O_p`_-`O_p` O_p`$0@F FFF_#Ozpa3h_+`sh_k`h_`h_`3i_+asi_$gpd?DpGpF FP0o)F FJ8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pG  s 0pG8pG0$h4_@BМB 0 ПP-d0@TРtРt440 S$=PР 8/ 0@<8$/@FhO1 bjGpiF$0 k3dkBd#iF)pF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡOCiF4  pGpGH6 d0@C?@ pG?CS?opG??#S?opG?[ OZ$OopGH$0@Hܜ0@H0@XHFPVHVHUHUHUH(5"5! Fk$OHIH$KH$ DH@w#! ($0@,h=Ha$"#! 9H! (75H@0H(.H(,H(C)H8")I( F@s"#I(4$"$ $!F (HU#F! VHY#!F L( H"T" In(?pD2e0@e0@)e0@e0@e0@Es0@e0@ f0@N^>H8=I 8! :Hx#"F7H<83I $! .H`#/K/J/I0K@/-HH#+K,J,I,KOp+HF()HH"FH"K#JI"K"F H(KJIKHK#KOpKJI e0@f0@;e0@e0@P0@[0@Z0@<[0@2e0@ԟ0@[0@lZ0@ [0@)e0@e0@ܞ0@l[0@Z0@e0@X0@[0@LZ0@Z0@H\0@[0@\0@\0@,Z0@F@Hc(P?H^(S=HY(UIm&;FQF@FF(9FXF*+y++ RFAF(F<F+y+O2F)I0\3ۻB6" QF@FtF0F2FIHmFXF r0++RFAF +ah3 Z`h;3h`+jC+b$toqO4nsh0@s0@{h0@h0@0@h0@-M FFFGh;hBOa@F(;hEسF5D;hB'Oa@F ;hESD;`*ZFAFD8`   XSB EAD 2F F0FOcZF F\D FRFAFTD @1O0#-E4MFF9FFX8hF/H F 4M :FOa0FXK2h'KB'# Oc$K"F a@F3FM` ``~F:FOa0F8( 8F I)FHD2FQF@F=F*FPF1F@D:FOa0FPFBF1F1EDD%h0@ Q*/@+/@h0@FFChhhAC0F[:F)F0D (Fht O@ pG pG-AFFs@! F6JOQO 2K3JaS __B`2F@!O2F9F(FF(73+Ohin*"Ha!H^(2F@!ZF2hKBKAF X3FF(FF1 FO2F9F(FF(Ѫhi h0@2h!KB#ko:FK F3FX 2FQF FtiAFFiF8AF@DF(F BFh E.Рhi1H"O0 ./@i0@FpGi( pG-EFhFFbRMF(hX0h[ o FChB1h(hz(X(&(4DHoF F?HaPF(`0oQF:HUF(#F+`5H(hF(h!FF/H,h F{OCOrOQT %H (h1FF*h8F,h F[#F1F8FkpoOS"F1F8F(;y+$v+H F:#F1F8F(k0@j0@Fj0@tj0@j0@j0@j0@O@sJ#:]8k0@0 FF#,"Fh08 M+hcF0FIH F8#+`$є0@Tk0@-AFFFF F`@!o??@"FF0F!*hKBK"#8F+Fg*FAF8F9F(Fh0FF,#F2FIH_,̿  !1/@0@ok0@-EFFFFFFF!H+F"FOAQFH6"OAH JIH)O4 FHh3F*FAF8FxF(HHHK*FAF3F8FeFk0@k0@l0@0@ok0@k0@k0@l0@^l0@l0@P88 pG"F!ht@8FF#h+O0`h()F7 h8 4FIHr0@ ]0@-E F!FFF !F0F)FSF:F%FEE(x,h?`h?AQpD532FFFCF*F9F0FF, F*FFIHb F0@ u0@-E+FFFF #2F.I.HMO4 F&IF'H<!(F%J#!F(F K!J &CF  B \ C# CCF:F(FQ!FJ(F IF H IF HTF03$0@u0@u0@u0@ou0@u0@{u0@ FFX&FB 1F F#+B1F F@ hQ#j1 DDo +c` (F6#"F FS(-MF FJF F{B! F8J FF ( -# )F FMFzFBF9Fu( 'H:FSF$Hd5#)F F!JFp)F FH)FJ FO (7 OCF:FYFv;( HZF3FvH))F FFu0@u0@u0@u0@u0@FFp$%F"DB * e9FHO0%FPK$ 4`v0@FJ0!ò #p#O0e0@FJĿn0@FJv0@7FFJ(` "`0FO0#v0@#FJ h #`o(v0@#FJs h #`o4v0@#FJa h #`oBv0@-A IF!FJ0FG!FF0FoF, !F0FJ7FHIHfo@F_"!F0FMF8F(F(FL(!F0FFFLv0@\v0@dv0@+0@pv0@pF( H6$ FpN4hB)F($hv0@ "K`[`K`pG  ,F("!$`d` FpG8Fhj[kK(F0)F HO0 KZh\`#`Kb``h 8`v0@ FFF,Y(FJCh+h;p$9 io(H#;p3p(F3iFv0@KS CkG(pFM-U$kG(U$p@lG (@0 pGF  B0 ǿ ޽pGKS kGpG(  B0 ӽpGF  J0KXhkG pG((KS kGO0pG(@0 ˽pG Kh 0+(( K` FI`I `I`!$ 0 D; DIB @BH 2"F w0@!ݿ FFFؿ8(FF*F!X F8-A I @B2 Գ@7O8R&T#D#CBOOC ERD#[#E=F8F F((Fo\ p 8 (]UL*4+ ~#*4&7F (LH!$P6--Ы+#-$473/$4o %434;Ho 43 4. :o1H(-/MOc#T=/F&44B(Ht(Д(44 $S@+o _(Н06?HT(ѱ(4$˱ I 4[Bo 1DBܔ $۲BF4<=8>?-EiL%#`#T(4*TCh(FF4TT T$T8T4T+T,YH ")FOzsXC(40+  C 4+@𐀄+4 4 IH7Bh! EWq?/ؿ#@Hؿ(4(4+  C d43404;,f04BQ> '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O 4 w0@_ d0@-MFFFO pL)44+.+@O +404,04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7 J o$A$- >4+#)4Q(4+  C .434F ##)4-Д+4?|POo(4+  C 4344pG FL4;+        L#)4G(ڽ@H40&KS HpG]0@/w0@OvKh x F--!FFF f*@&[/*G/Oeh=!(F()F'H &J/h` ѠhHG8Fx9FH2F(FI 0 Fh9/F+* !B!p,K#+ K)FhHO0w0@,0@w0@00@tx0@KhpG,0@ K0#0 x3iF j]iF  Cx0@-MFFFF): x+7F+YFF x F ?)F"x3**F0FFK]=+a5)DdbBE(BF8F#DEGD2FAFHC FO4Jx0@F FIF Fzx0@F$F0 F!FH@0@0@FIF# J@h 0 "1( F 00@ F!Fp#xbxCxCxC#yCcyC8  0 FFPI*F F#0o~x0@8 FF(*F8@! F8Xx1( Y(РTXBXAO0 F  #H ( @0@ FF cH}#Dd@ IHX B  BB x0@@0@00@$F̿")  pGF8IK[HDB AhB000@H0@00@p&O51F F0%uo,P#ah( @B!h HhGF0H ,` Fp*4ѵ?5F6x0@x0@'o&9F FXOJF "$ FkiGF8kh( C(0kh( C(0$07+oo@0@-M}F FFk # 'I2FhF iF@FF~г23nFXF JYFF{h@F PF?0``QF(F40`H)F FwF``o FoHaox0@x0@-EFFF(H,! FFp F 0]Fo !F:!(FF(#;2F(F.F(BF!F(FG(t. D /F(RF!F# 0 0F# IF(K(F_ F0oo9G/@p@ x0,LxX,1 N D F%x1u]@DЋBF`p0@8F{XM!x(Fh@8!xH 0@x0@8Fc( Max(FO@8axH 0@(y0@7F%#!F BТB"x0*bxX*-x:*O0*5- 0-A%lF0hOPP+HDP8`8h@1FHJ@1FB((xKS 0+C`@0@pey0@ly0@]0@-MF FFZK/h,F.Ыh3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FH h9FHZ8F KYF(FFH"F{!FXF(?|hw9FH疔0@0@y0@Ay0@z0@9z0@Qz0@ $pG $pGhKBo pG )ۊCjB pGhDDpGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o]( o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO1FF FF0F%DB$ F2F9F Fw(4iDpGhDDCh`pG7F F!F(F( (,o  F0(O48hFDD F(` F8"FhAh hh# F!FoF0C18hFDD F(` F8-AF#FF FT-O4 F-!F8F2FAFFX]+2F@!@F]@+!FjF8FFpFFFF{"FF1F(Fp@F F@XF F@L-MF FF(Fڸ%%BF!F0F,hF0F GB!F0F:FQF(ѻ@(F$FFFFF"FF1F(F 0pFFFF8-h0F (` 4 FpFFFFF"FF1F(Fs FIFFSO3F*F Fpvz0@-A xF/+ F5/! F(FF!F8FF88F(DFFBBРF04/+/!@F(F4F)FBF8F(F%o8FF F{!FF(F8@-AF FFO0 o BBFB3`B@FF8F("]pF F)F Fp@#:p(  K@BS K(FpGHpGHpGHpG]0@z0@z0@z0@Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ7 oopFFF`hh  ``ppFFFPkjDjbhD`p-M(FFFSPFh6)j.DRFF 0FuF,۩h DF)D#"(F 3F F)jh(F AD)DoF(*jD*bQFFDFO@r0$`0?`0_`-MFFF,i#$ "YF(F_P?/Q#6`piFFDaB!F(Fp@#"=O0p-AFFFFF-CЈ0F#" 3($l` 3 `BF#F9F0F4F3FF(&2F)F Fp-MF FFF'(6C1)F F FQF8(٥h-UDf'"1F FOscQ4F:F FBFYF FOsPF>Ds`opFFFF"FF1F(Fp@8+ h+o F]o JC o {0@JC {0@ F0M\B0K$5@`@(b0@sF p%.F F(.x.+@%#x46.( FsFNM| F#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -A&FFF4FDE0FU$18F&E$4p F h@&1F FB 46)#!l```&(`0 # J`p# t"K`pG#`pGt-MFF E4ah)8!#hYF-ҀhGЩB&%ah0F97FKBchB{#hOS 0Y>-=F-PFQh-(+%Ѹ"h h"8DAF0GP# KJ`` F#h@Fb`#h;Dh ###h;D30F`B+PFQh0+ѸhFC h"XDAF0G(#h@F[D3`#h[Dh+#h[D3`{8F#hS 0+x+ѢhchB-=F#h-^Q#hPF^ p`#h@F^` h(DCh+Ѓh+Уh03` hh(D"AF0Gh"#h+D`O2#hZQhD`nF#h+D3 `kt-E&F F3FF8"oK`  ;F"1F@FG("KO0` O2#h-ZQhD`t-MF;lFO # FF{`"|KPF "xK` %YF*Fe#cU;l #RFylxhZk ;lZ3h@0(Op1FO(] 7F0Fp3h+k+Cc;`#x +C +A#+B%F; CE;hB+x{h;lETP1FkL!h(IH5  )уB ғ 23Ex)ѭ h#F" De,FF0]F=+  cCEjxEBE=+#+p]FO+p;l31F Fk5 Fzh9l(#ZFYF+pF; CE!# p#x+?9;l#k`#h+sZF!FHl\+Px(F*F;2 Fzh9ls(?ZHot:|0@ |0@q|0@-M F'<"   $+C C$ C  2K]fF1HMw : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H&!FH!1FH0@|0@|0@|0@|0@-AvBF FO/0FD)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FJ#0IZ@  0@|0@-AFFFpIF(FF(FO7F,8FjF!F(FZx/+D<[BF1F.(BF!F(FFvz0@K8 ]F FF:FT -M0FFFF3(FF(FQFFZF(FF"!DBO1B!F(F1FF!8D0FF2H|0@pF?F!?@ 1F(3*F! FpFIFx3\pG0@F8CH#DBF#Sp Fx;A\0@ #h:B`\i1`i 3`i\`-Mh6&``a` F%< pE @ : EO0EEќBR $`D`$;E!o ' wDE hDE4WDE0}E8,@DhB% $]F-ET| 2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`x}0@w}0@}0@}0@}0@7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpF0@O2ؿB;?+pG DDB;?+FxF2,;+/*FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 88F80,F,F F8!FvBFًB F FDBF9DB xO3DɲB FKBFOzrF33hFOzs!pFN-B%F(5F(FVdp0X#"LM\+$* 0* %-9KBKA2c\D;#0@!-MF FF(n  .I1F(F"  F01FXF"@ PF#1F@F@" 8F!"@ "! "  !(F"  F!XF" PF!@Fo #FFFC`Q H}0@hZ`ppGFn-A#&FO:L\= %Fpgp:+3,F3+#+p3F+hL` p0@-MF FFF %) FhGEFixO -) x550) ##0 +#l)'`i)#q'%)8)иF 0 0 + "c)d)u)V;%k #`0# 0##qpز(+P#n/@m/@m/@Mp/@m/@n/@m/@m/@o/@+ "`-"[B OI"rF[BٔҲR *OW O0 RD tJ8!Oэ+xVM+)m+"I+'+FlIxF\3R "#hpCF3#`,F ;+O0 O " F"kx4+O H #O O  0%  303 001  F89E!T;"h+P `p   F.#;V)? ORO!cFB ٔ۲S  +OWO0CD  08O?خ#; "` 0VO #` YF FhG :ܸ?)? FhGʚ;0@K FFhFh ]m/@RKW ]pGm/@?RKB p]pGm/@ RK, p]pGm/@K\D C9(Կ08W8pGOppG0@px0+CxL\D۲x+"0F%&F0xB `(Fp*"* "0@"ѿ "οx-,н@ƿ0@BxF0+CxI\A۲x+"0$F!F/F8xB 7` F*"* "C1A0@pFF)KB J \@Fl;]v `!p@B!`O0p0@"տ!IK[FHDB pGAhB0P0@h0@P0@pFz L J Kp@޿0FciGch3r Fp4B$P0@P0@h0@ J K"pFLrB0FciGch3rp4P0@h0@P0@pF FFjph{2F)F FG(opFo\o%F"߿8% F `CiK`id`,II (F8Xg0@}0@7F,hFk,H,, KJ;,Fkha3 I{0K J},FJJJJg0@~0@~0@~0@1s0@ ~0@F FFF8FS( ѳhB ,DB4o! o%o-AFFFFx FF FAhCF:F(F1DAFFFp FF FqAh:F(F1D@-AFFFFx FF FXAhCF:F(F1DA޹81FU+-ѐ1+)#FrI  34, " I6V 8"IRM( O0O0(~0@,~0@i?3#?@3 ?$?#F"!( F8 @BFO0-MFi?3#?@3 :` GFFT"! @#? \HcO3{`xh`7FCF"QF0F~(RFqhSHN!U)Ѫ*NH0F x`(rFp)xI=)y):0[E6Ѻ 1)/{iYF8Os`j+0FCCSD#`ꉫCCc` 1I,q+ySBSA*x[*Cd+yP0)yA )  5By-)2B@F(q""`siIc`{id8Os,`/aS0FAA;hD0:h[F F+x`L2~0@b~0@~0@Xg0@"#F]pFF#z{(FF(F,(&$!F0F !khJZ IF(FpT"@K :4, p~0@~0@hkhGo%pGFpGo-AFF FFh,<,3Bo FhBChB@(Fj-AFF FF#hk;F2F)F FFA`Go%-AFF FFi#hk;F2F)F FFA`Go%pF FFP#hkh+2F)F Fp@Go%posF FPoh,<,3B0Fp F'hBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% Kh,<,3B FhFB BhE8Ft`\Fjڣ F193!;#A19!!9!?a4%%a`CargD``𵍰FJ FF!ChMF F)F;FmF0h F o ~0@8?0 ?!F@ F8!"Fz(F)(F8F8@ -M,FFFF#0xhF8L! F(o (F4Ccc,bc `CaO3<cdad bCh[l d;kk cl Ccd9k(Р`[hkIcl Ccd( a3hk3j[hlIcl Ccd(`k4cc#d` FvF(hc[hhclC@cd FG(F3hj+ FG( FG(@ou#RFhFFFFhl[ #(F#<oO08F(;Cl*Ԁi%hj8#j[hXk0bj"Yl `bikhPkj[hk0j#)lbclCScdhcl i+)lo 8ao8F(7Cl 8hHi`cl FCcd`cl#cd(cli;+is F(h[j+ FG( FG(ohpGhpGipGipG@jpGjpGP4?B #<; `pGhki42B #<;` pG#`P4?<;<BojdhdhB `kipGj[hXhpGClCCdpG`pGO0pGpFJ K LB$ Fp0F!h(D4,0@0@,0@IK[FHDB pGAhBH00@0@0@-MFO &KL\'=FB  .F 5Ѹ0FXF C+(FF7(F.F0@00@0@sFFFFFH*F F#poO3]pFFahlZT4_<=<B cl F(p(F1FkT0#CnhS`Zh`pGTKFɹ \d \ ` F JT3LPT(  oD0@FTR  pGF p FP F0!F@TFTJFHd0hTn8B Ch[hBipd0FF+C# `(; FF(:! FFo p)k) <( `#acae```d hK`!aba`jc FGH+kSci"iS``##aca4` ##`0`o"o_hpG#7 F`FhB!F,;,Bo+`0j9,;# F `0R?B,;#`#h`jj2B,;` pG7 F F,`0ChFZll hjl#FS/,:,B0O0ljBF#7`K FFo01(R?,;,BЙlB+`j8FF!|F%`F8#F`a"FF@#F`"FF@׿ Fe!F@{hFh]n# ` FK0#h#@F2 F #h+oFDh@j,h`3bc`iFkj[hiKG0#kjS``#b#cFjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@GsFFF Fl1FipbO DP< +`pooJF"ۿ"]l0 FFFFFl F!F2"8 FhhhkiGchD@  pG7F F2 ohB BhDB *``h`0F2 FHFh,<,3B(FclմB FCh`Dj,<Fv F@Կn!F@h a``h!0@ ` @ o K P#@pGsFhFGhFFh#h HYh+h J+F2Fopo 0@0@-EF0@FF<hFh0FF0h"hhX @Q 0CA 0 h+iC"p2F@FG(oo  F((!FoIF F@C0@-AF"IFFxFth$ORIH{ _O M_x8F$.п_OqxFRW0@50@0@A0@-EK)M''FFFOzv@J/D@F;xZ_ > I H5 H2_OrxR".FA0@W0@&0@0@0@8 M KF)FxZ_+ yZ__xOzpRP8W0@A0@-EFd.MGh.Kh/FzZ__Eox0FBF9F F;F(ѿ_z$_Hbkz9FR FBFp0FЃ@F _ObkzOzpR_HbkzR( &9F F_OrxR.иHA0@W0@0@-MF6+ hi<{/uHoxqH?oHAF FF(ѿ_jKF R_ R_ R_0R_HB' 0RAF F(FVH+%AF F _Or06R-;(oЃm ՛0Z_ ;_0RIտ_"0R/=Hegik FbF(Ї#kP+ Fz(FF! FPF(@C#k+ (Fz*d sOB#a#b`d0mF)F FzJb`I\IQ#0OSC"&i#gf1Cc@.O C|CCvF 3  #F CXCO O 6Or0D"0$&(*,.bgackZ "*")F F`j`T#O +d0")F F`EF(@# Fi0F(@ F~z FF(@chlI+7#H0d0b F)F`F(3#+## ``S`)F# F(?eF(f0c+ o+oOHONKFPc`HjbhDCSbIK!dB-O ?(?#d0#@# # Fl`S`FH0պ 0BjCbOROXjj.N@#xs"3hB)K6B(N#`-'J'J'J'J@sCs0#KKO shU+@ кOк_4к_"!o F f +O @h0@T_0@D_0@T_0@@@@@ O7#1#d FB@"A(F(!#HA FOH@BF(Ѻ_## FabhKB]3h0+@'o"9F Ff0000Oscg F1#CsboF13!;#A19!!9!?a4""a ao@+@ @@ka# 0I0^0#`BOn3h#+7O#0#!}KH"@#`# ?*? F`S` (0CE?x +mJR#pCBCAt#rbiI Bt*?ϮfKb  cI  FCbCbj F!o"O XN FE?V< +BSO< _E6V<, C B>VI!rOc'Od`9KP01`1OAC @0L%`1\Wr0(M3h+Dn_`1"R#`1_3h9F+DfLeTBF7`@"$Or$"$J#$J4%J%J%8"*`*FB?3:+:#:Ts`K 1 K41io fT x0@0@ /@y/@E/@i/@E/@/@]/@>GxxXLE%x&hEExEe_TGyy&hE%yEEyEe_TM-LGzz&hE%zEEzEe_TG{{&hE%{EE{Ee_) T,F||%hA!|AA|Aa_F}}%hA!}AA}Aa_F~~%hA!~~AAAa_!h_A1_ h!hi_!hi_A_ ha_IHJoI!h_ `hAB %hvU&P_C!PX O0@X0@@`@ _ Jhbi_C_ha0_#_h 0pGX pGjd)0s бz )bHpGC0C Cb pG-AFP FFFF`M2F!H$ FIP"!RO3"a#a#abbccJKcKgdH%`DBKc`ibbh"c[is FGXIHZhhz@B83. KB6E&@灄0@v0@h0@0@h0@0@ޘ0@0@ZZ-AFj#FFFG(o(`#BF9F0FjG(+hC+` -MF/MFĕ"5F  ŹO34Fo`KZ%  F5-".=Ж&W!X%8FFx `C[E S#F8F(_@F#@$( |`0@8CkF F#GC D)F F8@ChiGFpGChiGFpG0FhF0j% FFk0`GO00pGpF"O1i C H0O0"O1(FOzp0@-A !O1@FFFFhSBrh!h[hkH1`$ F*FH)0@X0@pFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA^"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1opFF" FO1F("O1 F( E Fp@"O1pFOS"O1Os"! Fch ib-AiF.t F(!"?0FhI`U+hC+`0FdI1"bI "F`I@FB^KB^KB+hC+`0F[I0YJBc XJB WJB^oTJB C뀫CbhQhNJB#chZhJKBjF0FHIP*Cs뀫Ccj + +,Os"! FBcj F ;+"#OCFOBF2(ۥhch Fiba FG   o #OrchZh$KB+H! F(H !C F(z)h F"#"LCB!(f燅0@0@0@ą0@`@w܅0@@x}@YsrMtM0@8FF"O1 FOd# #Oca#aa(F80j %h<+b<# `C`@b```"aca h# `L`h`Kh`L`h i 0"`o Fc khlhih `pGh8cYl `j`bpGCh\lhh_9)KJ[\Q\O!O Fg@2CFh@H`\C@%C_Bhh`C)C ),C0@0@F_#"iS`_"iSa"h`h"#iai F{"F@@S$Sp FFlF?!?(F)D Fi03F*F F8p@6Homp0@ibi[k`ikS`ik`pGpFF$kh[jBo&!F(F4("S   P C: ;"1F( Fp!Ch[jBoF][1!Ch[jBoF]@_1#-EF*IF F~O#@SCS(#|] COGR% ;8CB%3CG@Gc) F F ۣi]ciAAcicib0@-EFrF Fw#Fh1`hѠiOhBB`ihOBB`i h"`biWabiaha"OShh@` (#h`hi2U"@E"h^ COL^&  " ; B N& # C F&@FE( F( F( ۣi]ci@@cicibO h F chl]l#]C< h 0kJ_bsYa@R0a hBh_sYa_sYa h1%iR 0CB 0 F0h@m+Ce"chl[lw/&m.0F@(@ichi]ksizE*Ed+pEEhBйh-qвiOW!(F+hk_C_*hc+hk_C_*hcC F$(F=3O>rE" 2CT"|[@ V@*B"XB=@BHOR,BBBB bdYdT>>3O>rE?r" 2C:T"|[@ V@*B"Xj{:B"R" B= * *A"€€>@Do Bk<!spGopG#0k ZX"BZZ̀0ڈBUڀڀp1pG pG9!d#e( ޱ{{˹KJF2FPFI `#aN@##K`O K :" Ju`jhk``"a`zw0@;p0@0@`a0@0@a0@F,p"@/d?C?A  "0<B bш @Ӏ##cd#b#LU0lB 8+@ok F(9K-M&NCԡx1DL@vZDBF $(<F% E]jB%E],Т{bh±! FXDqajB!BZ{eAsbjchB"!F@F# {\2+L@B( io ktC#kU0 p!F눛#`C눛C!Fo,!F#T0>0+k#0CpFop) h: kkBHc$Lbor b<@9@>@8@Tlm(Lebb,`U0lB ao<ok&F Ko?Ku?s???B ؔ?#?#h[i! FG е(;U 8 lB:ѐ/**o*m(ebb"`"AsO,~ p,Jh*$OODl/kp?+k/o#-Eԁq0{>zF= O %}?}Հ#{?+++JKR#0I@"H#?O }?+\h # F O @dRsBq=е(:UU(,U$< D[9zpBβ>oJE1FFU"h?C?#hc`L0@-AF'Oxhk Хn ?2F!{HP#ki0@F@7htDtt?Ozp"F){@H-i0@! h AـhـhۈpG-MF1FF hS /BТ # aa&0#100# 0+@ $pO , 0D(0 0( p+"tD( jejF1hhs@𼀲؈ @,؀ F)Ji 'o(X( OHHOXH H XHX(hP"&>O#  $0)]Е rQ |!! pu &):іH6 8C !r& *4і/R0!B(F1 Faڀ&0+@40#rv(i8A!!rD r( h*ub{*\Z FhSCaQXBObhZ"hZ/"0Riqi# qi$ q hVs! hZs3|h_( k2C#Lc#(0 0' n@&  #Oc*CShC Ӏhۈ ڈ I#{H@N"! Fm!pB!ۈB#{@O2IHS0+ћ 0 +SCS #l0@0@{0@0@-EFFjTj F&0sO +h%ثh/Lڈr:O "hI 'n # Cf#%0hAhJ``C``kG#h% hB;"1籨i( hG#a#+bk{ #kb"#hZa&0+",,Zrhi) hGoak{+#+b#}+#ihS``"`"ahB 5#u` 0"F iOh1Fi:`G@4;h (FBH O00@ ?0@i x0f h hf8DkFah)hhhhG#c`h)ihhG#`j) ihhG#bj)`ihhG#b##`kc8phF0 F"(і0 HC0#kahBУh)F Fp@hGph0@pCjFh+ciCi!hhGFK`#"&c`Kea#a#h!F`#h2F^`ihiGB p&b!Fioo `  0@JF\H0;زpGD ;۲\D7;0@{F+/i[ ih[hGj) ihhG#b#j[`ih[hGj)`ihhG#bcjih[hG0#0#0#s@kǿF(1 --:&& F"XU,\xB5-ѝ0ԝ C 0C 0C 0C 0C8 p%:&pF FCi@0"4 D[T4+4 FKdhl`+`K)F+apip@"hiGop90@,"Kj`@˿ piFh*21i>J>K)Fa#iK/sF=K:F#FI (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H~%Hy?O2!H (OC $Ѩ acbO3a#O?1@ !?s `(4`cjs``cj`#sa201)F @z b @D#aP 90@d0@~0@i?3#?@3 N ?T"0`$?H"F! (#O53`(FF"IpF(" I6("IR( P 0@(~0@,~0@"0K`F F?D!Fjh HO00kii@0@(F 0@iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1F(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0F#{!0F#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF2FiF@Fn(F%F(?AZFb+#,1<-MF FFx+x.FF5/+\+0F*@o UF;/+\+ci;*0I0F#hZj"[jc`#3#a+x+*'IKj3Kjc`=+x+o FF(<XEF8ZF0F<eP<1CEAF0F[(iz!hCJh *"Dc`+O 3#3#az]0@Ό0@-MXFI@ FFF(5(@2"1F FS(@р.ii )OO$E{3F,-x KBq+F FNFdDE{'mh^bk+Cr^Ex F ?O@!?F(O3o!Fn(FbHf ) )OqOaBMA1F[F!FTH h )Dj 1J1V*!FD((F +!+OsOcBZFBz3F!F(2H2,KYFBE,+F!Fc(!RAq!v+DYFh (Fq +%+OsOcBeZ F(^ **OrObBR[FC FJKo 5o2@ь0@0@#"#]#J`J`J`J`KJ#?`pG -M KFhFF0F@IY"42TO &F! apppqqRFIfq '2F RFAF 2FKhM0@N7p N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`D7`7\70@0@KhP A1JhB  L#h3 +#` HZ#"#`K``%0@,7-M*F FF")FOHMº xJxC#(ыxxC#+"ёOy/ 0 :FQFw B ѣyyC#г6@0F#q#qFBFF4P:F!FPFKBFF&IE:FYF F@<F51F*F8)F8FMO;h+"'KhSEN0h"AF#MFFRF FLG"AF(h!h(h#;`#`3`P0@D7N7Kh8 pG-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*{ [2!!p!ppap#qbq4GHFh'F #;F`pFAF8F>H(b"!;H(\^##p#'cp#6Hpp'qF(Z(Ra#cq#qq:F0F44+H*K'F(FF@FV<#;FFAF`p8Fk7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)tw ]##p#cppp41F H`4;v0@0@0@0@d0@0@-AFFB!x)ѽ)ex3C)[2))@5,D3+R#o/0@w/0@C.0@/0@/0@/0@/0@C.0@C.0@/0@/0@/0@/0@/0@/0@C.0@/0@)S!/0@.0@/0@/0@/0@/0@ /0@/0@/0@/0@/0@/0@!/0@/0@/0@C.0@/0@I/0@)"/H"-H",Hcx+")H- #*F&I'H':F%H##JU~/F?-@#*FIH?':FH~#J/F"HxKpa"HKWO*F8F`MHIO5F`7\7X7T70@0@X0@ 330@"sF1F .KB#MEq+p+x1Fl+xl,p@pcSc-MD)FC+*x+Cx+уx+ F"Kh#JBR[Bk3:FxKBx*5*Kћx+ F")F#")FlH"kKkHhDjKx l4 F@fKx+Ob!FdHcI xbH#QF"aH#3`_Khb\IF]H!FcMR 3Zx2DUHM"RIF( "QFa+?yJN7h/?}/?q/O FA0BI%@)F@R F=IOb FS#D#wcw#0JwFwh5J R$ "% 4BF#&IF8"I\BF BFQF!J9FhpD# FC"O1)DscSc@7<7H733)0@D7|20@^0@N740@0@Mb K`K`"K`K`|x-M$cOcH<`(!FE_K`_K`Hh%1`@@R! F4YIOb FO #VJDwwFhEQJ R$ "% ("]",V"0O"4H#FAF8?":I+F*FQFpL 0FC# (FCC Cc*K-h*1 "@F/$Kh;H#P " C" FD#O1KIh#H;`)DsLpIH"P2`s0@0@0@|MbN73x40@U00@KhKhBHM@ J Ih@oOcFF`~@|0@x40@( x(] 8F F#h FkiG"!(! 8Fj !`h9(ahHo0@FCl hki㱀l FyByCyCyCzCBzC#h FkiG&ah@HU(ah@HM0@0@sFF(F#3`3q+hFki+A1NjFl0H7 #y C C C C C.by4CxCxC"yCbyC"iF F`ihH1F"FHiFH"iF F(Fs (FG(NbyCyCyC"zCbzCЩl"Hih Hop;0@i0@>0@g0@~0@70@0@ hF+!F@( #h+pFhuF)F( gN0`0!F( 0`%`$h FpF $`ClK`(FhB #FH(IFF0FX%O7( (x$ F0FB5DiF(FFh,<,3B Fmj1F`h(B٣lBi0@} z0s0Cl#`gdlO0!HF H`I@< FFhoFF0Ho F5FoOkl+h(FkhG (FQ#`#$qO Fp $oos( 4,#HH Fp!H*F(4F(/$[lH-HZhl'.BH [lD+H o%0@ҏ0@ۏ0@ޏ0@0@FFH IFhF!FhF0@0@FFH IFhF!FhF0@0@KIhFFhF8 ] 0@0@@hHt0@HFH(F8TI'(<F@HF F(i0@ŏ0@Ϗ0@8FH_08 I( M(`+hB"K`ŏ0@Ϗ0@(7pNF0hM+hBH,,`0`p H&@(p@ i0@ҏ0@KJ`J`"K`pG<0@"K`pG,7pGU@"FH o?N7L#hKJ#?`Ja`@aQ`QS``R##`@ο0@8+H*MF` +hB"om%K` F8$IJ F#IE( F!I?(" FF +h3+`Kh@ KFh `KhsKJ`7BrK`K`KJ`"K"K"0@,7`i0@Ϗ0@+0@$7(7 7<0@<0@K(FFK`pG<0@KhpG KF` `KJ`Ozs\CKC `MbKhKuK`tK )F F`@߀rKh@GOv@qmK]B(FFjKB[f{#{C#@V[B&e}#}:C#[@v@w BоB B@𣀳o-@B@)F F@O:*@@s B{{e|F&#|vC#[ :*oٮxxF&vBg.e+x@*`+\!(FH(V"[.JhB3H" MyyC#[ +8kz++}+ k}+/H@\2F)F F@+(~k~@ @(>Bi}+}}C#}8A! H[IhG<787070@0@D700@KOsB @s@ B   pG pG0@pKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjt0@N78F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuN7E"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "\" U! Fr r47FFB"w"JFh!4{rd+uu#",v$kuulvvvD7-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F' 4$K`K`K`K`K` Fb O0o0@0@$$) x"+219:*K? "+#ppG;:!Hg8 3(()) + #@J?O( KhcH Kh#HKh H"IH(_CF(Hv H H d7M0@@7p0@D70@0@N70@0@ː0@ H" K` (HF"K @di0@,7 0@("\K-M`O"YKYNhZO`F$XeP F#;`MK`-/'7 HL( DK`m"AKo`#>HW":K` "6K`"hbu-Jh/JhB"h#`G3h+3h++2+0(F((oLu"hbFH!hHWKHhR --$hXYo?d7,7$7 73'0@D7/0@P0@(0@Y0@-AHF FF:!@FF@Fop8`*Fq F# ,D<(*FI3k"K`,7o$MF$H Bp"I"L*h"K"I` hOb'$hJD)hF# FhY%!J!ueu[v#vuu%vevK6`uK u(F` K`@d7b0@QF0@0@D7h7-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF"h"YFPFc! F*r r%uuuu uJFFD9F2FF1F(FMʸd7,7D7 LhFl hF!h8K"h` K`dO0(0@ 88OKONh2h:*\fs\\OrREI FCH0D FAIAI@K@Jh42?I F" F'0;KD:F Fh9I8KD F:F6I 3hD+ 4K+ F:F2IDe$/K0J0Ihh h/H"-K`ObR+K$h[k%ObRO@s(k%I.$%ObROs(kI!$%ObROc(kI$%$%F8p7s0@0@0@Mb|0@3y0@0@0@0@0@,80848H7,7$80@0@Ƒ0@-MJFh BѣO9h)ТJhBЊ*- "o𗁲oв@`"o:`J L`BؐKKM IPFFx(FJJBFH!#;`IPFFx(FKh2H #;`~IPFmF zK`zIPFbF xkK5.tN`@ EEmL#E]J3#D[J~璲)2` VIVI!9`QI* `O_I0 `^I `^H)1h]H\H"Mظ9)0B?P@rkMI h3 `0C0LK`AO9h)Sи03B( F2"SCDK 9hB43h?I0?K=h>K`,Kh 3h8Kh!,,"" *B&H.H}",K# #K2K !hBP )E# ,8808Mb880@0@0@0@0@0@0@0@80@$87 888!0@/0@Q0@(88N0@0@0@8 8f0@,7@!F)i3HLd# s#3#2/L3h"By,J#D#pb)HR!c[;+?$Hm*g*F0B0@B]L;h00+H8hLJ h8 `p H!hOzs!XCJH" K`!b0@880@0@38-0@880@0@0@,7Jh3`JhBIHM@w H K Ih Kh+н@(80@0@֒0@0@0@N0@8-EL0##0|H "! yH( "!vKvHuM "!(`)hzqHOzs+`oHnN "!r0`1h)jH#3`@W"B9FfH#'0cKdLh"!F@F0nF ^IC\H#ҲYI " F'!FWH'sFUHOKTILJTHSI hcSKhJ0C@BOH NL,AIMH!hIIKH h!IJ@ Fh"CKDH`CHEܼ'@KAHhc@H?K F`>K2h`=K>I(h`2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>Bypassing DPLL failed 0x%x DPLL locking failed for 0x%x Clock enable failed for 0x%p idlest 0x%x DDR3 H/W leveling incomplete with errors ti-musb-peripheralti-musb-hostgpio_omapi2c_omapns16550_serialresetting ... A335BONEA33515BBSKU#02A335X_SKA335BNLTA335PBGLA335_ICEBad EEPROM or unknown board, cannot configure pinmux.No AC power, switching to default OPP ti_i2c_eeprom_init failed boot_os1.500A1tps65217_reg_write failure tps65217_voltage_update failure BBG1ddr_vtt_enam335x-evmam335x-boneam335x-boneblackam335x-pocketbeagleam335x-evmskam335x-bonegreenam335x-icev2am335x-sancloud-bbe-liteam335x-sancloud-bbe-extended-wifiam335x-sancloud-bbeomap_hsmmceth_cpswti,am3352-cpsw-phy-selcpsw,am33xxfdt_root: %s SPL: fdt_shrink_to_minimum err - %d SPL: arch_fixup_fdt err - %d U-BootTrying to boot from %s SPL: Unsupported Boot Device! SPL: failed to boot from all boot devices U-Boot SPL 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000) Can't load %s: No load address and no buffer %s: Skip load '%s': image size is 0! Cannot get image data/size fdt/imageskernelloadables%s: can't load image loadables index %d (ret = %d) spl: ymodem err - %s Loaded %lu bytes UARTThe Expected Linux image was not found. Please check your NAND configuration. Trying to start u-boot now... NANDyesautoloadNo Ethernet devices found ethactProblem booting with BOOTP usb_etherUSB etheth devicespl: unsupported mmc boot device. mmc_load_image_raw_sector: mmc block read error spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_os: mmc block read error Expected image is not found. Trying to start U-Boot spl: mmc: wrong boot mode u-boot.imgMMC2_2MMC2MMC1%s: fat register err - %d %s: error reading image %s, err - %d falcon_args_filespl: error reading image %s, err - %d, falling back to default falcon_image_filespl: falling back to default spl: falcon_image_file not set in environment, falling back to default spl: falcon_args_file not set in environment, falling back to default argsuImagearchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imagefilesystemFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageinvalidInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwarelinuxLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-V%s: %s: %s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. regERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapUnsupported %s address size entrydatadata-offsetdata-positiondata-size/configurationsdefaultdescription%s: Missing FDT description in DTB NULL device name! mdio_register: non unique device name '%s' Error: Cannot find high speed parent of usb-1 device alloc space exhausted loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenvenv_buf [%u bytes] too small for value of "%s" %lx%pM*** Warning - %s, using default environment Loading Environment from %s... OK ^%s$Error compiling regex: %s ## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flagseth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" nowhere/aliasesFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cells#size-cellshimport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%sokay### ERROR ### Please RESET the board ### This will not be a case any time RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.Whole Diskhdusbdmmcsd%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x DOS%s:%d%s.%sidescsiusbsatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdrootroot_drivernop%s: %s: error: gpio %s%d not reserved get_valueset_dir_flagsgpioinputoutputunusedunknownfuncgpio@%4x_generic_%xi2c_generic_chip_drvi2c-chipi2c_generici2cTimed out in %s: status=%04x Check if pads/pull-ups of bus are properly configured i2c_probe: pads on bus probably not configured (status=0x%x) I2C read: data len < 0 I2C read: NULL pointer passed I2C read: address out of range i2c_read (data phase): pads on bus probably not configured (status=0x%x) I2C write: data len < 0 I2C write: NULL pointer passed I2C write: address 0x%x + 0x%x out of range i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! Error : I2C initializing first phase clock Error : I2C initializing clock ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! Select HS400 failed %d Select HS400ES failed %d MMC Device %d not found mmc_blk%s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s: timedout waiting for status! OMAP SD/MMC%s: timedout waiting for cc2! %s: timedout waiting for softresetall! %s: timedout waiting for ics! nand: error: invalid bit-flip location nand: error: Unable to find NAND settings in GPMC Configuration - quitting omap-elm%s: uncorrectable ECC errors (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYqca,keep-pll-enabledvddio-regulatorregulator-min-microvoltregulator-max-microvoltqca,clk-out-frequencyqca,clk-out-strengthAR8035AR8031/AR8033AR8021SMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700cpdma_process timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc Updated phy address for CPSW#%d, old: %d, new: %d ti,am43xx-cpsw-phy-selti,dra7xx-cpsw-phy-seldavinci,emacNo serial driver foundomap_serialep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! falseidlein/statusout/statuswaitUTMI-16UTMI-8musb->config->num_eps <= MUSB_C_NUM_EPS, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%sERROR musb int-queues only support queuesize 1 ERROR int-urb is already pending on pipe %lx Failed to enqueue URB to controller MUSB host is not registered Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! timeout sending packets to usb ethernet USB RNDIS network up! highRNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:ef:00:01usbnet_devaddrde:ad:be:ef:00:00usbnet_hostaddrmusb-hdrcRNDIS/%sTexas Instruments%02X%02X%02X%02X%02X%02Xusing %s, OUT %s IN %s%s%s STATUS MAC %pM HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready cdc_connect_timeoutEthernet DataRNDIS Communications Controlcouldn't find an available UDC Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) UPartition %d invalid on device %d ..Invalid FAT entry Error reading cluster ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d AM335x U-Boot SPLhostnamebootp_archpxeuuidInvalid pxeuuid: %s bootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d bootfileDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! Error: %s address %pM illegal value Warning: %s failed to set MAC address ROMDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethrotatenoethprime, eth%d: %s [PRIME]ethernet%s%daddr%saddreth%dmacskipethmacskipnetretryonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) filesizefileaddrUsing %s device octettsize%c%u%cblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) tsize TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... /s done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *load_simple_fitspl_load_simple_fitspl_load_image_fat_osspl_register_fat_devicespl_load_image_fatfdt_fixup_memory_banksfdt_find_or_add_subnodefit_find_config_nodebootcmd=run findfdt; run init_console; run finduuid; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x82000000arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxmtdids=nand0=nand.0mtdparts=mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)arocsdxbimEPTGMK(((((AAAAAABBBBBB0123456789abcdefwait_for_eventwait_for_bb(4$,0  $(,048<@ #(-27->0@pF FF$(*Fp@ I HW! F$x( *FI HW Fp@$1F Fp@$288-AFKH(I':FIIW FL4F(6F FL 01F FL"F FK+X 9F1#F1F F7JT(CB+F3HW!#- FAF+JI{+O(Hp(&Hk($Hfx"Hb8w"IV( k"IV(1F FJTWJo1F FMەB+FHWI#1F F JL9 9+929 99 T9]9h9l9XJ0cVH F$ F"FQHVF("d NI"Fj LILM" KI"E JIH1_Cc_EOH1H1_Cc_E H1!F$ V*!E $kj_#տ_Oc6HbW{j_[տ_Oc0HbW!j $&B,HW+HWU*HW")K4Fa(HW"%K`%KpH1_#c_JH1H1_#c_HH1BFFHWeE $ V!E $Y9[99pD99H9::C:9L~:H~j:0jH9FM"fIV(eL$C"cIVcK(F9"`IV`K(FXHH+"[IVZK(FQH"UIVPCxI+QLRJL+F F(MINHlMK0&_46_JH :}йGHW0ԝ C C C C C;H:8K8&_<6_6H :R0ԝ C C C C C)H:(K(Jx(K)H)FF&H:+`%H:'FH:#Fl)FH I ! 0L{" FIV (!F9::::::9 T::?:D::;H~ ;;;0;:(;pGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDHF !Fh a a8 DBpG;?JKFdKaKaP1 3 = -EF F*M+OB*K`EB80L \$KB43B"KB;B*y*KX hDCH 0!? ?G#IHW5"SEr BR  NB~FIHWeӇhL7%F#h#`0FF9OBЄB  "F4{1HBHAG2*6$`B`A+)h D 2"`K` I"K`-E"MF+h iFFDB,3B#`##`%h F#FAFX$#hB$##`P(F-h5BO :FAF(FB( ,#`-,-A FFFH)*h(Fd!FB)F8F++  F3K,0hZB2` (F"8F FHHFFaFFVF H(+"\ȱCh;`###hhB"`- 1K,(Fk FHH IM h.hB($3i( ` 1K,hD79D![R3a@-h F*i:ha-M`O1FhDc  Y D)D!D?1z`F "XF*F F ` V P2"D"R*a :ha H K!hi ?60 ppGHpGHpG&޾F B3 pG00 &OG3F1MK3'+F$%F#wC;U4N[0j"L;:۲T#0 ЋF"JgB{ "D3LD/B@ҲT" B V[h@ŲR%P%R  ŲR%P%R  CC%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) IBI SYSTdH0$ PDas U-BootHHRUNTSERVdPE E ]m ]ѡE M U 񡄀 #??OopGpGpGpG@pG@#???OopG8F FC0?"3@SB#@BؿO)F F8@>?DpGpF F&0o)F F 8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF q Y`0pG8pG/xРUРU/\HРP L8,,0 S[[ 8/0@) _/_ РP/8 /0Od@P TP  Q:< 80QR:/llpiF$0 k3dkBd#iF7ppGs0F[k`H F9H!V("HVGKIt,FHV;O@ %O` !0;  FGp0kR;Y;oy;;~;pGF H903 F HUH F@L;;pFF(F0Fpo!F(F(FO6F`IJ6(THK@;;0G%@$0C#&@CC'@CcLBLBH% )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHV (obox;<F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk H HD} HHx@ORHU<pGH ?D@ FFHU  ?OB 8 R8 8 o8 8 pG0AQA@aC pG?CS?opG??#S?opG0pG,S F!0_    #P?0o CY?OU3??C?o?C?o?[ O$OopGpFquVA h#C `BphB#C`U/*p K h_;@HU)@BD?FFQl!tQ/:hB#C` h# `F H h_8 HUBW)@3@?u@Bn?K_pGDK_0pGD8KDB!KB KBJL(R P( KS +F!F HU 8J L J L L M Jl~?t??`~??% OAO@< OA c <0dpGG  ^F2s FKJh`pGx~අ7a0 # F"F)FHUL F0?sF "e!#F0e!HU7 FpF!0F#9HU*!0F#$(#*hò B!*y(!*z(!*{(!*|)@_@_"K/pGDKhhhh_ pGx~3@180lk- U$ B8 F!4T-_-O_p`_-`O_p` O_p`$0@F FFF_#Ozpab3h_+`sh_k`h_`h_`3i_+asi_$gpdiml3H5liml(,H&#!8F01#!8F0!8F# **>J! (<0:HH̆A'VqB rB#r B$B8CBdBBBBCC1CDsCPCjl*hЫi00+ 0 D0gЛJ)D@Ւ0++ #RF (vo` 0 pOs0k1F0FZF8F (5 8F  F&  o8F*mBqJiml1(oHO+nHK lHTOlHTL-hHTC?1&?!?0 < EK BH BEcl+>Д"0+ZH RSF(NH7wMH7r "єFxos  FAHT@HhRR0Fc0FF(f@#-3o:#FObQF;F S?H{GSF O7=#FRF@ GF(9FHT0#FRF GF(#FRFOpGF( 'DCCC+DDHDDDDDEpGoFO,Z@Fy8 AHTQ _ A H HT=#08 F+E]EE-AFFF&B۽U FS_(hS6Do ZlB@H!FTG  Eo FFF#[lH7zP!T-F #:F)F@ H!FTG H7bF(0FS EFL0oFZl 0 I(FT#h5LF8!kF"F , _o-E FFFD[l "0+%O --&FW(S'0EED0F #:F)FFG@H!FTi3FQFJGjF!PF+H7K(FF ;FoyLp FFF7j0H7 p1F(F0GF-MFKHFF7FhFO 0FSBغ!AHT#FZF(FMF=) Z,f*!@FTJ GF1HT ocl+=0)8(Fc(FFH%)FJI3H7NF`Sc#D+F0FJI (IrIFHT F  HT3 F HLFFFFGFF GpGpGFFFF+F1F:F FG0+дpO0 KS pGhx *pG3`hFBhHTK7G-AF xF/+ FF}{ñ#0(FSFSD*FHT(o# }Or!iSn)FSu HTBF IT+F FfhG( +h;`?GZG_sFF FF7h!T( 3F)F FpooF@h}hz iw`itiqin jk`jhje F@`-E# FFhK`xF )F )#) F+R *#k`44` ) #*0,IF+"\ *ѧ(`X#E(h3#0#A'?5?AAAAAAAAAAAAfJJJ JF&hhn`,|R3"+FRD"("FH $ZJF}H FFR|F FRx8D"F I HSo# }IS2F(FJJKpF%FhP`hMUhB Fp@C@80F6hsF FF"!caa#2F1F#F(F( F$ Fp-M$ FhCJ 3 @K#F*i(hMF(mЫF:H6F"[_E'+,NF3HSIH 0F\F0FW,K (GliEDT<#@{$h@S!I@FSBFAF0F(0F M-ih1W< R(F+FW< RFDF?hFQF0F(0ih HS4 gfff5-K@K `K-AFFFF!"e0#s 0g``#v(FRn(FR a=# "iTH/!(FRx(C3oo oyiEpFFF HS p#a!F(F F uKFF@"hFR @"iF^chXBXAFh@O3 QiXBXA< S/pG0FFFB"@T!0;`<<5B0D0`W?3#D 8`)8FL#h+"(FR h8 4oh+ pGB 0 FFh FFIH0LمFIH;L؅FIH޿PLڅ-M F9`زF F4Fu!K"I"HBFSB #D;` FHS--)FHSo% EO3AFPF[BFYFPF O&(RF@F PN obL^LjLtLLFIHvL\مF  ":I;HSt8I:HSph!4I6HSg `F`fFlF;F2F)F,HSQ'I+HSMhw"i"I'HSCbiI%HS=*% FIF HS0%B)F F*FIHS K+% IHS5 +!ihH R@9@SjLLLLMM.MDMQMaMyM8FF#h+O0`h()FR" h8 4FIHSمFIHݿp؅FIHӿRڅFIHɿL\مFIHNdڅF2SCK` ~H6 @!S2O@U8H6 "!S}80P<@4 ,DBH4@6 "!SiF`UUH6@ӿ"!SUUB-AF FFFDDFE7F(GFB)F F:FRB<s N FFF1hX1h+F F/F FSFp~#iF3] KhFB GHH F,(   'Vl8 pG-EF#V+`3`FoFF(ހ(@ـyH6[F/Ԁ8FvIRF`#/pp'#l /3#mkLQF8F XQF8F F8FS@ (d({(@ ZHS YK:hBXHoVKlUI F F(As q8F@LH8F\JH8FGHGH;+ {E+Ѹѻ+@FJF>HS@/@h**`D3`x## F ( fe e!o:(К_:!8FQ0!0S =H|o /?:l+9cl+?)"0+$!hHR! hUކU'Vq~A rB#r B5VPVlV-EF%H FFF6D@!SXF#3`;`"HF,OR)FPFQ0`HO0Bc4`*F!FPF;`Q8 Q*:`1h HR~0hO3*F!F%HVVV BB-MlF l8FU(W8FlOO CF8F(JG( ###9F(FH(8F(F 38F(N3 L^ETKFtQ;I*hKB@3`5`" K*hBh"" `oH kYYYYLY@w'VF FF PHR ) (0C#* CC+ Cc+FH+48+xCHq&p6C#r&CCs&ScД%0 $p"zG'B "&0 GGB B'0 GgB b:DyB:; @D#|C #C CC c;D; @D"~B "B BB b:D: @aD`6C #bC CcC c;D; @D3`) (0C#* CC+ Cc+ohiQ#D;RB@D1`bZO ]F [O QF `bBhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFi5WpGpFKF*F!JQ kP c51FF F(F6p#d#bo oy FlFB k5#bco-AFFF@FFAF8F F5U*hBAAF8F`"#1F F#5Q+`o Caa 8Fh3`h0`iB 88`pFF H4#F3pXxKhQ-(FQ`0pp`h^sKh(Fh7F ?F_(` F07(`iB08-A0"M"L  1F /K\CBkh+ 7D5TJI( "AFHO O3BF)F# (@^^^ pGp FF"!e#k#k J#Fop1F(UlsF FF!"FhQ$OB"`F*FpK` ^𵻰 F |عci i#fiF0FFu/F:h1F F"KX`W?+;*F/Fo"O1 Ft("lkO"!lO] #")FO( IOF+ HO(O.d(o ^@wKFK-A FF7F"!0F#<j1F J(Ft.F oAF(Fc(msF FF!"FhPlOB"`F*FAp-E$FKFF  BFIPFP"!F(h XhF :hB;` oo__(H F38(F"!P#F JF8+d/!O]`4"FbkjUJjJ!+FJPHOk(c o 0F7#b0F(9F2EcO6 _^oydK` _F F{0KFJK` [F FM( F]H)F4KHS!p3P;FOq0FJP H3FH3FH3KJ(F-F;FOq0FJP L#FoXIA_%IfG_ކoyP_-Miư F+b4I0FO 0FOg50FOcp(U-I(FO(F,IO `iF3F" FF(9#Fb#H3SFFO 5p  AF0Fr;F2F!FF2xBmCeo0FOdd(o ge#e(FFoo`_j_r_I!-ACKܰ"F   #$!;JP :HF !8H3Fع6H3ر!FPF!3H"!0F ?F@O1.H3(o F\)Kh(d%H3(O+l(cF#H3F#I"H3(!FPIFF@FP!F8F(8FOd"!F @!FH3ne(e#bmCeo _w___H_F~_oyI_8mFCie FY_(( F8@K!F(F8@˾-E?H F!3HF i=C((bei(FF)F FY(O#l1F2"# k4(A ic@F-;khi !%JP*!k" O /! O#p@FB($@Fk"km3gmm[3F2!J P! X(o=l H! H3F3F2!J PH__HI_FFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-E F!FFF E!F0FE)FSF:F%FEE(x,h?`h?AQpD532-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFFE,(`L#9F0FJDh#`# `-MFFFEd !F(F S+ +"9F(FDDIFDHP,O0F1F!F(FE< F ;FR (F {+ +"!F !F(F $DF ,#F#FRK$!q"FG F DO4O E4BF1F??F D`-MFFFDۺ ;F2F!F(F MESF2F!F(FD(F FFFFDYCF*F9F0FErF, FE2*FFIHPf F3`7FDEFHPTH3F$ F0O0#F!(FJEEFH?`;M`[`-MBFFF$ F!=J(FD~OFFEAF(FDS#[EBAF(FE6O8:FCF(FE EF'HPTFAF(FE(?O !F(FJE`8FEFHP fH6 FJbHbH2+`H _H@@FC\H,%i-BEE WHO<`ch3`hBSBOHAF(FNO1(F  Fd(~fcff=HO\cl"0+!h8HOQ ! h +3H!FOC FC0Hch B-H(F/(r" !)H23 F!(F0 FCj(\(FXC^8chB?w!H2F(?B~e]edBd e Be3eHeeaeqee5fcWfnfwf pGFF FFl( CHOO5BHO(F F((=H F9(;Hle(FNU#D+F F5J6I F4H2* "!Od(0HOl0B#6ӱ" FF'HO~ F(D:F!HOp/bh!F8FM! F60˱0c`!F8FM F  Fs(%*FfngfffFf gKggFFCp$%F"DB * e9FHOO0%FPK$ 4`g-AO`#!FFFNFPCEAF8FO0` 4,`-AO`:!FFFN}FPCEAF8FO~0` 4,`FJC| `@ @BgF JClH+ h 0O0og8 FIFD*F F8@Cy8WFJC@0ò #p#O0*tFJC,0ò #p#O0_FJC0ò #p#O0?FJC( p O0MFJC `o( ` NFJ`FJ57FFJC(` "`0FO0g#FJC h #`og#FJC h #`og#FJC h #`ogFjFFFFhjF9F F`h0 D9F FxD4`+`+F2F9F F@oFJCV `@ @B-7FFJCE(` "`0FO0㱆-EFF FF9F8HFO|)F FF(4HEOo1HOk3F)F0J FC3FF)F F-JCFAF*HOV)HOR(HOO#)F F&JCF RF9F$HOB)F FFRF9FHO6HO29FHO+)F Fd`HH]O6B HEQghh;oH$h0h8hLh]hjh-AF" FFC`FHN IF8FNm8 K2F)F FAPHN~IF8FN\K}hhhh#-AFFF0F)FwHO.uHO! FF)FqHO.mHOjF9F F(`0F)FFhHO9F  F,)FFaHO}9F FF)F]HOrgVHOl)FYHOhbQHOb.aOs@"9F  FW)FFLHOL+.}9F  F9)FFCHO8BK@L9F FF)F>HO*:2HO$>.$9F FF)F5HO.<)HO1HO `Hk-HO-.#9F FC (F+ HO.9F F()FHOHO+*F1F F1F K@Տh]hhhhhhi$i. :ihi_iMi-A!FFIHOHO! FFIHOHOI FCCEFIHAOwHOs& FC(F+! FyICxJ#)F FCFlItHOO&9F FCs(F++")F FC2FF]IgHO2w)F FZJj>F)F+s")F FC2FFRI\HO)F FDwFLIXHO.^KHO )F# FSJCFDIRHO.SCHNOJ#)F FCFHNO#)F FCF:JCFH)F FC(F+->F)FcHN1FHNI *HN1FHN&H I $HN1FHNH+1F FJ1Fj{i]hiWiiKiijhA(jA;jSQj]eRjWgjzjjChDpGF FFF( 2F Fh)FhG Zh`O0-EFFFC(F o9N"!F(FCF6HM4IF0FM!F(FS/N!F"(FCn"F9F(FCh"FF1F)HN ' %HQFN!F(F#JCx+ hSHNHO!F(FCA!F(F) W&?RF3F@F.vNBN0FM( N N j}h-kdkJkWkakj kkj0F F"C)F F`")F FC IF HNr 0l )F F@kksIFC CIFHNR p&)FHNJ!F(FBo(F+ +"!F(FC1FF HN0!F(F6(HN&WikkF ~0XBXA F 0XBXA F 0XBXA 8F FB1clh(F$!FCFйFFJ(FC#F!F(FJC|(F IC'(o F8ooo)oIggW FIFC ]9F0FJCOF8F#!(FM1FpD`F)Fj"%FT9F*F0FC^F F!o iK0FC-F0 F-MFFFF#MCO \Eo[FRFAF0FFF0F(B  F,F F8 FlFF{ #*F F(o8o-MtFF| _ h h k+JR#H:FYFNO18F F`FYFHN F kF8F7#F,.YFHN8F #ڣHKo!F8FB:FHN-!FdZF#8FQ"FF8FB#ZFHN0!F8FJ H!F8F (Ho H !F8FL0_BF!F8F0q(b"!F8Fj(["!F8FcF(S-@8"!F8FXF"!F8FB(@#"!F8F:(@"!F8F2(@"!F8F*(@ "!F8F"(@"!F8F-#!F8FL$Fp)F@F/!FF*FPHNo(-&-(!F8F+YFFH*h-!F8FH$YF>HNo+Qzh-:D ГBҹBYF2HNo2FYF/HN#8F!F ??0l(dѝ?0 +_Ы+\-#BDF  FF 2F+F9F xYFHNo䵅(;lJllmllljlMX Bm%mGmlmmmFVF-0FBHB1FBF8F9>F-ѝ?0H `! ` +?S +F `H.&B-nml FF I:FF(####9FF F P-MF# F *rhr@,r FM(#!MF(^F"+FFB#Z##)F Ҁ(FjJF (FC/( ,€@E4kh+DE/aHN'o`  ``08F520FO2TFO' CE(CFDJ (F"F(FB##Z##)F =(#5HNQ,#! FMF#;#!F(F'JF (FB#DF FZh ro F  F (HNo sFFC?H N FfYFDXFC/H 9FXF( XFC0'JFHo `]e3nVninnnFO#h h"hHM^( FnFF (#hKh"hHMJ F nHpG-Mh F "l+lB @(omm-II`h6(F(F FjFF0F!F(9I@F_F(>M(o*FF1HN^0+:MJF@F+Ix(Fo "(F&IMF(5)FZ7 MX@F0GF( Fg7/+F!JNM*I(fI(RF HNVFnn"on0݅n,o7oDoHpGHpGHpGopG(opFF "!["FIlIl"IlzIlspIl l8IleFo0Fp IlY IlMa(oooooooK`#C` p-E}FF|  FRF!iN WCF$?miR*o }2L)FF(Z@FTiCihDo-#F"0Fid(oOr!F8FL@F/ihhD+-#F"0FiA(bx *O0@@* :aD #xBch 1oooŰF9FFjF`- C)F ;F0FJM FEoo8FF FLFر FIm F! Iw" I HL5 K I(F F8@Uo 8$p0p ~;p~Cp-AİhFmFNh,h FD#h"HhLF(90FI3(h( BF8FIF+h:FYh}F+h8hlF((hF(8hF((F[pFVpFFFG*pFFT!MFF HM!"Fq(FFH$M FpO4\pp-E8FFFF 3XhMxa:)*#)( "I`h`hJ+  B HMO0@!1F(FT8 #KBF@sSF~q FH0A!F@ָ:FF&HM F(-($(>!H"h KBH  F H F H FHH H FhHO1 FH F F( H Hqq'VqrB r B1rIr]rtrr*FF Kh@&$!W$M4BF0F~sF F0K&`KHhVMkF"1F Fp~rsF#M FLId2FaCHspX㇀m۶X㇀*̿XhHMoy"iF KMHYHV 3]u%u-MFF FFFFU;ܸvgI`hL:F(@FhMWYFFhMRYFF iMM9F2hFCFZHM(F1h&(ISF"FAFSJTKFBFFRHM` "NIBF`hLF(?ѠhMFF(F4`FHMl"DI`hL0(FV "\v'^-AF>+ FFO0" Iph|(ChbB-hKB)FF3A`G ׁ0F#*3 OCHM?0 M`h)hC()h`hF(`hMv~ F"FHMwF#H"M ]wp@VHk%F&+lk1FRH#kPH#*lOH6.!hKHahJHhIHIHMGH8FHL "DIDHMNGF(_F@I FM)FjF>HOFOF h>#J+``J#``8   #sF F3Op@FHMy(FA:HMp @ Fp8.iF0F:kF8d$A HMZ)HMU>9{ |{|Kh`Kh `pG  -EF 0F*BFFJhDB"!F(F>8O1(F/FFpKP`BF9F0F<. K`<*F F< F><K`N    -EF}Or!o:ON  3lE% ql"JH)DL0F(rl*DQ||C#||CCSc AH0E`@H0A@?HM?L F }!ML ;HM:LFPFAF7HPF2%F8#HMl"HMi"L$ Dd- EQF,C@F7@3F2F!FxH F , F0F;!hFH0\FO1BDd! F.FO2AFB\!F2F8F>F00FU LF1FF  x})}L *-AFFO4 F?F0 A4HL$,ШhM/KFB(-IhhKhF8A)HLc$hhKJF"H"IKIFK"F!F8FLF(O4(F!F"@FLF(!F0F $ KhB9F HL$ Kh?}r}z}'^e } -EF##MT5"FCFFF|dKh-H !L2HK#BF!F0F0(I#0#As"F1FCF8FB~t-MVFH)O,hB TH<J:FHK@;FLN@H  V+ZE HLVE$h~oy{T-~s @n0<~ pG B!Hz8*8FF IXhK@- !4`h 8! F!v~&FF7F- 2F9F`hx-+ IKP I`hKHahHL" '=4&v~y~|~ *  -AF>+ FFO0" Iph(ChbB-hKB)FF3A`G 8ׁ B!H-Eh,U,N-M8<,P kKiJNPFO< H+FF2BrOF4OO(DFFErF~,FO#d CD Bb #h#HLp8  ףp= ף~hK-AF>+ FFO0" Iph^(ChbB-hKB)FF3A`G ׁ*sF+ F(HL$ p"phFL"FFhLOzr K `jC H# HL*FIHL O0|?-AFFW I"Xh@hCF:F1F(FFA`GO0pM,hB#HL pHNL(HLHHLh HL HL1F$hB!lNF3h+HL H/FH!H/>FHhH !(FF(H/+F(0h?(0h{8 , ʀဆF*8F*IXhKLX %hB(F 8-h "!hhL#F hB HL+Bh3(н8@O03l''NF0hhB VF-(F HL F#S```G` F$hl? H F!/FH/N FpzIʀ*FFIXhKNF$%F#  mW%>#5B a %T"Lxx+O0]-MF FF (hB=-(%sBHA(F"ɲH I HLx .D,D+F2F!F8  U pG$-AF FFFO!;F2F)F FFAF F(F*-EFFO4 F_h"8F/IKF*D*6ѠhlO:F#T#c9 IvF(4OUoBOH HVKIFXFK~"IH">#F;q F(FV,yhRVFM% XPㅀ %F" F!F*FHL(F Fб#FH"F#h:F)F0FB(FEJKBF FL(  "@!KkK" !K@kCh)j3BC`pGi;BC`pGi23abpGj:;abpG0F F8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF h8(7iroF8hJ(` (Fn H#h)ia 3k```#y+"#hu℆愆 O1F@k8 HS#H<0O1hH# -AFFOVO'hBh#(FAT #S``,I>FF=qFP&HK F(F + "I Jb F%! ^F FMO1 AA NF F(FO2 hFA+FQF8F J.i(dㅀ X.h m-MF)IFF"CF!&J>Q%I>vF(;F=F! FhO1 AdA FP(F,L0F( F O2 hFAn"F+F9FPF F((F 8FFdㅀ X -AFFFFFJE,O1 FAD)F F1FJT0FJ(DO2!FA+BF)F8FH -EFF @!FF(Z"xhF:@Or)F?F&?xhh;F(FOrA F=;h;/+@"(FIJ(FJO1FhA DDa KFO2)FAy"Fh0FAI2FQF@F KpF(Fl0Fi FLL 8F HJFH8F#(FJC( FFK =-AFF $!F'Caa 5E FU JrFPU#F F 580F F$7FFoBF#FhB/L FO2a#+KhD#b(8-<! " F3F/F(<&FVhB*aiB)(F9$"HFK*(F@F(iXiGF(F4"HFKJ`(ѱ%a(F99F?hLL PcF7H!`CaTF K J K Ih Kv K(FFM F0LtyvE -M! (FHOa !`8 FVO8F  `#a%}%/0OOb)Fh%`**F I8FH:Oh.h B@,h% F"JKBF$! FOFaaB(F(@𯀅KJK(FhKIFdhJByIS'7F(@O 8(@vIS'7F(w 8(mmIS'7oF(c 8(Y ! vF@! pF(@F< F"S'>Fp@F_F=.kiB6(FX/W#h+7 h hGF7-@ Oa 6F(?VQF0(F0;JCF@T(7G(OS RCF$! F(-Caa7`"##"## hh G77Of7HZFCiGF7(/73H(FOXFKB?/? LyEx໅E!F(`OD7"# PFG7$ B'"AF0FpKHO E@/?(F`(9iKjJjK(FhiKiIF-hKEOc7ZFPF0GF7/+ ! WF PO1FA Iع8F~RO7hG7~(FA.R0Fn/Z#}+?'SO2 PAH0O2?I PAH8FMJ 3 vO1 P\#T#;q<``F(pV*0(F-Jh$F(  cV#!3Bѧ OO1h@B(FFBhhBh#p#h`chS`#S``U (F5F6h O/F具yE΅ vㅀE*b=F8 A0HK .M+x+3-L-I h7eF('"h)I7('I h7TF($N1F"h7(0hAjhIhGJ;+`H#+p6(N!H@F(KIK2hKbF F<KB O0?} ( $ ⅆÅyE#-M$!F F F(ڀF9\F F<|hph.F(̀9F/9F F9IF8F9  D F<`O1k@FO1k@A vFHkO1(Fm)FF@"%sk 80 <F(PF"EI=F Fk~pk{hx0ju < < 8F<@F<(F2F F2IF(a F/IF(W F*Kk*IK(L*F F'K(IA(B*F F$K%I7(8"K#J#K Fh"KF+ KB?ODF M F9>FN'FIJD=H-lF (;IJD:H-bF0F(I0FIt(FIq(F)F8"@F(FIf(F8!@FBFAF)HJ8FKF8FJF9F$HJ=0 G!HI HJzIJt FIJoH ~_JL]_ H!H&H-H39BIU G䈆@wv* "!XhJ 0 $. $."$. $.2$. $.$.$.$.p*FHJ "p#h`h Fh48+F2FahHJ 49d$.$.t$.0D<F MB  4B xH+\0F Bb1-AF8H F-)!J=F!F0FF1H %BܽA-HO7-*H0F0FI5D0FI0D&ѧB"F1FAHJc%HJ_,4lgBHAJQV%JHBBF JG5BHJ@ OBH KbB;Fq]F HJ15@w0oy܆FFHJK!F`H@-t“,wf-M*FFO4K"IXhIF(~ѧ FF%x-+!JF/9б-?0F>c+ q+'?+  8%-l0#$ Kh(EIHJ F)F~H-\}IF>(5uK1FwH`-l !J0JhB/FmHFF?/(?<FhHJr"fIhhIF(;/kFhJ`@F(!FhJ/FChF1F?r? FPHJC!F(iJFFBhBJHJ3u0F$>N3hEHi"DIhhIȹ/"h0hh>x?FT /ZFQF*K0h?m(?F'HZFQF0h>FoF!HH#(ix<+WEK)x>)ЧBHrQ4X$P;͆,Fwfړ 8T 3, >"(FJ*x?* 2`23Q))FH+F)x2 )Ъ[+*0MJx])F )14X$0BS\Dx])?ZJJ3 CF{MI(FI|S4BDBED7hhxg+@#/!/њ0s+)i0h >k0n+s+H/F!F0h> !FF0h> 0Fn+/!hiJFO5{BݓB 5n* ]E !F"0h>MF@F A!F0h>ښ0s+@Fi-!O;>HJ!FZF0h>cF(b)`ۚ0v+Q 4I/ "!iJF-)F F-"h*IJmO6. FI,7D FI'0>DBܻ!F'.۵T& - YGIJ>7B1FHa+F@F- s+RF>FHd, 1򅀺oyѕէؕ򕆀p+#l+@O//hQF0h> ,D)F"F0h>F`"FQFHJO l$-(!FHI(FXHI")F0h>gEF pxK)FIH I4,݋H!JCF+RR#ۀ܀a܀܀܀܀܀܀EրvIzH I,?c~ ")F0h>AhF 0h>khF(QѠEfIjH IEbIgH I cHIZIbH I}E_H1"^IHh0h>U/0h h>(3>&FTH?j()>FPH hhxh+f/ѫhxg+$IN)iV H4 ,}X$h AH PI-3h>HZh,FI%3h;Hh I3h9Hh I3h7Hi I!F5HI3h4Hi I ,3h1Hi I 3h.Hj I,3h+HYj I0h>QF'HI&I"HpF(H/㫨hI3hamL? Ⓠ06=:ER ׆fז*AXo"{IhhHFȹ/"FhI"FFh!FIBF;F0ht˻"kIhhHF(]ѫhxp+'0h>FeHIddHIaE/AF0h>>F]HܻAFZH2IFa+"FhI<"F F(iAFI5:F#F0h>5(>FIHd+'FhIF0h>L(>F@H̻"?IhhHh0h,(?ԫ>F8H"7IhhHFع//FhI!FFhI<0hO"F9F0hF'I"hhHaFȹ/ժ3h+?hIo(?0h(?I"hhH@F(/ШhIQF0hyv./F9r~ėޗc좆$-M$-f$.}$.H$.=..O-AFF")FFFh*#h)ЙՆZ #h##`1F HI7#h##`)FP#jF8FiF0iFHI'H-M*FFF@*^h4"0FIH(IhHFO 4%h"0FIHF(p+x+%2 O FAF8FM\O 4O UFO TAh"FnHIFF,CF+(H\F=1F(FHpx!IM#F1F>\CC"F1F,4B=3xs+c+i+O4t+&"(FFbF)F>HIj!F8FF F&&&6IF02HIN瞹FTF)F,HI@_!F)HI9$..F?_Fذd !F$$HI(_FHI7$B H-?{(FX7.$7t!$CYbំ*-AFFW I"Xh@hCF:F1F(FFA`GO0Kh+H :o` 0FFF. 8F\FHI  FhhI>FFHI!F8FF(FH Ġڠ0jHIr ]7F F@+F"!F0@ro0shFFFFH.$F"hhIFH %.ۮB ")F )F HI545- @ pO6 ;Q* X0lHI$O1Xh!IFF HI!F6 F@FHI  K`Wj}0FBhlHIclաlHIHI F&hChhRhHI矡*6 &h,<,3B  Fj!XhIFFF6 "F(!FHI ޡ*sFF(!XhI%F0FIHIu$. FhIFMFH FQHI] FpO4u]*sFF,!XhIiFF0FIHI=$ .FhIFF( FpF(HIO4u]#\.*D@x08pG3+O0pG-M*FFO4 FDKBKhAKhAKhzF8s$1FF:I;HI$!FxhIx!FhIsFh(Fܸ!FhIeFF_F/(')F;FFFF)F$HIGEO!H =DGE C K`K`K`KHI ^*H  HIpdHD@j6yv]*-AFO0Xh!I!FhIFh-(F!hI!F iIF@FHk;F"F1F?(FIHI  )F(-AF+FO5(F!phI!FhIFh(F(FF@{9FF!hI!0iI!Fc+ #NWF0B H1FFIHI% !-MFS+FFM!phIM!FhIH!FhICFh(F@F!0iI6F8FF8k)FgPF:F I!HI|'8FFF!FD E ЫhC`#LF(B H!F IpiG(ѫhRF#`!FCFF(о!y~*-EFO5(FXh!I!FhIFh (F(FFs1FFع!hI&bFD!FHIFF'D;+ܺ 2FIHHFIHH%#!F F  @F" 4FAFHH)o=-E*FFO60F@K@Kh@Kh@FEF@{Y9FF(R8I_h!!FphIA!FhI<Fh~(F,+HٲH*H :%DD K K` K`, !H"H !HI,F'KB#F)FF(Ѻ%D)FHHO#F)FaF(FIHHA&{,<84!O]ViH S P-A*FFGXh!H!FhHFh(F7@FF8k )FF8IHH !hH(( .F i!HF+F9FFIHH FHOztO0!x F**O 0H`,,xhHT,O3$@ x*+!0HC$+Cx{+0FF;}+# p++FpG pG-MFFFFG'F4Lh BF(F!hG(T hGEOeh>PFF8FF FG-G @ 8 (Կ  (̿  C1FPF|1FF8Fw-! #XBXA  B  BBB  4\E)FHH Ʌ*FFh(F(3 H } (hahho#O0"K`KhK`pG|ltKhK`KhK`KhK`pGhd|xtpKhK`KhK`KhK`pGdhx|pt @ O0MFA`)FFF(`*FOa/hϱx I(F(hFHHtO6$DDMJ3FFH) I8F(F~?0F!?Y!F"F HHP!FH+0F Mm@oyEJFKh#JhY`ppG|t#I/*D?pGD8 K Mh,L (8(x < -M'ml FF>FO44@#F;x Y _PF kgܺxкu| QhIF B8F ?(B@l'''''' ' ' ' '#3p##'spY#pp7qK 0x0qsqqB!Kh!Khd'  OzpG?&"KH`1F F2F1FHH1FH+c!FHHzK`$LcPhdtl~JFT*-MFF:|pKhKh!F K";F)F"F(FF\ K5D`Kp`!h 1FH KhD1FHFO0 l*L!XhH `!hHH q* 3: FF!H u]O0pF+F;!hHv!FhhHq/F!hHjHHHGI#F&%DB$B1FHH GFG,h@FG'D #FG!`U4O0ﾭޱ*pFC!h f@!phH&!FhH!( -#h-#h-##x-#FF*S:-#FF*S:- D#FB+#FF*3:O0p FF-Kh-Kh!F-HH2-!!h+HH,*H (C((O!;x-+.kBD!h 0`h9FHKhD-!hH-!H!xH"HHB K` K`- `.,D-- p .+FHԧ]iڧ৆*F O0pG*F {O0pG-AF+F-!8h *!xhHMK"h!DhHF !hH=#F8  -`+D-- pO0 *-EFF&h S!`hHM!FhH !Fh-hH( H   x3 O0槆-M*FFZh X۫+,JO`hR#G(O!;hhG;h! hG4FF'E$-#hhBЦVD8+F"FAFHG$BF9FHG F--##xb\绲,D L7O4$.8 FBFB HGcAh)@8@HG¾HGTc[-M*FFkݧKx[x4 50KxKKKKh60KBhhx40F7(!FkhYx.53ШhG'òx-+;0!G_. hG_x-++0!G _. !(iG.6!hiG"|I FhzHGEO4 FF40r+i+m++"mI FF(@ԁ ػ @ȁfHG$w+$.&$VF_OB$\ 3!F 2(*!F20 30!FFOK!F(;F %LJLI ,(F!F GHG4Os2F60)F 6(02F)F=HG$6^ESEE8HG5UE*#K4 p5 Zp!K` K6 KKK`K`KSEE2F)F$HG6#HGFF$2F)F(2F)FHGo$6^E605UEFFꆀ߬⬆Uosޫ%Tms#2F80)FwHG+)FvHG'1FuHG#$6^E5UE?oFF80#6  @C2F)F80m(eH$3FM8*F_HG#$ 65ZE kZHG3۲SE?4EFTO;;xCE[EC3\h*FLHG# ;BEHGGK7B # ~hDHfs@Gr*Q@)@08J9N_2F! "5HG-HG 32J*))F0Fs.IE-KF,HGu籈E @)т)F0F + #I$J+F))F0FI# l"I F(.8h34栬IƬ%@ą+ąU/whU{ꆀsFFF"GFB0`x-) PRxB"!G ` p #`O0-M*FFF@G[hxKh Kh KhKhKhKhKHKFphHxFp(1sh[xx+-Ѱhkh 3ChCj w-[j+hr-яH * #7w->/V'!G?GF#r-7/ V'.!@FFLF(;Р ZFAFF h  # "TƸӸ׸joy긆?"*@UeubֹpF FQF01F HF$ Fp #` F( FZ跆ڿ:F*d&-E2K!h F&F2F!FH l,K,J1FF+HF&K`i0+9!F&HF8F!hhG@!F!hhG9!FhG4(F!HF'! FF!hhG!!FhG(F!hG! Fz(F!Fz HF_O7Fyu9R*F Khz@ * !XhFK!hGO0 L! h^pH !h0{+ H  爄t*F5Xh!F!FhFOF!8h5Fh#F2F9hHF(F(HF (Fr"F1F'F K JFBF HF` O0yuFں*-AF?Xh!Fe!FhF`!FhF[hF!Fp#F2FHF(F(HF (F;F"F1FF K JFBF HF` O0爄𺆀yuF pFK!hFF(Ch+HFd$ Fp.!hhFF F<F(HFQ.7Q*-AF5Xh!F!FhF!FhFXF!aF*F#FHF"0F)F;F"FUF K JFBF HF` O0 爄gyuF L h(u( `!$0q H e BӀhz;۲+ J JR# Czi HF ]F"SBБBh2ж )p&FhhBp#S```F` L(F-h8(F J FR J IhFFrhF_ `iFHF  ж f[ F"Fs"hxg+K+ M+G+k+m+щAQ2AQ"`AQ-MF# F??`vBv veHiF0&0F QCBA+z]H;۲+\J\IR#hjzFBAҩiWHF iz(zeF(9ib8m(aIB+zJH;۲+IJEIR#hjzDF9iI&)+z;۲+g.KRFS&IHE_F8` HE.` I†h†ж ††-MMm,h̹K"`[`K!FH`[`@"!FH"!FH #J+`pH(FFH(FOr!"! %")F D&IHN0FD(ـ!HEG MDM+xIHPL FDOqH,pHE,wO;x O ́h@E+#;p#`@` xS+9Ѐ"1FgHD[%1F8FDF(bHx,@+@V m#S`` (F-h  [F*FAFa8p;x=+ YHE&IM(hhBt0-x7 {ZFF(Fp(ю,!#8F#DMP0 AH8FDI RE F F7HzBQzBh=-1K1IS%0HEy! 0#9F#P 2D# ZD<006#S```F` F$hr*)Æ?†Æ†ÆÆĆ,Ć|ж LĆ3FF "(FDI D 5P' x/8:M+hBC9HE!FDn(Cѝ$0 +F3H(q(W#F%FZFAFF`hzYz(F=-%K&KS%0 F%HFE bFq0`s``Or!FHD*hK`KpH FID(*F1F Fq( K` KpiĆĆ?ж Ć)FF -HEc$ Fp`h 8F( KP` Kp0hz:Ҳ*KIS"Bz+FHE=Ćж ņ-M*FF)ѝIXhDFFH1FH1FH"Kp~ IhhDF@r1FHpi(,tыONzH ;yH 8FO hzBz;۲+X#1FipHEoHEZ_UE$hkjYF####fHhE  -hcHEc+Ѐ`I"hhDFO0dh  (nXK hBѩhTHEaa0zBpzB6h.аiDFhDD(iD40Dhi(D(4?,AHE99ki@H)i+FiHD###"ZF(1+F()52("FAF0FJ###2#asa3a/S#a1F(F;KIHFD<$Tʆ.kↀ[ʆZʆ:͆qʆCʆoyʆʆʆʆˆˆʆʆʆʆyuF/J# #l#$i#gH(ѱH@ i jF8H$8F %kiYF[B2 "F8zji23i(F5"2[FBFgBFHD$PF AFHDHiUF5. <, >   HD>FkiO6 <,  8            nHD"0FlIC<(\##`­!DH"cI0FC(_K`I`HFD.!0FC+(ŀ"ZIC(@XIC###"F3FYF (ҭ(˭F8!FDBHDR"0F;IC(0F=ICF(@ ?Y!XD#FF(F(j"F1F/HD)$ _"hki4hBq'H0i DSC" F+@#",€$!(FF1hJʆˆˆˆ ̆̆x̆%̆1ʆ̆̆dž6͆>͆džie###"ZF#F (('GF*hDGBw۸*h3hRc*`H3`D}'k"F;FPF0FGIC(?_IC(?XIC(?QICF(,"3#23h52a#(F~ (F+F1hJHK,FHD$0+U  F("!4#0ki0i D0 RF[F(F:F;RF[FqIqHDpJjK1h(F[F(F\WFRF[FAF(FrkiiDD FK _Ho1F_HD0F]IC<F(ҫΫF"D'1F " DG6@(MHD+JH2Or1F8F4FB($+i [B B8O@"!PFP*iQFSB (F8(p#!F1HD]$ hiiDG$x,HDPo BW 64! "PFW$0(F0jiD 0iBF 0#0#i,BFHD̆OȆVȆYȆˆ1Fyu#͆e̆ie͆i͆͆͆͆͆ˆˆki4Dt(iii8 G6"W @۲CTYFHD+i[B h CE "!XF^W(0(F0jiD 0iRF 0#0#3RF!FHkiDΆBΆ-AFFF" FWI bChB -сh KB h;F)F0FFA`GO0 ׁpEdF( HMh,<,3B pl HF>KlB+FbhHDUj,  RF (D,="Or!0F%|:F)F s2xI+F*YF FID0FC5-1F F  HD+O0 }ODF  І@woyІІ-EF!} FF!Or +CjF i( !} "AFhDg xFBFù!F 0(//0JOq D. h< h 0#FJHDO0_І-A*FFO4MIXhC%Fȹ3+hh d(v.(i F"@HD?IhhC8"A:IhhBF8"A]4IhhB"1IhhB"/IhhBF-H-K.J%FO+OB(H(H- :!,!X$HD95#IhhBF(.ݮhh0F9F-i (:F1FHD$(F F۲r#)FHD |ֆ솀@wIweՆІ@ццj%цKц0FK~F2" IkF! hP(F +hca0"o_Ն*-AFFW I"Xh @hCF:F1F(FFA`GO0Ą0*FH'F0$ F 0*/\h! FD<(!FHCH'#J)FFHCxF,Ob I HFO4 _Ն_;'^oy-EF1HFFF&#.J cF(N*H'5F!Q((&K&IhC &O *F H( >N*F ;(H&8`0 i*F )(*F "(V) So Fo _;ֆļӕ*"H&б!C(#y FX HC FHC$HO4 _ֆ'^5ֆF KFB B )8! FF6B(F8!?-M*FFO4 F^hI0F8BF(@lFC0Fx+x+Y:+Cx+"F0CFx+ѸR" C 0Fx+x-ѸBC0Fx+x-9F0F!#09F0F 2(:F1FqHC$7F&FFF%OFCFRF9F0FbM+hdHq0FbIBn(?#XC0x+?Lx+G*h !##F(*h! DBAeFCHC0FAIB((0F?IB"(0F=IB(@𢁸+h10#1(o @#x++4 F ''CFB?x+ݮG+h1#ZD[B.?L#$(h CaEt< F"IB0(h`###Gй HC6#7׆6nk׆1׆׆׆IB(@ʀH.hB Կ#K ¿2Osb@  !( SD B#F  CEm -r)FHC$A !F8F Fd\E (\FBd(  XFFT dsHC(FB !8FF FF yMh"FDAFXFB(#DD'D9F!Eȹ1B"FAFXFg9F!,UK(FCFRMRMRM BgFNHCd PFOzqF FFHM FE3FGH CQ$<$"=IB"9IBF(hFc "/IB(LF0J1K-F/HC$!F-HC,HC`)dG(?Ю+h2FF1F"HC,HC0FIBs(b^ C*HC"FHH׆Q؆׆1#׆"؆MbG؆/׆*׆d؆_͆ B}؆؆؆؆IB.@IB(F((hXan\Q#GC#FGo^(*؆-EF#bL#hF `K#`_M)hc]HN/@pphPCXKx`:)`APCx.+0Cx@+0C `/!hCBK/`hEN*FP)С0۲ +١7۲+١W۲+ :HC! `AMp\۲CsT-K!h-K/Jh3FCB((K!K9F0Fh"h(oFع#JK)hkFhFO+hHHCFHCQ  HC6O0@Bن ن/ن=نMنR-E*FFFPFE:IXhBF&=4--5H&|F8 -/H&F.IhB-IhBF+IhBXh)HC`gi"H9F%ch!h@FC(AFH%##QFJ ^HC89F T(HC- 2F F ~  چ __چچMچՆG'^چFF F"!hFCu:hFhxh'`"#1F(F#'#`-AF )F-29KF4 M\l|hhBd d @HB5 "/U|"sT#6U!chF;+4J5JR# 13H[B@FA( HSFBF)F+HB)F*HB,  N ( ' HHBPFA(0FA(Cl F ( (  ()F FT#;p kކȆކކކ\@wF "!hF6iF F0FiF} ClhF  (Cl Gаq ?$?Os"FZ(!FHBnPކ-MFSHBb1QI@QJ F 1NIOCMHNK FBJ1SJHBD FGHB<%FOEO1CEAHMB.?HB) !=HB"߆j߆x߆ކ߆F߆߆߆݆߆F F#,  Cl 8( 3(  .(  7EiF  0h,<,3Bclj F hhB F (cl UhBIkH"( K`HeNp*FFO0p"IXhAHKx#HB "I`hA(HB""}I`hA}P-zIzHB"qKxvHBF"uI`hAe(sHTqI"`hAYF-nH(hBkFFjHB FQFgHB FEcI"`hA5F(@-ݠhBIF4F()FZHB !hB: 9FBFTH!i xS+&E+QHF; +R#qSRRR SSSRRRRgSRR]Sf;ڲ *=HBV$)F;HBP3hnA!AA]##"d  E%%"0F0.HS.HB2$,HB-$+HB($)HB#$(HB+F"%H`"%I`hA p@Q}"!F(FKp@6@wl߆p߆߆F7߆j3uPE[Ţx:ᆀᆀᆀᆀᆀᆀᆀ7ↀ-M*FFFF*.!XhB_-F)ѹh%XF zYF RF3H3FB#F*F B 2FQF-HB $OD! F((0%H F#HO Fh-@5H(DEB F1 B FX(O1XFk@HHehF- FiCJ K@F`9hO0冀冀Ȇ冀ȆȆ~*-AFF1O4*[xzsl+ s+?!phB4F?!phBF4&F/4FV?x-*)F@F(I`hA}H$ F%FF"I`hAn( I`hAh/"`hBWx+iF"d(!DH!GF(!,XHE$"m!N!0!!((%冀冀H冀憀-MFKFFHh%/!phB8/F!hB1/Fh!B(F Fz((VoHXO ]F&"F)FlHBn"hkKBjHBg  FfH+bHBS0+/]H[\HBC FZHZHB: FBWH)F F/[ݝ)K)wPHNHYF"FLHBO1 F(IHYF FbYFDHAF F/3AF Fl=HAF FF9HAF F )F1H7FB$HN0F?1!?)H%0(H%, W?%F(O5AF8F*FA/DDd)FHBO0F>(H~~̆熀熀'Vq rCB:熀B#r Bz熀LX熀ȆXMX\X熀8膀F熀膀-A*FFFA";IXhn(nh+k-80F:"3Ih[F(h+/I-Q#0.I** T?ȹh++8 bi"ihHbBF! HBHBLHBH%n0HYh %g0[h_Hp0HkB0F0օj膀s膀醀膀膀膀膀膀*-EFF_**hh$-IA;*F1F FEO.F "C;FZ#BF,F)F0FFXG?IZ'AF0 F"@FFBO F@8FI40F[ )F0FrF(O O4_솀4ꆀ7 FAKFh+IA8% F,F F0hFIA()F@(A*F솀-pFF O4 F p@("(FI@F((F@(D<}+(FAF(@8"!F(D(F@B(FAN(F%p!hFAbiF(F^(F%{d dB0`(Fa솀#-Mx )Jx0(KBF&HAo x "LDDE28FciGF4jFAF8FhG@_ D5oFHAo XF@ # 0hCE3x30F@@#0D<1FHO@d솀솀솀-MHF@FH@FH@FH@FH@ EDT5=DD%4.W0F@JF o IF% `()FA蹐HA:oI@w@`I@d!F@(!F@8\O ;*"TkιYFx oF(PqI@>FPF ,;*  fIF(@(FAH8FaIz(!F@("FD@c8FSI](oNI@-x"A Fi+nD4EL <8FBI6б]"A Fi+QDEP<8F@eF+/I@(\#8F#E<6ExY]#!F@$$(1FHAFPFh@Fo"F(F@U??솀솀솀솀솀솀솀솀ֆ;Iwކ@w솀!톀I@(#O0oІ-MF+F h AhF xKhHAO07FFhF83FhIHA I`h@L8HA(F F8I`h@?F(5Ѹ2ьHA!i>ta(F*hBфHAHA0(؁HiAF2F;|(F F@F20F/,wI`h@F(Si[ !FDD?4$?@4 nF G AF(F$?C aHAU!F(F Fxi0(WHADO4WHFA>zAF(F#F zFi@FLI`h@(U#iJJ{`JKB HHu O4^F BO:AF(FhGFxh$@PipFKh6HAO4 Fp*"`hFAF0F"BFHAo $"hFAp)FF0FmF()FHA F SF')FXhx-*%JFh3`>. (Ff+O?+#F9:FIT>)(EO5H ч$8 *-AFFW I "Xh@hCF:F1F(FFA`GO0#0 FFJ >,HAkF F 0 ! H>HAS,F чpw*FF[hx-*[xa+!<5,'&BH>S(60 C0/d)!b)c)O0%r)t)*V"O *P"O )&F*E"F!'"H    RE[xC  YFHAy "F!FHAr(FHAk"AF FF"F D B?v Hh H􆀗ކ ч3[yp!F"<,S_.x-.iF F$!o.a.f.нp@{"),FH$] p*[h J# >;@ ]O0 ч-EFF.FQ_+x-+ =!(F@}Fx)F7HA >?+f+_H1J.h`0kBF(F,I>0 0 'Z'@[70BD FF!FH ;F &P+:F)PE&pџBKW# >8F"+ K)FhHAsO0$H чZ蒈t0*FM/0 M0hh$FȱOa FJA"!FH(kh x JiF#8" C p#" O0톀-MFhmch*OF3hC;T#)FAFx?/ @Fbh+I@o5.5 D@6%O $O Ub?5(h?  WEDco@3B ##0#DDcp3,F@6@FuBȿ" KȿUxJ " m O0i*FF"O0pGKhpGH K0#0Or x3iF ]iF  톀-MFh#FFF 'F^F ;0`h x-)7!@*F!>4/HP" !V8H>f5I@ 4H s)b) c)O0t)+H '+DF#)dF+:O PFMj!@4F;LP"!H>۸9]* 8`1 H#R;F"FH@ чFP pGOrF!Vt@ I H'm{)9ZH@I ~L_ pG pGOzsXC? LFg|0?J@I`| ?HQ`| >I`| =I`| O4 FF#;Dx40F0F-@l F0F?l(`p(F1F h?$iAF`h?0/-ݣh[`$h31FH@ZO4/ܣh+#``h@F?=``@F?6,ah```SFa$1Dl-M$FF%F!8F?F๸ɀ8F?iD F{9FF(D?Z % ! F?(@ FBЦ  AF F`RFF9F(D?FEF6!0F?Op:!0F?F(ZO F0F#iF(m0FF(gñ0F?vF@F?rPD0F@hB 1FPF p FDQ> J>GPIZ>V)F Z>_Z0 D  DOZp(F>+FSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F>=!F>3Op0F60!XY\F!0[YB0F$50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%LH-TF!&F!0S'0B00F;07 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F> #+T(DBp!(F(F7Kh{o4J`FEF >;h C (FDNF(I>A;h(F&I>;(F >7 7h(F I>/(F>w 0BFj6pF;!>X0( HX?K8 ;F43+6T@w`L-MFF"!O8O %'  H"KpBFF9F HOr"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH?=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhGPPu1p1! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H?#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?oCj"K`4#|/?K E?'?Ϯ!?~EѪL  K! K##Kh]uqT8M,h\ K(``KaC`#`` 8D'8q0DZ FDS'H"(D! "?F"H FY !F"H"!FB1H?0[H? H?H"!FH AH"f!H AH"\K F`8!FH"F! H(;FT]mX:-AF "Kh8FA"O1k-)FH?F(H$$4 I,н F>FFH&!F H%F?4FBp>@F>~zlXv pG pGIK [@0pG80 o 80pG KF @8 R8 8 o 8 k dpGH0 }C~#H0pG pG 0IFX80Or\CL0PKF [hp jpll0Zhp l H O2 !HLF"`   pG pG pG pG pG pG pG pG pG pG pG pG pG pG3 yH \:"H H \"L l l Rh2"t tH R"H H tp pGH0 s#H0H0P0pGpGpGpG#HFFFh l3F+"F.F!kGJ=<0F BH;!R  !;C '@IAq[ @ A #1C _9F-Kе@; [   G '@f@@pF\  @@& @ _8FBсB H? F)F J= j  #F,д oygfff4 *4 pG pGOB80 0P[D4P@LF`c4 8 8@H0;#H03KFh"H 5i=… pG pG pG0 CsC0pG HH@ ! H WFx"_ LlH"!"hH"p ` "~$JUH H H?B hF  H?2;lF H?,H?)0H?" ]' T X Th 98I}@~T  I K J[`L D +[!8* \  pG pG pG pG pG pG pG pG0H#3#s00#305|=Ї pG#lFJ3ZFH?@tzpF( H?$ FpN4hB)F> ($hd"K`[`K`pGd` F("!$`d` F 8Fhj[kK(F0)F H?UO0 KZh\`#`Kb``h 8`d`-AO `8 MF(h0!F0=p(h8 F( `KhpG`-AFO=hB1FH> $4X?[hK1FXh=D 4U$4 ,-hdKh0pG`FFF ;FO21FjG(( FFF@3FO2)FkG 8 M H,hB H Kha8@ H1>rH>m$h8d`-AFF" FF O0Os@B"AF8F (ѽ0DA 3`+pp" ~0H>& ]O4  07F FOzp0 ")F F [8H>H> Or0B@okF")F FCH0")F F 5H")F F, HS0 @`d _i{7F Fp")F F 0&H>&H> ")F F !HOr0B, 0Y kF")F FH0")F F H")F F H0 @i#0"D*A,-Q+!A!ODg0"D BDoBg@𵣰,FF0= G$?bp 'pb 〢OB)*(9%{ #+5Ozp==oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H> F }F1FH>o")Fp$JBhF*@## 1fg0Y* "@! FOzp=1 +g0 + + I H>ro@+## f##w-EFFF%N@z#hn"A!d# F#1C (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F(o"xcx˱"(\\\3ZB+ Fڲ"pB #Ie"1+8FOEY( %9=+ )` o8Ozp=o3 TopG Fh7n&A!Os;C"#AAF(o#Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H>ro"p1FH>j`FFʲ!p#pp#&QwBH>Go$ED&1+ 3nhC$Os## "DAp-A} ?FFFF$?+o }*)#p(z#FF((#x+%O38c9#FBF0F(8B ?4B#+pBcx0##x;4?#o"-MFFF(Ozp= )F F0?@ !?Fб;FF)F FGڴ !H>0FC=F(F.Foo Pqx)ЎH>;2x *FHO;1Fp]FQ]F1B 9xzx*R0*z*> ){H>_8BxH0x[E2ДQ-tH0F%Oz1By&ok1# p F D9F" %!"&!;xDj#C&!2&!) )VHADBTHkSH hC#%ݓNHn %!"p D9F D)FHBDHhк?AH hC Fp2F)F Fy60B5#hn FA!d##!AA "FH)+H>o f gBp=( ")F@F*H ")F8F#)F "0F! #BF Fj! #:F Fb)?ۮ #2F FX\|&Lo#-Ah`FFFF0 H>D F1F(FF(Ѹ(Fd#ih/`#"(FAA H>Bp=b.(FAC!(FmF(6e pGFFF,Y(FCh+h;p$9 i(H>#;p3p(FiFd#0hn#D$##"DA0d#pA, *%)%hn#D$-DA"#Apd#0hn#D$##"DAo0pGiA8 pFnhC&d#"#FA#AFL, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>1 =^BF1F(F(۸@+7/O O4oг $$Bp=?"F1F, *"1F(FA1F H>$"1F(F2co$-MF:},  F&?(`"1F(F(7x1F / '(F:F(׀:F1F 3yx!#rq ")"! #yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/q/kѕ1+@##d`/h+hn"A!d##AA(F#A+(y(F&(&q, F(FO3c&gz 9Be۔H!0"F>B8F =d/d0&`azp a 9BQ&O 9BQ0K#0KhB\#0 ,@4S@s@h#,9i8Fac1+.݀+hnA!d## "(F #AA( :}i66"1F@F61F F/! #([H=o `D`{h `z``a6`T 9 ; g#? LJ BД ={iB11F(F ( =~;iB"#ihS``#  C F=e:iB"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F+AF(F+AF(F["1F(F|"1F(Ft"1F(F7i2*a1FH=o4p#@'9i "a pGFhhnA!Os#"zAA"!#(#h9%H= hazhA!nCA@AA H= hzhA!nCA@AH< O0IpF "!(F'@C h0hn&A!Os ##z2FAA!#\H< hazhA!n MC)C hzhA!nC)C0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA^+hI0F zD4 CD@D0+ !F(hF:O CECFFOs !FSF(h F(h 9!F"*h9 E&(h9;Ѵ E 3ЛF  D}#sa# F%0$0F j h{OzuisBp<=ѣi3H=ao #{+ 3x++ 8 @Bp#++O0 [-EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0F#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x=O0H<"F:FFi(ۓzpLF "! F`P##p0)F[cp#0#q@060 F+ # #0+kG`p-MFFFF*c FAF !-Lz0#`4P]E(!i%HjC "`*""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ ! 8F  DD-MFFFF*c+ F.F q!c-Lz0#`4P]E(!i%HjC "`(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ ! 8F  DDOshn#D$"#DAv-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)Fsss4Os2F# h]( FZO0FchA0< hfzhF&#n&C0F@F FUA1CA@AOr& '( h9ո?azZ(Ox #:F1F h ( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz}xUSBCUSBS7} %0 H= 0FAhH= Fg5 "K`pGt(H=LH!h= h(̿  @B(tT-AFFFL&!1+Eі"1;+@8"AF F'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fczzc{ z{!{)0K+02H=,1J1K1H=% +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!b!K$9(F( ?O# I#畤흁ՠp۝-MFF'L (?hSrz0 "! F;##p01F[cp$#0#q60 F+ # #03kGFP?oH=O:0FB0+єL0:+єM0L BdH=uk{+/sPF@`H< .p\K@Ԙ0"+#ks 2"I+ OO "^ (Yb "!AH0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO ! "+H%##p01F[cp#060$H+ # #03kGx "H=shO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@ -EF , !FF(F8$  F)0h'hn _A!Os#$?3zAA#"AOBؿFOȿ;F !$J=,#Os0I, }#6F(Y#FCrr1F(FF+030SF( I.FX)(F#F(7Eډt)/?h `pGopG-AFFFW OBoT >DF1F;q(< ,`o-MFFm(}){Ѓj+{h+VOFh L t#i FG'FW ?hBѣi+Cbh0H (+%jB,H<biJS # K+F-hS GU ]F;(=kh 0Hs ?' F@O9F0EH08FFAHOb1F>S0F >H<OOO1 F&F6H6I F1hF F0-(F+}+"9F F1jFF*H<9F Fa0'H<&9F%H<9F F !H9F F($+"9F F(QF@F =F(:|U㇀⇀;~WNg"!"FFy|ZhhBQ`Dy`t` nh*" ` ) )h*xQ)" -LQ[(O(jQD`q1)  TXHDPLYy[)QD`qhQ`Dy"t0(~(љy19)T!5ϱ55y2)0)ص~("`!F`" `" `" `|" `x" `t" `p"`(l"q f-AFhFFF{<8 +(#hBNE @F;h;;`HI#h;#`+x h + 0D<#h#3#`50 `(x[H,#h;#`}!-AFFi)Z )FB chT)K+BZKdPj+@m!h)fhHv2F)D `(D; "h1FH*D+B #h;#`#h+"chTo #o+phBhB\#h3h+ #h;#`B>6 A2F)D(D;k"h1FtH*D<  >ch;c`hAhBkJkH< ch"h;Bc`خhAhB_HF X6 S6 N#h;#`#h+ah)?U6J7H< =ch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` +'KS!`.#h3ahY1F(F;(F; !h``BjAj+I hBH3h`BĿ#`BJR#` N #h;#`JH<8 ch"h;Bc`oyiii{hBhB"T@i;chjFD#h)F`i(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D;;#h1FT"h H*D<#h3#`>? #h!T"hH*D<-AFF FF;m"F! FP#%a#s`~F.D#hah+B yB UEѽYa`T"h!H*D<#h3#`-A0F FFI hO0FJ`J`J`JH`J3+@+pB# `8FOb)F# F-0.0! /4'F(+x sOñ!+:htK)FS";;h3+̿3FF;`iKhBkJ`h3` F:hfK`,;FF;6fF(;BAho;F8Fx ,FWdƲ ." .YS&ѷK==F..*.2E##7H#p:`#+pO02H0;!F(FF+x +Ѧ!F(FF@3B 5 .#8F#pI,DKD#3k3s3#` 0iiii!i}"KFpi-MmFF F;#FF(-#o F FtN8F@1F>qB(F@$ F1F(F> wsB/D@?;+U<<#Cz`;DZh(FBZ`U<#CE<R&T#D#CBOOC ERD#[#E=F<pGۿѿǿFF08(o pG pGHpGnF OWHOB1F@H9(F$hLn8F0P! F,F F8P"!F FhKHldH3dd `  `oLn!K HddpGLnP"!hF I9C# KhF K K K K9 ]F7΁΁΁΁΁ !!KpF FH#Fx% 9l&! FvF F_(Fp!F*F#4FsU&*-AF'AF4-8H: )F(7BO0FHu `!H]8 : H:n8N  H:a"!hGFH:V-A FF(K(FF(AF"OرF(Bs6B$,#FFF(F2F(;hK0+j#F"F!F8h2<`(F%%4-E FFF'8F.!9{x@F9F#'FO FBѺ*F@F!h9R8 h9kB'F  4'FKJKIZCÿX㇀m۶X㇀Fih H:!hH:`i H  9-M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``9(  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`W(ѸCF !2hH:,5"F1FX%88{ 5;kBX%H: %0:7F FF , (O KOs H0(OKhhOsroy-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F958@F9>F$5? U,F$ F5BU 9'PERF@FU9(ѧBJF$ Fo-MhFIh 9F `0F9%1FȿH̿F9(FKxF , ,t5A+FK< , ,@- #B%0-VwJxK #vLvH*FaC)(s([и s=S%9 @F9"F@1DBSDB{$t0 02U"pDS x``5S%x$+и #JK! Os(((G, , @XF9LSFFSYF"-?A = < 1E2BF۠ Աи  =S%9$, "vPFU7| H9 FH9N%F ,X HH:T 0F9'{M+ HHX =DHDnX㇀m۶X㇀@wrj8F F9( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O t_ @w-MFFFO pL)44+.+@O +404,804B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8FH4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C 434F #)4-Д+4?|POo(4+  C 434tpG FL4;+ z w t q n k h eM#)4G(ڽ@H8t0&KS HpG IK[FHDB pGAhB0@pFz L J Kp@޿0FciGch3r Fp4B$@pFJ K LB 0F!h8`hp4@F$ F!(-E{F+SHEh;)O)LJVLHE9 ')K5) ) k)ܡH*CK@BHI^ 0})Ѕ) "h n H L ݆Q U Z _ [u pF#FFP0jBph{"F1F(FG(opFo\o%F"ܿ8% F `CiK`id`,I8I 8PP(F8GT -M FF.! FF8%F F8w#,U FF F9Fx{"F9FH9po(F0FF PF9Fx#RF9FHF1F8FF(#0oYF(@#{+#hH+ F%ц -M F!F`Fx"FHFH9Fo @FPF"(F8((FyI8(:!(F8F(F8"FFcT4:FYFc ZFkH9FF̱#x FgI8c F9Fx*C *F_H9o o8hz ,BCiSZFXH9o O4,*;ZFQH9o\ iO 193!;#A19!!9!?4""a1F8hhc%$2F!F8hF lB4,ѽ/H9kN$2F!FF!F*H9_Bb%Fx"1F9x"0F3,F,6 "0F!I8 1FH9E8hFi193!;#A19!!9!?4""aɆ ކ%ц  . M o GT -EFFFyFбh۱$ hB2F!F8FhG o FQF@F8g(4O4o%-MFFF Fy BF)F[F8F,*F9FH9&#!(F8]F((F8"sTFFBF8F  6ZF1F1FH9PFF, F 7F,hFk,H,, KJ;,Fkha3 I9_0K J},FJJJJ?6 - " S' 0F$jF!F(F4,$ F0F FFZF8FS( ѳhB ,DB4o! o%o-AFFFFx FF F4AhCF:F(F1DA俽FFFp FF FAh:F(F1D@#-AFFFFx FF FAhCF:F(F1DA鿽81FU+-ѐ1+)#FrI  34, " I68N 8"IR8E( O0O0B F io@3 ?%?+F"!F(FO0F(F(ѣn+1+Цff-MFi?3#?@3 :` OFFx"!@#?  iH9_O3{`xh7F[F"AF0F(BFqh`H9J!U)Ѫ*[H100Fx`( rF p)xIL)y)I0SEEѸ @)>;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,7D+y9ISBSA*x[*C d SF8%" P7+yu0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`7PPIS0FAA;hD00:hSF Fx`1L | GT F"#F]-MFi?#?@F FF FH8_7F W$?#F"(*F=H8K Fa(!8H1bxsDF{` y(IE+$#y+I{h4Bј0*+Ѹ 0PFAAjYD-ZF F3FEѩ(a" BB+LL*D!x(Ѐ)IKj1FHcF8-6( F*+Ѯ)IKL | oy FH8"#F FD 8 @BpFFFFF3F"(F(JIH8$ Fp(F-O437Fi Fi-MFiFo FFгrN"3F! F(3x+'*FahkH8WO:"iIp7@/+FbheHq8FO 0[0E 3F"YF F(3xk"XIYH7F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,7()F  FB@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#Osydy 3`GT#jF!]p#!F0ahH8P p H8K% )F#H58?#)F F0#Or# Ip" F M0#\.#2$*;#$0Hp1򅀰i!FF@;D?4$?@4 ?$?#F"!(F.(JU#!Bsty*Z@@(3B 8FO0F`"!hF^"iF F7-8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF v")F@F!b{#{!FC#{(FCC{Cbi"F @F\SEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PARTFC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : aw" Oa"$0Cw% p#`&0+1 '0005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCb[# tctCtt-MF HF(|,zІi@1F;f?6&?@6 ? +? "[F!(F(F_#FQF(Fw(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF FjiWn"8F8 "9FPF7qh#"QFflQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F;d @ F(Щi0F;XI0HFA!J0KAAAaSF2F(FBPFOQ P0UC#R CCS CcT B"VBBWBbZCQFmY X0C#Z CC[ CcB  IGNOREMEFm Fi8F;+F"iD0F( ;F"F0Fl O0O08oiF H )FO0;)F;(8 8i8!F;!Fs#F"F F( bi# FV:CXBXAp-EiFF!F[ F;C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`{JF ! 8mI,7"I F700@ @[H@"dP7@F' GTׅ-Mi!FF[ ;%D?4$?@4 O *? QF0F `6(FH8UFH8REH8OEH8LP0hB7F Fh5(Д!0 $`H("0 FHH#0Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- K+. KK/ KkkBF)F{hH8100 5B"203BB40BbC#6HCC7Cc8!F H8 H8~,9-AiF F[ !F;FD?4$?@4 $ ?(?:AF0F|`x(F )F87xh7 F7Fo-Mz`iQ0FP F@ R0F@@S01F@`8;1F@;f?6&?@6 ??*"?F{"!(F;`(F;hH"!p;`JU";h&!"ơ!aji1F:! !(FRFj(FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh#Y0Cb{Z0#{XC#{CC{!FCb[0F# tctCRFQFtt#F(F(Fo7FI0HKA!J0BFAAAa{h(FE F100BFA!20(FAA30Aa1{hEc~!~~A!~RFAAAa#F(F(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbi:E W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(F"E71FF"05A !H0 8DB0 H"$9F   B Ppx75Q2FD]"qoLoIoF ʅE# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww sCiF;" 0! B" #0$P%P&P'PCi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/0o"() B* +:F0FLPMPNPOP-P.PP0QPRPSPT0UPVPWP%tetttXPYPZP[P86J@ @B-MiFF[ !FFF:JD?@ !?F"F!7iCp!F:6D?@ !?F@(F7o  F"F!CFZF)F0FSF:F)F0FF(:F)F0FF8F(FO4s#F"F F(O0p0h!0 %A!"0jiAA#0:Aa$0C#&CC'Cc+B#(FF8O0-MiF!F[ :%D?4$?@4 G *?  "U#0F Gri;$?F+F0F:F1k) (, `#acaf```d hK`!aba`j FGF3k# h##`ci"iS``##aca F(F<`%o 8`o"o_o -AFFFVO,<,Boll*B@(Fj}([hh] hpGFF$ FtF04,O4 F2F9Fh4v((h4BF4F F@ٿpjFhB ,;,BoB `pj0,;#7 F`F)hB!F,;,Bo+`0j9,;# F ` 0R?B,;#`#h`jj2B,;` pG7 F F,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh4FPhh4BP FjopFFF F43FF!F(Fp@ChFZll hjl2#FS/,:,B0O0ljBF#7`K FFo0u(R?,;,BЙlB+`j#s F`opW(T?,;,BlB3`j#s F`op9(T?,;,BlB3`j8F#FF#`FlO2p"F(F8@po88FF!7F%`F8#F`"FF@#F`="FF@׿#F`^"FF@ȿ#F`n"FF@#F`}"FF@F##`"FF@ F!F@hF]# ` F|0#h#@F F #h+oFuh@TJFH d0h;TnBi0;j,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGhR?,;,B]j0 p FFF)JFR?B! رKF``a 3`B`` phBhBhooo 0)LFT?BohBhB i`0ho8F)JFRhBohB hB $#S```D` F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Fcl Fx! Fcl Fl! F FFi+#lkS``c dcl`hU FRGF((F8o-EFFO U4OT<BPF#hB FF8ahH5Fk4F<%hFj;! FN#j[h[kC F{! FEi{hRkj[hkC Fl! F1cl#Scds FF(VClI" (@F"F(FN7.ho2l*;#aR3+4(Fsi۹i3l _KF0(F"kl #kd w#(FG(phj+(FGoopo-EFFF'ozT4PpB," K-`m``co"oS``n'ggg FGso F4Fp焍<#p NJ0`H F`F8 I3 FI1h (`@ @Bp@8p-MF0LJh FEڰ"HI hF3u "F F3&  (9.2 x+3!FeF(F Fp2F!F(Fo47plFFMĕV phpFM+h#` V$ pNH.4hp<pBjFj'j#F:F)FH3$o焍D\KhpG@IF hppB pGjBop8-AFO( *IF*H3yO4 F$+m!l$J37"F#HgF(!H$к$#YF#(FBF;FFH##$#YF#(FBF;FF( H(FF(HM. 0E[-AFjL,baaaY )F $AC,L"#+I## (NWCsBs($N( #h7hF2Br2C3hO)F# .2[B2"##"AۿFIFH3O0PHX7FjC+MKhL# "###" Kp 0IFH3iPXH4FjC+   2SC `#K` #"#!F pqIFH34O0-AF hjF(F((PAT*K+J|0@ tEu ErEr O##K"Fh +F[(0'FFJ0JE Eu@ BA Kh0F!D IFH3O0oHPXL hV##`X-M+FFFFo(F"3Acx*ph7h3[Fx*Ѱh3x+ѠkFoF(o8FPId2(P#b<#dt0cd#XFCi#dиCIh2F(F0i3d8FI(h2F8#bhh3$x.Ѩh3x+1K e1Ke1K#f1Kcf1Kf0#0-I(h2(+'bhh3Fx+Ѩh3x+83F!J!I3 H3-O0I(h2(*hIH3####I(h2('ĕYDEEEeDʆkk 0pGFj*$kBtӃkhD Fo8Fj*$kBtӀkh(D F8o+sFFo(Fp#bIh2/F#bph3Lcx+Ѱh3Ccx+K#fKeKe0e0oCHGGFFFFxF(F2fFI2 FF F -o F(F(:F1FFo ?KFhhhkiGchD@  pG7F F2 oDhB BhDB *``h`0F2 FHFh,<,3B(FclմB FCh`Dj,ORIH2 _O M_x8F$1.п_OqxFR8;N8-EK)M''FFFOzv@J/D@F1;xZ_ > I H2M H2J_OrxR".F88Nl8 M KF)FxZ_+ yZ__xOzpR1d888-EF!.MGh.Kh/FzZ__Eox0FBF9F F;F(ѿ_z$_Hbkz9FR FBFp0FЃ@F1!_ObkzOzpR1_HbkzR( &9F F_OrxR.иH2888FF(F `JIlc``(FK` 8-MF6+ hi<{/uHoxqH?oHAF FF(ѿ_jKF R_ R_ R_0R_HB' 0RAF F(FVH2)%AF F_Or06R-;(oЃm ՛0Z_ ;_0RIտ_"0R/=HD&6Os&'BԿbgcgB(g*g,g.g0g2gg`ckZ "*")F F`j`#O +d0")F F`F(@#O Fi0eF(@ F0z FSF(@$chjI+<7#P0d0b F)F`F(q3#+# ``)F# F'?`F(X;hcyhCE c+cNHOMKFWc`HjbhDCSbHK!dB*O G'?#l0#@# # Ft``S`fFiոhBjCbOSORj#j/N@'xw.KB-N#`;,J,J,J,J@sCs6(KK"V<;B6O VVFFD1FH04 .Hh4jhLK4"(F+h(Fh9FBh H0!F H0$v]@wT hFk FFC#OslJIH#IF'```O3cc#css;~3r #P1o%] #` -MFFF@FF(O5(F AFH zc(P0F)F38FF)F3XДx0+ds;DjB+D@)F0H;:@0O %Bch+) 2E(F!i:Do JC+ !#!O!#$#  F"F0H F 0xF(&# 0# FjF(Ozq FED(UF}O !!-MFFF1FPFF8QFH z( FoعFO #h F[iSE(SFDFBiB F1FBi#H0-:'8F-3-""!i oSC # F FH0- #0#  F HOzq F!(o Ѿ3!_!q!pF F,2_ C_,2,_@ /F,2_B /z"Fp@ I H0~/xF,_ @/o(po񅀌!F&wh,q_G3_,1K 14om_,q$2_SB4 / gfffG0 p>0 ( -AF(F(FF(FlpLc!Fa(F&($#i K#achAFCc`K8F`KJ`Osca,<cjCcbAF8F J,2cjCcb 2xcjCcbu0!n 8FOqF 6 bF"F(F8@-MFFFF(F3 + $h/F$2_@_O30202_KOa FOq F33+LP0/shЙw O5O@5ZHE%HEDZ3++eOs`hE&Cs_2{hEHEih.L2K*НH*F_42h_ 2/3Ee_ R/0F0R_@F/(z%ٌIH/%om /@znIH/Oa FhOq FcO5hyK-*տ_#02sh2п_a2_sa2_3a2_`{hehh]C/F(OwO .F0b_ . zVIVH/.Oa F1Բ02_C _02CFBјF' 02_C_0202_C_02 _Chh=h^CF(OxO . .ZF0r_ .R z%I/Oa F8?y02_C_02+FBF( 02_C _02՚S_ O03232!!#"G-AF F FF F OFK"+`iI`kj,0jc-j F"|I F|@=`h1_C_ 1.F_,2_Cs_ ,2.F,2_h@2_,@Cc_@2 &&h(2_<"_. #`c""C`cC cB"_(2_<",1_c_,1,2_#p##C`#_,2,2_#C#CpSC_ ,2.;F,_E,2_C_,2(2_Cs_(23h_J 4" .zNIH/ om .zSIHK#c#sCsCc[.zIH6"B"K"32T"s""-MFF Fhrhi7hBih*j*,!{ѿ_B _,!iC`hiBhF,2_#_,2,2_#p##C`#_,2i)ZiHD2 @3B(FF,2_#C#CC_ ,2.lF,_8QFWH2a,2_C_,21,!_" _,!("_B_("_" _,!("_"@:.) z8I9H/$#}+?,2_#_,2j0BG"h,"_"_,"F-MF& ihpB FF:  !`1# C! Cz x1{ 3F;FZZC #; C7! C&A" )hU#p{,X'OFL iBo2<]8Ahpq? @P.B2cDB0;+][[[[ #"OC h!@ @A0 0C'CF ـO p1 F  *   AaA@2F F (FSEzh1i*SCbi  FA.(cB^h1 &XAFXC A !Vi*hQ\h^DT!B@"!";" F$"%p1"&2"(+h"[L# i   Fl (D D E#p3 ;BѮ " #  #" #F ci@ <#`DkiH3DBF!XFXFji)jqi(XF!hFF@Dji)jXD <%O  @A2jDAD2@  1"  Iot-MF<5FF@Du+YиV#p!h@iC!0,F(H@=tA   +D\JCF|3tFAu3u3/&u0/0 ZF F;Fd۲/;h:F F[FR|<#<5Po BF FJO2Z`OD0DV0p  "B\C"C<\RAXBXA00p  "B\C"C<\RA(  @ @0ppF(;,FO  [HBz #8F+oFriB(F0F;"F#Fu9F,JF(DDo -MF#FF3`;i{i;#B YH-#o00F0"F8F+F 3`FLHEqIH#o0Ca0"F8F+F|F h"F08F+FPF&#"F02H+F-h"F E(F8F+FLF H"F8F+F!FSDEf+F"FH-70 0u ;i  ^RF+F8F&@c(+FRF H-;iFEi++++,-MO zFFAiF9B OH-o %:F0?O AH-Bs ;H>o PFC;h"F(F3FPFO u"F3F*H- BE(BF#(F"F3F/Fhu 3F"FH-~;h;`DF+i; *i#RB"@(F*i(RB#"@ H-W+i FF),P,x,,,#FFF.O\]? v ޲u@f@C3ak @C%CCCCgnCCO @-C %+C+C+Cv;C3CC۲#CCC@pp Sp{3xx\xE@PxxxD@S@ECAЄTUU*OT:хUUU*4уSTT*.j@ 2C:C*C% C*CC CZ  "CC" \S@ T "C##C#*oI D[O1$1G1x_pG1_pG1_pG1" G]1" G]#B\_p3#AB x_T3#RB1@_3#ARB _!3sX1F F+411[#0001"0FLaGP)F FX1$p@GFp-MF440UܤԴu# FFG/FAF#ObBk%tǹ(F:F50FG ;DWD4P[\?ZFAF0FūcG( 030?DD0BD8F0-MF 0 FؤTܴF4BF9F$B:F U#!F0FFM`G0F5G=QDZDS/5T #4pF1 F1[8aO3! FҲGn5 F1GB!F F<1GopH\1#\181:K81<18K<1$16K$1L14KL1P12KP110JB.K/J)F11+K1(1)K(1,1'K,11%JB$K$J)F11!JBK J)F1 1JBKJ)F 1D1KD14c445#45pGGaI}ɤפ礂 ł%[ ?yF 0 )D,=0[lUU,D33%D DB<9S[lU4U5,D3534,D5$ 4%D- ,D%   DB9[lUU,D33%D DBoI-AFd1FF2[FF'h!  %B\FC1@`8!8P! FG1 FG1L !*,8 cih![FF  %B\FC1@(/d!'Խ FP!G F1GCUUD33 DB   -AFFJ`1FBCC`1D1G<5;2F+F F(AG2F+F FAr@sFFtF  &XEAXC#4$1G#2F F+FFO1 F$1G F(Fp#?$Dх"1F F01G"y9F F01G01" F9G`1[" F019G"O1 F01G-!9؀-%`+-0*ʿ!!v"+v"%@+-41\+ F01"p!G F01"O1G F@_41+\@+z +w F@(P)-AF F%FCiO)F01FGs~Kс"O1 F01G-zK-41+@\A+C`1-&ؐ-(х"1F F01G1" F01Gy"9F F01G"01 F9G`1Z" F019G+v"-K=#ս-гؐ- -`---Чp---41\* F01"p!G F01"O1G FA F01"!G F01A"O1G F01"0!G"O1 F01Gk * FAh!pF FFyS D0F1GB p1Go-M FF4$FDDCOt$`ZC:F# FCF(J;DFB.E F MN[0+O3F #EFAFZF FD#D 5ZF*"# F }` # FF(o #2FAF Fd(-MF FFؤܴTԄ4i3 #RF1F FCFo$VDB)F F5(4D#ZF)F F*F($]DB)F F(4D8#)F F(-MF FFؤܴdTn4 3F)F Fx !@F4G#RF9F FF o0F$B)F F(4D*F9F5@FG#ZF)F FF($]DB)F F(4D>WD-MF44t4F FF09FF. 09F(D.Fi.%B#0UBA# Fi|p !0F4G#:F Fo oBتE!@FU!XFN5;DDD5BF0FG+BتE\R3T FFFFBi#(F/Fo F/Fi(F (-M0F FFF4ش4Tm$B"# Fip !8F4G#ZF1F F oBF1F58FG=^DDS/5TpX1FF1F$1 FG FO1 F$1G$11F FG1F FO1F$1 FG(Fp1FFX1 FGF(-EiFF2hjF*FhsiDB򝀫BEwh1  @" A A  "(B \GBOrGl"DBs`tQ F  (E\GC)Fl)F F$1GhQ F  (XGEXCPO1 F$1Go(F1 FBO31h3FiZ1!F3h F+ 5,5GFO1 F$1G-h3ao-E!FF8F "F `! 1 I## ##d12[FFO O3F*F FciF[Fd1Fպ@F O F `i@tHhCBA h(؈iH(FF(Fm F(F5Lo-MF FFFg!AF8F`RY$ZF!PFQ%BF!8FK&! E,D4D F,F4F-MF FO44F4ԴD$TD4in@F!0F4G#QF F3F o$B)F F%(4D!0F4G#)F FF(*FuQF0FG$DFB)F F(4DJ4 030 ;D4PF#FF/0E;D8F0[F)F F(З-MF`1d ## FFtF1FF.F 01FXD.C 4j3CFsCFO32F!(F8GRFAF# FFo 0%YF5RD(FG4D4DE ZF#I!rOc'Od`9KP01`1OAC @0L%`1\Wr'(M3h+Dn_`1"R#`1_3h9F+DfLeTBF7`@"$Or$"$J#$J4%J%J%8"*`*FB?3:+:#:Ts`K 1 K41io fT~0.Ԉiႀႀ₀炀悀M䂀ႀ>GxxXLE%x&hEExEe_TGyy&hE%yEEyEe_TM-LGzz&hE%zEEzEe_TG{{&hE%{EE{Ee_) T,F||%hA!|AA|Aa_F}}%hA!}AA}Aa_F~~%hA!~~AAAa_!h_A1_ h!hi_!hi_A_ ha_IH)oI!h_ `hAB %hvU&P_C!PX|..@`@ _ Jhbi_C_ha0_#_h 0pGX pGhk$hF`GhkdhF`GhkhG𵏰F FFFJF!)() K2F;F)F F/(h; ..FkFh#`pFF F "F#AnGppFF F"F#nGppFF FF>E5 H(o Fp(FZF(0F~F(FS.@A𵑰FFiFű)F8F,陹)F0F, Fi@"hF=iF FuemGo@A#5!DA G(#HAFF!`G#HAFF!`G-EF XF p(FV"FSF8FLG( 0D0DJz-o hBHhpG1BopG8# rF F 8 JBsH#+r)F(-E$V<1o  $ . A 'A' Ѿ gqF HO0"O1(FOzp&rc2-A !O1@FFFFhSBrh!h[hkH1'`$ F*FH'x22pFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA^"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1opFF" FO1F("O1 F( E Fp@"O1pFOS"O1Os"! Fch ib-AiF.hl.{ F(!"0FjI`+hC+`0FfI+"dI"FbI@FB(Fo\KB\KB+hC+`0FYI(WJB VJB UJB TJB  C뀫CbhQhLJB#chZhHKBjF0FGIP*Cs뀫Ccj + +(Os"! F7cj F ;+"#OCFOBF'(ۥhch FibV F< o #OrchZh$KB+H! F(nH !C F(^)h F"#"LCB!(J2223`@w+3@x}@YsrMtMA38FF"O1 FOd# #Oca#aa(F80j %h<+b<# `C`@b```"aca h# `L`h`Kh`L`h i 0"`o Fc khlhih `pGh8cYl `j`bpGCh\lhh_9)KJ[\Q\O!O Fg@2CFh@H`\C@%C_Bhh`C)C ),C텀텀F_#"iS`_"iSa"h`h"#iai F"F@@S$Sp FFF?!?(F)D$ Fi03F*F F8p@6H'Somp3-MFSX!F F(pa8F#0`I0OS#cOPc#bOca##aOsbO3`3h|Ic`lF0xH'(FvIlFsH iXC`cpIl$FmHmIl0FjHjIl4F(8FfI hC8#FF8F+F^I@Fx"\Il`dlO F-&Ork`OXbkZ`i+OBrkaO\bka"F8Fal!blk3h+ o%`(F"AIF%! "XF>I%8 "XF#Fh1`hѠiOhBB`ihOBB`i h"`biWabiaha"OShh@` (#h`hi2U"@E"h^ COL^&  " ; B N& # C F&@FE( F( F( ۣi]ci@@cicibO h F chl]l#]C< h 0kJ_bsYa@R0a hBh_sYa_sYa h1%iR 0CB 0 F0h@m+Ce"chl[lw/&m.0F(@ichi]ksizE*Ed+pEEhBйh-qвiOW!(F+hk_C_*hc+hk_C_*hcC F$(F=C`CCC@#_"h S`%F0_+ 8F%d(HOzp%chJbchJcch*Fb`h !0&?`h F+`h# %JbchJ v[[#}d#` -MFFu'F,8F FF F\(=#   U U2 8%0FBа_аOаO аaO а?ЫFH%  !FH%LP0$%q@ILP0$-= (H%6r6A@ahkj GopGpG FCi ```h`Zh`h"thtibt[ica𵋰FF(FB&F1F(FB?2F IlD a2FIl>`"Il81F`(F-O_`aciSNI2Fl"(F3Fca/ # & # ao7'717lhiDh@X\_pG=!F@i`i@!o  F)!@i$@ihh#D@Ҳ_ZT8 F !F@i "F!hi , 8Ho  F  * 0, +J@i!V H텀pFF@i!F@!`i`i!`i"!`i%p@!8 FCiFXi!Q(,F(F 88F F!`iRB"!`i{"!`iv"!`iq`i!il"`iFgk)F F`i8@"!Z8Fg(FmF(F`O1`a F 80FRF(FBo 0 `"Il# ajF!(F``hF_`acic# a&JIl`a(7lphFkFsiopG(ѳi+)F Fp@G8FF(F`chC`h`#` 88F"FIl ` 88-MF0@FkF0F,hChıB(FkhBѫhSERF!F@Fpl`;hC0FMGL+FFihk[hGpG0i%h$jkdhdhq,h4F0`Go^0pGo%hh޿hshFk FiFC F@ojFG(pjhB 3`sFFFjFq F8H1F+`#`p-AFFFFjFq FF@F)FH%( FAFF(kl(F(F+`(F'F Ch3`=`(F(F8-MFFFFjFq F(xF@FYF>H% FAFhF=ѺQF F(/K.3FFOC``ClXF``FChF>hB) $` ( FFFPFF(и!<0+гB:F1FlF(PF8O2FFl1I&0`0J1Il p`/Il2.IFl--IFl(d*IDl -M$F FFFFBPF KOOKh HGiZF)F0FDDD HGZF)F0Ft!'>hhĿ-MFFFF0)FQHokOI#(:"MI#:"!F#(!(FFEH8`(S2FAF,H@IoyC> ]>@wp>>u>>>-MF°FF!x"F$ FI# (F(؁IH$1F_@IH$y)FH1FhIH$k)FH FI"P(F(𮁞IH$X0F0IH$P)FH1F0IH$D)FHH$;)F ~" FI"U(@N(F{F(zH@FI$()FH&KB)FH)FH{`'to 4DFF#F@F$;E)FH F,)FH) (0C#* CC+ Cc+)FxHib~#~C#~CC~Sc)FrH[% $0C#& CC' Cc&FF'V$FCa| |@ |@@|@`DF8'@ & Cbz z@ zF@@z@`D8'*# @FB)FLH #'rcrC?rZF#F@F$r)FCH%0$ zA!&0AA'0Aacz@ z@@z@`D8&$ 3F@FQD)F0H%0$ zA!&0$AA'0VDAacz@ z@@z@`D8&# a@Fc(<)FH~A>?>?T?w?????@#@?@@G@MX@s@@@@@7A`AAAA-Hb$0C2h*KB*ѳ+'&K$(%K)%K%H%*#'2F+F!F$X)FA+F FN(BK;DHB@&J>K)Fa#iK/sF=K:F#F B @xxR" [[ph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)F%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`o甍.FH͇L#hBH##`H͇FOr!H!F@"H qF  pGpGFh(o(F.M.N(ps F(m(rsh0F'H 8 F((t0tt!@ F( FHo t"!kK)F+`@#+#vK F`F(#hHj E(@ oI 8F3s#ss;h[i+!8FG͇4͇8F^6Eo^pGKxpG"KppG"KppGK`F&F FIH!{ ḞZCFH1̇U "Fe epGUpGT0#T0pGpFi(KpK!h rFKF`K``KbKCbKbKbKcKC`KCc#Cf0F!F F(Fpo ͇͇ꆀ͇jujhhh͇iBiyi xuyF&_(OV`(Jx* x!+ .4F( $I"F(h_#FOSBԿ&&k`{"fAsxh)FhiG#+b hiKmS"@+F:FG F-KiU2K`8 FMiU%+nbj!h#e #e8p F+mFl+&4l;(Fp@6;B`(m+-F"0cjFB(F h'0S"bbh!F(FiG @KK#aOSc`(F``Fs FA"hF!"jrahacjB+8FTF"H (K0F#a``"H r -$-g":pbbh!F0FiGHOO5=- K Jh[m K Jh[maK Jh[m{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppGF0 hkh]$`6F F!FGpo%-M0yF:hF8jFp;:F7 $#(F hF({i CaFŗ ';F(F IF(w+h`nGh9G7FahF H!" FF( H0@)h)H0@HGHGG"FKiF} pF(7y%FFh,>,B+єh,<,BR;hCh,<,BTiF F`+HK+Kx+o Fqh'H>0FF#H5j,> H,1F} JFH7#Cq"K5pHcl F#Cy FUjcl FCy FHj砍XHlGGH,H6HpFF(FiFi(F,Y 0 i F#`p@Ob F a,Yp#` Kx 1 pGlF-Ao)Ekk^lhq<.@x= bE yB"o Ӕo.& @ V`"` .>3O>rE" 2CT"|[@ V@*B"XB=@BHOR,BBBB bdYdT>>3O>rE?r" 2C:T"|[@ V@*B"Xj{:B"R" B= * *A"€€>@Do Bk<!spGopG#0k ZX"BZZ̀0ڈBUڀڀp1pG pG9!d#e( ޱ{{˹KJF2FPFI `#aN@##K`O K :" Ju`jhk``"a`zk V9HŅoyXŅF,p"@/d?C?A  "0<B bш @Ӏ##cd#b#LU0lB 8+@ok F(9K-M&NCԡx1DL@vZDBF $(<F% E]jB%E],Т{bh±! FX"qajB!BZ{eAsbjchB"!F@F# {\2+L@B( io ktC#kU0 p!F눛#`C눛C!Fo,!F#T0>0+k#0CpFop) h: kkBHc$Lbor b<@9@>@8@Tlm(Lebb,`U0lB ao<ok&F Ko?Ku?s???B ؔ?#?#h[i! FG е(;U 8 lB:ѐ/**o*m(ebb"`"AsO,~ p,Jh*$OODl/kp?+k/o#-Eԁq0{>zF= O %}?}Հ#{?+++JKR#0I@"Ho#?O }?+\h # F O @dRsBq=е(:UU(,U$< D[9zpBβ>oJE1FFUI7I/IfIrI~II8UoyI·63IЇRЇЇ.Їχ·vЇ!*B\B B<ll150 F?(#h[h FG Fv$h9#C9hj)pG-MFFF!<" FH"!8FC `:a"b``J cor#bcb 6b `'aa#c o#iF#i p#iq0!-EFFF3-FHj$ F@99FH[T F(0F2F!F #BF9F (H9 F9+C9II$J-A"F FhH(F ci+A3Ozs)F19FGis3 (F@Eӣis3o=!F0Fio$J-E FFF8#(F#@F*FAF E-M FFF#(F*F@F (F:hk`AF M~8FhLP0QkxCkp hh[jGkxkp hhjG!h 1Gkx ԕ`0[ "2#Ozp`XC8@""# Fw#ks3 h 1G#ks3РkpFFcj3#ks3o=06"9@# F9 p-M FFF;#(F#@F*FUAF MF F h0Ho0FaF(#hzuq`B B h F<"h?C?#hc`IJ-AF'Oxhk Хn ?2F!{H#kfJF@7htDtt?Ozp"F){@HfJ! h AـhـhۈpG-MF1FF hS /BТ # aa&0#100# 0+@ $pO , 0D(0 0( p+"tD( jejF1hhs@𼀲؈ @,؀ F)Ji 'o(X( OHHOXH H XHX(hP"&>O#  $0)]Е rQ |!! pu &):іH6 !X8C !r& *4і/R0!B(F1 Faڀ&0+@40#rv(i8A!!rD r( h*ub{*\Z FhSCaQXBObhZ"hZ/"0Riqi# qi$ q hVs! hZs3|h_( k2C#Lc#(0 0' n@&  #Oc*CShC Ӏhۈ ڈ I#{H@N" ! Fm!pB!ۈB#{@O2IHS0+ћ 0 +SCS #J1񅀰J-EFFjTj F&0sO +h%ثh.Lڈr:O "hI 'n # Cf#%0hAhJ``C``kG#h% hB>"1汨i( hG#a#+bk{ #kb"#hZa&0+%//Zrhi) hGnak{+#+b#}+%ih F]`+`#`#a,hB NVNF `pG J KF &LB8FT6a6HH FHI"IH" FIz  чѷIsN#J F,"`  FE( F(Bh чOhFOr!hF;hN+H #0`;`#0h`8jF)FH8AjF)Fz(hF(hFp(Ch` чxOsNHpG  L#h I KF#`X#hx:+K#`"hxDp h OO#-E=F4%?F@FFй#9F0FU F`;FRF1FH$ F =5O2#=#AF"#H?0SF2FIHOOO#-A=}F~2Fw F!I'?FVO)F F V FhK`+F2F!FH!FoO29F HQ(3F"F I HObAF8F =2 OOOO0pGO0pG pGO0pGpGo pGFHhBDlDBFF$чO0pGO0pGO0pG-MFnFiFpFGF0Bx ڤ`Z ТE{TFl ~"F9F|BH o(FfOO0pGO0pGO0pGKhpGKh@h#-AFJK'L<#h B#z[h IG8 K"h` K`?DO04$ч0FJFhO=`Mh I8hGXF K*h` K` FI4,DO44$ч0L h%CjG##`KFhi FGF FKFhCi FGF F8KFh F)Fi FGF F8-EF KFh FF ggRFCF)Fi FGF F-MFKFh F!F SF(FG #BBE)FHO4z F-P7KFh$j(FGFc- FKmB`0Kh`KhC`蒈40F Khjk FGF9, KdB`納蒈FpKhKCk FG@FXKh@B!FQ;+H6(FF((F2F9F H F + H7#H~&7F蒈LPzP]PmPKFhk FGF FKFhk FGF Fp KFhF1Fl(FG2F)FH>O4 FpP*7FhXh-F$ F0iFh(HO4F-MF+FO4 F*!hhhF ]H$/h  hFBx+//ѠFF"F!OHih!F}FLHaF(EJHLOF!Fhik/FF!FicF ?KhEi1F#PFVFp 1FPFGF+ QF+HOFBF/hh8/h8*i 3F? #!HrH AF   Ozs JnHH1FH H>I FJ PU_PPQQ؆8膀Foy8F+F* !h`h`- hH8 8O0 FF F@} -EF+F_hhhF $ F Fh!FFhi}F>Ѩi!FuF *F1FF@F#tFPF.F#HͱH.)F>Ozs J H H%F3O4QQ؆pF+F"hhhwF Kh.Ahh FpHbO4$納*F hXhQHh8 O0 *FhXh;8h hH0 O0 H H p+hC, :!,!jhH4D5eQ$чццFFF1FFر#F F"#vF((Fq F#BBѨU=`o oHpG8JhrBЈBPpG7%L#!hqn( H !hq 0)F+F*F!hq QiFh@ ]` F`h PO0 KFh(h0"U O0礎 "!ںFh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRFM(#` Z`l 9FR9FMF  ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9F[FRF(?@ FF#D3 [FRF(?("!BFO480F Hhh HhP EE0O0-E FFFF(QF HO0X2F F+FQphFFF+ChBуhB F)F@ F `@*F!0FI Fo pf`` 炊jpGFhXpG`X1pGF@*@pGF@)OhjFpGF@)O@hSjFpGF@)OhjFpG8F F DCB08-MFFFFF@li ?#?@3  ( & CC'K@h Fб+F;`cCvE>hAH0#H+H(7F < ?&?"!F3FOZFQF3F"!Fhl"SF!FB"!F3F9ZFQF0F笎QQQFL($hi 4@ ,  @\IJB#CT C#:D xB C p@BXCBDZ#@۲O0礎FL($hi 4@ , @\B#TC#:D xBC p@BXCBDZ#@۲礎KhjF(O ;D# x CO0 ppGD#@BXBB:@۲KhjF(O;D# xBC ppGD#@BXBB:@۲礎sFAjFKnЃj"h1OpU]" X")FTF * : KFFp-MKh VhF)F@ ,*F!Fh@ )F"*F!.+𱀣+ƀ#k3#cQF k2FoEiB𚀣j!Fw8F1(@𪀻o 5%c3E?O3#c  iByңj!FU(F((FFjhS'hjR'  * $jS'QF#O xF*мo3@O B phzC#c3@*ѪC!;@* `jhX!;A5*D`X! i3Fh(AF0F({0FO0y!F)?n  DQFFe{8FFjZFS%h # jYX*F k F%k-0B i3Fhz(AF0F(P@*C;@* #`jhX:C5)D`X0Fhe kч-MKhjhF)F@ *F!F5h@ )F*F!F+/.cj[n@0++k0cjFU!F(FFУh2F + k1FhS(CkBFS(kF(0CE i;F h(̀8Fih(@ŀ@*C;ꁡ@) bji;a8F0Fk(2BCO3ciE𓀢j@* UC+!F(Fn Уh+  2Fyk1FhS*kS*!>K"[FFЃhFBx^FO @ Z 3c@03@0@*C;끢@* k@*jC;@* kbji!;a i;FhCh08F3(?S8F0FO0PO    FO FH礎ч-M F$  B@F,𑀆h@ 1FdF2F!-<ѵH6F{F,?FwѮH&&0FhF,F3@HhSD`AќHME0FFZZFQCSDD@#F(Шi p 0 9FF(AF FojF0F8FQFQFD0F: FOCi 0"9F c8 K FFho@B-ML#hFiF 3FBli*j^Ն^ #h$O i(5 3@+FO 23 B.O2mF2B XE*! 1Ih"F@F@PFuhBhEF!D@F$ Hg@FoE ڭh@F (D2  U+$@F,OkN ZE]ۺ)!F@ TF"F!`H#O0O2]K`]K`pm0@B0SF"F!0VHL0BPFO1#NJ@ `!F3`0#F"FFFH@m@03h K S+w 1YE ̀%!F@ F"FQFT1HO2+K`+K`m0@B."F!3h6 'H0BPFBO1#J@ `!F3`0#F"FF@m@0LP-D!F@ F"F!P͹ HD礎bRxR҇RRSDSsSO2K`K`AFF[ @0B0+F"F! H 0B(FO1#J@ `!F00A#F"FFP-@3hS(0@00S"H3%!F@ F"FQF~тHO2K`K`(n0@B."F!3h` zHܱ0BPFlO1#rJ@ `!F3`0#F"FFF@+n@0fM-!F@ F"FQF+]HlO2SK`SK`l3hOV(x0F F-?ɮ(F%FEo CU`UnU-MOBK h iRh 3"E"AFO78FhF)F@ F*F!B,S8i#F!hCh4HO7 FF{%.FF+٢YB7yFB!عY/H~ F0(Ѻк0D0 Fm(hDBٲH^o U(UL hH#J#``O2K`L hH#J#``O2 K` L hH# J#``O2 K`҇чч8 M L(h8!h)qS#+` h##`8@-M{`0FF`+@h(x +rЭ   (FCF (+ی!@ F"AFO +h#`i {+H+FZHNh+D%(h"D F@ G#0pHOCи OrШCH7H70Ki(h"(#0&и-H"-H O +FOh+{h+1FXF {hh` 7F.HEZFhH@ FлDhSETO"##(FRFCF@E@+>1F H6.OUUjUUU-M FF``# #0F4B1F(F<(FF;/+лO /!(FyF0FF 3/*6+ !F0Fh` UF)F0F 7F;i+@@Jh3+`!F@F0+A @ 2Fz`F!zh%-=%!F@F-+x/+0F!F*Khv1F(FqF(F!F0FК0+{ih`;ih`( ;* (F,0+"#@F(2C(F瀎7F#% K` 0(,(  ,(#N F1h O;`q#03 h0<` h"(1h Fq/O0礎p!OaF@ FOb!_l FkNNSs"Bl#` #X0`#nմ0!#r F|Ax!L4`p FF#3` 礎p FFKEd"h`Kh`chECli  @% CC@EpFF FFgI+F"F h@l𽨎pFElO`iObi#Fp@BؿcOcBjF!O`'i=B&i5B(Ӡh#jiCCj;#J`J`)F FhF(F!F0FwhjR% a)F FP!FphkR% qؑԑp3hiMUKB@F(Fv)F b@ F*F!gbֱ!j%ihiJChC3F!WFj-jbO0p0(Ho UphF1F@ F2F!55KjFh!B"hFFF i+F!hpC#ah*F(F*%`j bjO`n!#fbjOc`jjebk{j #b@0c#c pP%jC%`5ijB#b.FP%kC%`5ikB#c%.F礎-EqNw3hFi# 2@Bl`iOa@a@ CFOb!eb-Ā(Fȱ_F3hZiXhjhao##a0VHCO5;i@ 9FF:F)Fyb..FiB,'iB>ض1F@ F2F!dc/&iBB&iBU&7FiBf`j#BB:F`j(F@ AF,FBF!8J&pjS&0+69F F!Fj&i!pCS'0h(7@ AF8FBF! J&pkS&0+?|61F F!Fk'i!xCS&0h(?f61F F!F6Do 礎U-M@M} +hF #?FOrF! ++ @@ !FJF"F/L!'`//P+HO3 }$0[nX$H" 0FF3 !h%(@#hjS H F3% +' F  X$0hSEH&VAVxVV+hjjhF1F@ 2F :+2F(hD(h(F C X0 X pC O<- # `&GћKh hFF@ F1F/@׀HfKhjhF1F@ ~2F!+@HNKhjhF1F@ f2F!+@zH6yO B@FFF Fq!FFF:PF`F)F)FDPFXhh@ F(F!- i+F!xCh(V9F(FF(Oh x9F(F(DѣkBFS(s@*OC3󁢊@* bji3ahR!F0F.'i!xChC!F0F!Fap^VnF(.H(F>;O4XBAFPFhFoFj2FS&PF1F(F@*dC3@* jjh3`0B)FF(i;F!h0AF8F`8F椎V҇&V ҇-+𸀯h@ 9FW:F!+?ٮO-(i!pCh hP@F`oFF1F(FZFj2F@FS&E 0@*, C3 0@* ,0jjh3`0B)FPFIF(i!xChh09F`tq{(oFF1F(FFj2FS&Z @*C3@* jjh3`}KhB8F)FF(i!xCh(9F=(qK``..0h@ 1F2F!+?3.(i!pCh#E.8FoFFj2FS&8F1F(F@*<C3@* jjh3`0B})FF(i!xCh(o9F(i`f0+QF@ 0FRF!.X/i3F!xChO hW0FX8F8hFoFj2FS&8F!1F(F*@*C3@* jjh3`KhBw)F)F!hN(i!xChC(9Fe(]&O0FLIk҇҇V*0+Fo BjFQ"(F@*C3@* jjh3`KhB)FF(i!xCh(9F (ѨK`  TK`3"=UhFoEj*FS%0Fq)F Fz@*C3@* bjh3`;hB!FzF i!pCh1Fȹ=`3(F#4000@0<0,? %,F%Lo <+F ' AF @ AFFBF!],c` +@΀J#/@ O#*FQF Fc T*h0@ SC[ ap9FF:FAF--JO0F;h>j(FXFYFFj0FF  0F 0pCAF+F (F(O!F  @(F\(ACli;hi 3 CE(CF h XD FO3 B?3  @C' A  3@ Ha F L h(F##`҇V(H9H#3 " F&  5J Z(EјF D DhD3CF  @C' A DJCDGF3  @C' A 'O89Khj FXFYFF8@FjF  D@F B >! (F!+FpC 1F(F (= -1F(FI(/& F4`0`@`<`(F`RFJh;`ԑpCV H O0p#*F8H"##VVVp FF)FF# Fp@-$F OWkqhK ЫhO|2h 4dd,M$.FV;Zh2N$7FW;Zh2$V \4U Wd,# J` J`" K`h4Hd,h4Ad,簎@ؑԑБ-MF&FlO "j3B ;hhX#0F@ F!6;hX#0hh)Fh=hD;hZ:`X#0Z`o @ؑ-MF FFFIH>oJd#FRIhHСB#;+Mh+hF@ X#EF!+hX#0hXh1F+hZX#0*`\` o W@ؑ-MFF@FEIHoL`#hX#0sh@ F#FFi#hX#0hXh)F#h ZX#0"`_`o Wԑ-EFF'HE!@ F"!5 H&&`f`@ QFFRF1F$%`9F (Fl Jh+ K Ih ```T``3WGWܑ҇8 M,hD(hX" K(``K`8 hdhDh Fܑ҇p KhO0phhBh"B[hX6B2 -MvhF1F@ L2F!F@ AFABF!FE(F0F".%K!h"?'i+F!xChO phB  XF30;h "'i3F!hxC[h2FVը礎( HHaW}W-MFCjF_ngoцh@ 1FF2F9F.u@ QFFRF9F">(F2o "hK!h':F9F9F'i+FxChcjnY<ո\HkiKO Fkjoi\Cskb;"F!h0F i3FGC!h8Fqhih^ѓB?@F (F0F ?H.Osai3a`jbj!nO`CfbjOc`j"FLh*FD #aE@h2X FSO ѓB32aѺXFO oo ѓBѸ0F 3`B?^wO0,WW-M#\Jp`\JF`[Jd%`"GFZLh#`ZK`!@ F"!"HO0!@ F"!"X<`O3XK` `Z+S`_LQF@ FRF)Fвh#hF@ W#qF)F#hW#0h+CF)Fh(FObqj#hhW#0AFh #h@FZW#0"`]` m( h8 @B#hQF@ W#2FRF)F#hW#0h(?uObqj#hZ"`"W#0Z`@ܑԑؑБ-MȰ'CjFmXiO!w9h"K;`hF!F@ F"F!N=!(["(F4ih+F!`C7OsgK@ iAFFBF!)D(F9d$^MU+9hRhK2^9h"K;`FhF9F@ F:F!,[PHpHO " FHHK S+Rh2Os`"XFK`3d  :K8S(0"[h `OcK`h"F(F F";`d0U,ah<ьK!h("(FJ7ih#F!xCOsK@ iAFFBF! Fz "8Fh:Fr F8FБ;9@WLDx B\B;10 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB Fd쑈pF JFh FX Jh1 LJ$h&DB HqO0p*F-(d쑈葈Q{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5H +ч FGCF+hS$+h3)KB# FYCJF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGVGCGFW-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(FY DdB F*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(F$F*KFhFFO4 Fi@ ?1!?RF(F! (O4(F@")F F㊻ #@!F"3`8F3h4 +O!F H$dB#$4 H #$3`"!FH{(#dWWX-E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H%H?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @ b @D#a쑈X@ p`E PaS`F`FP#a#b F "IFY(F8(O0+\.+oOT)F0F0FOq F,!F(X-AFF%NO., ,!F Hx# Ԥa+@5B(F_$텀-EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(F"8(DB5`x +.+)-MChF+FFS + +\н#@FYCF FiBOh B(F8 D0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDDCDF焊@FDCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch +1+@4OsEOs[EYF Fch +OS SC-F:FO KMLN 2B ahr8 )0Op@|)`FE-QF F:chF +!Or@q+ FREٺ@P ++OsOcSE@EFG(F*F3F )KOp@u)(FE  [b2 FFHBA3QF F BF*ch +Or@q+ FZEٻ ++OsOc[E@FEHJK 2B Aƀ  a c B x8 8, cCsЦO;h+ኢi#VOs @B u;e-@Ȁ0F,@ #DYC:F83B`E^DecD5CwM*h㊘BK2F9F(h7*h㊘B>D QhhB ` Q` CBubh *Os@q* FE &5F;O1@ 78`(UMH O0  cBs FV⊐B:F0D ^⊐BcVDD+r7+K9Fh(Kh<CB eDDEsAOCFK~QF FkbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOu䑈Xcu1%)F F'(5ch ++ ]-:㊦if3DcKhB+aH- QF Fbh *Os@q* FB?QF F)FFQF FEFRK&iFFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@s葈Xi?3#?@3 N ?x"0`$?H3"F! (#O53`(FF"IpF(" I6("IR(d쑈XB F iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Fd(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@FG#41CFF+#{@F#z.#>F;"0F'#{!0Fn#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAFO2FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0F|8o EF;/+\+ci *$I0FEȹ#hZj"[jc`#3#a+x+* I+x+o F(< HxH#F!JH2(HAX[e[ Y[[-MF'@xBK-TQPE7I hF(i(TF(h3F*F (Fd+Fx-AFFF!dJcIF(F YFP\H8F F @+x+`kx+]"F OI/F1KLJH#*F3Fe@3F*F](# "#8I=HF(V-F(Q8H+"5I(;(8m 0hFu(F"I'x+(F#IF7# I*F h F(F,Ў(F(LbL`0hF-?VHFQ LR X.L[zㅀ \h[ \#"-E FF(H(I}F0&KB%H +#IFHF+ BF9F FhHIHFHHL FH&OS VE(F}BF9F5F(6ㅀX1\R\Pㅀ\\-AFHFF B%$+F9FJ0FM"F0F I KB 5?HH FPdㅀ X -AIFHLFAF Fб1FN#%gS" ICF HpF0F F(FMXPㅀ 𵋰F!JF#IFKF0H5 F IHF(:Fm)F(P:R1D0Di;"IHF X\Pㅀ-M$"F IF(@A !YF(;FF.FF[E#.@"I ( (QгF KFBlOFE@'IX F(X#JhF sF(L" F(C ? F 4  # @pK0H9F%x`lO &B FbHB8F ;hbH _I"D9  7r /Q (! WJVI F(?s F F +ذF8FFF`"FI(#FZhB Fh9F}"r 3EXFO F 0/O XF/}F[Ex0!0F0F"0"IFxDRFCFBFI7FM;vF(  XX58F:O8Ldㅀx\ ㅀh XJhBHpGBh pGH-EFO TPEE #%S` F`%`e`(F.FVhB-hhB #S``8F?h҇KhB`KKh@ pG҇ptKh8`Kh@ pG҇p-AMOѦB 0j(?",I(90F"(K)O`!#hhB-%Kx;O`$0HD D Dc FR"F6hiBbh6hiBXhhp```Y`Fh J笒Hȼ҇ؼӇ`|FhF!F yL FF-qH``KZhX``B``pG҇!F ` H -M,FFFF *KBL ذ(G&L?s+ sO KB@O и/K@/@!FFй@"F O2+bO3 #KgZh]`+`j``0 F  `HsFFF@#B KB*F F3FFFpJ`sFFF*F# F3FeFFp-A'FN\4hBA90#i+ Bw ӣk+ +#c F

$h 1B 2H҇pFZF0F F$EzBAa p8F@ F%iuL M(F8<0+#<0A F<0+7M-AFFF)%L FKh+LOV(F( i,tё<0FFE#V# <1!<G3B@;`ӇF)(!K`+@ջӇ-AFFFFnF+i+/O30bBr$OQD 0D D@s+H # Hc<08FO0FOpFFFr2F+F FFFp JhB pGBh҇FFFT_BH "1F=` -hHF FF2&F H9JhBМBhO &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBH҇҇sFFF,*F F3FF:FpF FF$+L F!0F)`!`F(FW/B F3$!`h*F :FhB*hQh4-EFFrFF+H"8Fv(KB$! F"1F0a#bh|`5%`c``PEEO1FHb 0F [F ! [P#S`` ``` F H`+j(b#`h'F3S/O '7FO E%/+"nFR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i 91F#*FhF!F F?hJ-MFFFFF0BQFAF(FFp"F#(FN!L FF[hXE"0BAF(FzF(iB%#S```D`/ѪhB(FiQ)* J```D`FhLF4FThBѲhB Mi#0F1~F9F?hM1FH(F0FG%\-MO FF @!FFF@4! F0 FMM(F#aOS#`K`]RFQF(F`MHu0F F xh]-MF#F++(i+-@)F*F|IFF(xF0wL F WF(a@x E BR!(S 8F{i GF\  E BRQ( h8FG,  "F(@;F2FAFhFe@r#C @F!BRDKBwDK`{`FFAL*F8F@I `BF8FFRZhh8hKLxQ ]pGQK. FF?F@pG𵅰 FF8%T !T|T,;#0F49F5=FRZhF"-HFQ ]pGQK FFF@pGFFF"F#(FFF:F1F(FFH"F#!F(F F02KhF F1(+IF0i*k+%I#$IFy)abaPbFhKhdK`v KM`#am)FjGFMck"Fo#FGFBxhp0F/(FF@##I(FF!#i++I+F0k{#(FkGF) F#!Ih#O>Kh]-AFFF##F F&IqF%#i++ M F(FKhBѧ#ji`&!1F "j(#j2FAFhiej` + FY(F!H##bhxO]8OqJ F J KD Jh MBb Jb 2bbc H(F F8,Ӈ҇0ӇPp#"IHp !0J 402F I XF pF2F(F!FXzㅀ FFQa!!F@i;`a" FIFF60 /١A+ء72*# (` ,䅀shF F hF KB ;B  hH `+`2F!hpH 0$B 0PB` 04H"K`af]XӇKp[琒8F44 L(` 8B  Fz, l!h!HKu q]XӇ-AFO FF~h_ #sC JIhBXBa Hjh +pB@+x+1+R#]5^_^\g^o^\\\\\\\\\\1^1^1^1^\#^\^,H(:0(s1+?nR#'^'^'^'^'^-^-^-^-^\\\\\\\1^1^1^1^\#^\^~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3TsiHG76h2#Ӈ (Ӈ8F F! M+x F$" IFK,ph<@# F8LLӇ@ pF F-@,> MNz)xA F "L FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@L琒Ӈ/@𵅰(51H+.P%$&,HO-*K1,"!Za(J`h*ZhBhBZi*iBhB"b"aaK`"Z`F([+ 'F(;+,$R+ 0; +U$ 3E$0,E]]pӇXӇ#𵅰%O&K&N'J'I'H(KFF(6#H*F"I!H"F`F!OpJF(HB FhM`!FJHFH2"#!(hF(HHӇӇ0Ӈx_]%_]] ^-MF FF (HF$sh0FGFBp/Eн0+ #<%0+F H + %+н *+*o 3B 0 H%0+F4G(кH6^I^Y^8F$E+h3(FN(((Эi4H(i(B(F4i%4i+j[h[hB+H+44F8-MFFFjF1F8F(;:z*O_O.OLO`O+,""p"bp"pBr"#tbt-Bqp r!sassstt!uauuu4 FO"pObpO*q@r #t`t-@rpp !sassstt!uauuu;z+##(0n+ +"(F)t*4"(F)0l"(Fl")F)0R(1FHe^pF F)a h+^FpFX FiB.F!.Q(.3##p#cp#p#"pVI ~#&ucuC6uulH..ѨiB(@(F$9#q##p#"cp#ppcqD(F}##p #!cp%#F&pp "0F"0F)A#%4< FpiB(H((F/`##p@h(QCh+##cp#p#pl4<(FG##p#cp#p#"pz4<,,<0##p#cp#p#F"pI "+h"u"u#buukh"#vbvBvv4(F##p|F`x* ЂxxB"\D+ pG pGx+Cx++Cx++@x+F( F px$+ЃxxC#D( FF-MFFO FF@\E-? FIH$h9F F(i*FF(FF}BF(=F@FBEFDF+`҇xpFF"FF8#F1F(Fp@"p8Fx*Zx*pGxxB"DpF,(FUF4F Fp*F!F-E F&&F8!HEܿF)F(FF 0D+F"FQF4D F"I4:F)F F"I0F텀""F F)H@xxF&0F@2F!F"I(FwFxx@ 00DF(2F9Fxx!FC"xx"@ 0DI(D텀*pF FF F p$ pEppp -AF F AFG5F(FF 0F=F(FAF"H#*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F3"Ixx.C#*0FIDEF0F/I=-BD0FIwby#yIC#yCCyCbiD#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (FA!S+-)++x+++++|++3+++++++"++"yymIC#cy"y(Fayyy"yC#B"eI"dIcK cz"za{B"zzBB#{&|C#{BbCC{(FCcVIb|.*0 ,QIQI0F|D* R,KIKI0F5Wcy"yHIw$0GI+4' './D0F/3IBDє$ >Izyayy"yfzC#$zB"(F7I&yy"y`y!zdzC#A!B"/Im"~(F+Iw.%*J*O#D0Fz(Ik5-:FDxx$IG'^{D(FJ#9@D(FIN^^솀^^^^`ĵ___ _&__+_N_c_oyކn_u_rIsH#y*FqIF!S+ՀU"")0+g+!y`yyy*gA!AAAb(0XI"AFcy"yB"yyBBMIBb(FSA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*Itxx.C#*?0F$IdDEF0F/IZ=-BDxx A!9FHgxx!B":@3F@(FJ$D0F!Tz______솀'^a^pFmhF/%,&s bB#x+cx+ #phFF F mpkxxC#D!F[F}XFv(W%e F F%=FXF[n0F1FB(Fx.+0F1FB(F.FCEF)/*(F)FB0F  XF l( F "#XF#`%#XFI#ef0h`k`n`oy8F(lph$d(F F8$8Fl FH8)Fh|(-AFFFF"8F/I;(Xh/!8FGQ,H2BOAA2mH0R ۲BLx FPO1@F|0FAFO29F F F9 F50FF`BBLLLL8 p FFFHA:m;m& hlAHp+h1F0h#(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpFT@FOEFH @<RE-=5B  0F^F"h< Ӈ-EFFFe3+'wH\@<SEfH"AFFXc|"|B"3B2R Hh8FeG(FӇpF%iBp#S```E` pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! aF(׀"!F0ia#`Ocz%z'GE%z'DEEzEe%DB:! :F(AF 3ha(_Д,0- .C#+`(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1@5=F0+++ji FB+jiR+ O1F @   O 2Lhhi (FV*L*L ;P+'L FHO`@```by#y C#Esj ubC B* (|F8(F(FLRFYF0h J`;`x``PhS````#  ӇpF F)FFF0F8(];((  p FFF F H;h# HT_BH0Fh(-h -EFFF Y0F j$HhBظ^HFZ_UE8FhxhB+iB٧9Fhi;FCH*ihi?!8Dna@FF(kiD -h -AFFF F0 HT_B@Fh+iBjiC;R#P-(F$3hFB0`HF)F4` -h-E FFF] F nH+h#eHF&XE+hB .`WH 46D%i;&FEp4FBsachg`<`{`` c6 FVO3c8(F}9H$h1BB?/(Fk1H,=O 2O3YBRBUEAE*ѥhhB&jjjjBBLje#S``#`C`*FhXEM,hB jH" I F $hHӇ H輅7@u RCOC BR o j0-MFCKFB}.{(O^O2@(f(qO<9HhB8Hh)E-EU$AE| =65OC FpF(B$O4 FU<4@e @7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFF#(F"F;F1FF#h#`(FFFFF,#"F1F;F(FF FLpF FF2F)F FUF Fp FFFF &L F!F3F*F8FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H|F Fp H e紒X 䅀6䅀J䅀^䅀x䅀a-AMFF$FO20F)hX"8Fih ( #h4,  Ņ-AOFFBFFFKB(hqFh+FBF9F0Fu( F#+`$ FDF8M,h4+hiDBch[  3+*"h2D# F8@0 "! F M!FO2(`Z"+ha!#FE@ J,F@F!J H"F F0UbEfiVa `L#h3 H H#z ! Jch S h"(HӇ b_%b#-M`O1 F(qFDF'; EJ٫:F 0F+"F "1F)JFB0@(FF0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 𵋰"kF :F LH v"#)Fv H(#BB(F\ F TbGb-E2CFF0H /H.I.KBB"i)F :fisB#iDB  O18FFF+hS "9FPFk##QF28FS9FH Z QF8F@"PF I kh+h3D&ubUbEfiVabL΅O1 F(H *HO2#!F#H"#F(#*s H F iBBH FQ('^ Gbbub-MFD0FFF GL F*)л+S**#*"9FPF@F$@ѻиv QF8F]FUsih)3)L&& !- 2K,++hBFQF8F}F"[FLLNih1CЍAE .(F),z?vxrpFF++(#J##J# FpLLJKFcKScKcKd2P 3 }/0@7H #FFF@bFKh)K#!غ"#K!#JHHFH Fbm f| 8oo(F F8@M-MFFv! FF(1F(F/zF(nXFRIF(h#F#FFF(]AFPF g@F{h;;lBK#" fg;K"o$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUp.b-AF FF8#x/+6BF/! F l(FF!F8FF88F(DFFBBРF04/+/!@F J(F4F)FBF8FL(F%o8FF F C!FF(F8@8FF F 6!FF(F8@-MFFFFۻoF$%F&F{TE;2F=I]/):BۚBȿ"DB!F@FF(Ы[Ex+/"6]TTE B"-ȿ5zU!F@F^ao#"Fo -AF FFF0,O8@F!o BoBFB3`B8F&J Fo "(]o pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FzB"!Fo-AFF FF QFB BF!F8F h*F! F - 4-D s9FF%B(Fp F1 S0DB5o-EFF8F %FDEO5 F /0 EذBTF52F9F F ((FoFF0 +`$ FDB-O3 F1 C#DB-o-(`F?FJ "FUFn-A#)F Fo F:F(shB0FG('F%F0FAF+C' (o 8(<S [Ȅ{ȄȄDŽȄȄȄȄQȄ-o 5"-AF0Fx++睱= kFAF0F(Fo o  @*B*F DY#Fpo-AFFFF B(F "F9F*F0FF Fo#F CF FhF(  K@BS K(FpGHpGHpGHpG4dtddi'+لhD$Bh"DB jBh XB   8F(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ  oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(F O S#ah2F )D6? `fbh*j )D `+j#b-M(FFFc [@Fh 6!j&DBFF 0FF&-Jۡh QD!D#" F 3FPV@F #j;#bFkh%j -)D F!D8F("jD"bpFAF&O@q0-`0?`0_`RF*F-MF FFFع(FO.i"F6#(F#FXQ#?O` F-AFFiF(F&B 6#F(F)DA"O4 F-AFFFF`BF9F0FF-CЈ0F#" ($l` 3 `BF#F9F0FF3FF(&2F)FK FpsF FF_)F2F FF9"# F 2p-MF FFFC(;CFRF)F F(6C1)F F FYF8(٥h-]Df'"1F FtOscQ4F:F FBFQF FOsXF>Ds`opFFFF "FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FF/0F.si +O tj$"FYF0F:F)F0FVFOSka?kbo` #0FY (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(F K?+`OSkaOSo`ai$a 8F_F FcjB!F Fh"jDc`(F88+ h+o F]o JC o eJC  `𵅰FFFF+hbo :F1F(F$FFopFFJF FC+3F!F(FJC+!F(F@(F p2F!F(F(!F(FCldfd-MFFFF(F F(FP!)F F - Fo  F1F KFh HF Z(0"  j :D F '# 1FF FF( CE)F F^")F F1FF F8CF(;F*F FF()F F-AFF$FFAF8FJ`+ohZЫkFAF8FJFXF0F~( 3o0F@-,`ee-AFFFFFF(F AF(FY(F !F(FkFA1(9F0Fe(!F(F"!F(FH9FFF0FBF9F0FC(F#F*F0F(!F(F*o -MF F3(F,0F |F(DF (F(@(FI +g2(FIF`1!(F(Fր!(FJP!0FJHCF!0FJaF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGKӇ(ܠa+ 8pGBpG3Z*pGKӇpF$B 5`104.pO10@91?"?+pGpF8FF,F Fp2F!Fk-AFFFFO1F8FBDEd`O@9FEDFK#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4L DB;C@۲40 P F0M\B0K$5@`@PޅF FF @" F |FC +h$ FphF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0F#Z`8F1F F,a F0D7"$FhF F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`>f"$hFF"!F Ff"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(GTquKf:hFF"!F F ##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`>f"$f"$%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FH ;FT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3F i-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N8>DD@k@3DNjsc N>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ-EFia(CiF$3CaCiTsFCa@ TE"FEҾRF9F(Fs@8"!(F#i)F#eci Fce1!F"0F Fp@X"!!7-AFK3)Cc3#FF3EBiF8F.FE(FF!F2FhFW4D[#Eg"pFF9hBphQ?V"`2fE `-M# FFhB&FhBE#3DFS&0AFFFO *hh$Chhh!hEd@)F6F S,0+KFhS,0  +RKN+8R=B@?pG-MFF`{`*hih{cCFBF1F0t;i2FAFZFAF0F{j;iV#R# B;1F09j S-BA+h9jxh#@2FAFh CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@NIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3ܿ-EhF?`(ChF(3F(C`@ ERF@<"AF(FLL=Ll;<L,:LL9Ll78L,6LL5Ll34L,2LL1Ll/0 L,.LL-Ll+,L,*LL)Ll'( L,&LL%Ll#$ L,"LL!Ll L,LLLlL,LLLlL,LLLlL,LLLlL,LL Ll  BjL, LL LlL,LLLlL,LLLliO,slKDDjiiDDCih hOs>C^ih H iiDD   KjDDO(ivhD hO~8C h  hX iJ D    JN BD DDO(uhhDbDhOs8  J XD JbD(C DDO,rlDO{<   J h\DDBD<DDDO*rjDK O|>   J ^DL  DDDO(uhDOv8 J XDsD DDDO(shDF Ou8  J XD LDDDO(rhD  E O{<  H\D   D DDO.znDfDKOr> H^D    B  DDDO.snDOv>H^D eDh   D DDO.unDFOs>  /BD7q۵[V9Y?^[1$H ^D    C  DDDO.wnDO{>  H^D  4 D DDO.znDfDKOr> H^D    B  DDDO.unDOv>H^D cDŠD DDO.snD FOu> H ^D DDDO,wlDDE O{<  H\D OLDtL,DON  DO,DzlDDvDKOr< H\D OLwL ,DDON ` DDDO,slDBOv<  H\ D OL FDONsN. DD DO,wlDOu<   H  \DDON(DDOHwH( d  D DDO(whDE O|8  } Ut]rހܛtiGƝ̡ $J XrDD ONL DDOHsH($`    J DD DO(whDOr8XvDD 3F ON B DOHvH(( D   D DO(whDOs8uDJ XD ON  DOHuH( d  D D DO(uhD C O{< H \D OL ONDvN.D 0 K    D H D DO.wnDOu>bD^D OL  DE D ONrN. 4` D   DDO.wnFDgDOz> H^D ;FJOL DDONwN.  8    D DDO.wnDOs>   H ^D OL ONDrN.D  <h C     D DDO.wnDeDO{> H^D o,-tJܩ\ڈvRQ>m1'  OL DD ONuN. @\ D   DDO.wnD  Ow>K^   H D OL D DONwN.  D    DDDO.wnFDgD Oz>G   H^D OL  DONuN.D HX    DDDO.wnD  Ow>J^   H D OL DD ONtN. < DDDO,wl DwD O{   H ^DDOL D8DONxN.D<@D < dD4DDDDO,xlD,D4O|< \C H DDONDDOHvH( D䁆  DD DO(vhD O|8F    J XD ONDDOHzH(DD4@<  DHBIH.DD< H^D OL( DDONxN.D(D<  D( D@DD< H^D 00OL DDD ONuN. <@  DDD@@O.xnD DFOs> H ^D 88OL 0(D,D(ONxN.D0@<0 D  < |DDDDDO.xnDC O{>  H^D OL8 DDONuN.D4D@4 @  D H^D OL D@D ONtN. D8  D tDDD88O.xnDcDBOv> H^D OL D 迢KfpK£Ql$օ5DD ONwN. 8<  DDD< H ^D OL D$DONtN.D<8 @  8 TDDD@@O.xnDC O{>  H^D OL D(DONwN.DD@ H^D OL DDONxN.D8@  @8 4D

 H^D OL DD0DDONxN.D<  <  D@DDO.xnD FOs> H ^D ,,OL 8D4D8ONxN.D     DDDO.xnDC O{>  H^D OL , H^D  OL pjl7LwH'4 9JN DDONxN.D   DDD O.xnDcDBOv> H^D OL ,DD,ONxN.D   L DDDO.xnD FOs> H ^D $$OL DDDONxN.D@ @    DDDO.xnDC O{> H ^bDD ((OL $ D8D ONxN.       DDDO.xnDfDKOr> H^D OL( D<@D@ONxN.D$ $   tDDD O.xnDcDBOv> H^D 00OL DONzND.   D  F DDO.unDOs>H^D D44OL 0$D,D$ONxN.D   \DDDO.{nDbDCOu>H^D OL Oʜ[o.htocxxȄnj4 DDONzN.      pDDDO.xnDfDOr>EH^D OL,D DDBONtN.DD DO.tnDOv> H^DDOLD DOHDzH(DDDO(thDF O~8   hXJ DDhDDi CiiiD j Cj  $ElPxq-EhF?`(ChF(3F(C`@ E(RFX@<"AF(F& !p@@BWxqEtF>Dx242O7@&d@gDGE@  aE0ҀIa!O1U`]`BR2B`@B)s&43a8<@ >eEADqD6ٞFED AEcD'aE< QDADeEqDUDED FQEcDB mDϋBqFF-;F =Ox-_p x3pBB{eEADqDٞFED AEѭKx={pxp??ё=13/>OU 9FcF;G '* <LL31IxYp3</#G#FgF?(?LO&aD IMO5&9DI !Tirii-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0⅀P⅀텀䅀i۱$"aBcOBDa`aZab`\``bbbcccfed Fo8F F*<x1*9<+7o8#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoou*}*8FiCjkk32"cjikjGj"cjiG a8o-M*FFOD xDOsBE=,DB٤D FJ )DD DDD DD DD DD DD DDDD DDDD DDDD DD\DD D D:,D+D,D -MF(Ii,FhCh+A#hk + ##` 00k0#%+'(2HN4\jnu ##`o1o hR #/$;?@D5-ٓH3B"FF"a ,`#^F]Fa#`##a#jO2ch0! b!K0#+ПK6 bj3BҜK="ca # #a F4 F#`o/ʀ;?@D5-+&a`OЊK#j"`#i"i ,`a%#.F#`-@Ҁ#j^`#i"i a%#.F#`-@ǀ#j#`#j2 `#i"i ,`a%#.F#`#icЀ-@#j&d^a#i%.F##`#iX-#lFB(F#"jixQii bE `DDbE:RZFQFL#iZFQFiJa#l  D#d+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFiaDe 0p0jccK#h+{0BuPhk(@U"ij 0(Ghc(@H##`o/;?@D5!/;?@D5,/;?@D5A"i ,`aCiiii"j*?9a6"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFi{aDf##`#i- "BгKh"j*Sb/?R+?@D5%.F"j*@#b"#jc"FFIa4 #/?4;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=~vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZF  D[D#l #d1/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?c+?@D5-Zf7J=2083$ nB 0JC+cfd#ceXFQh(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDh#h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03`2 h8D0 hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4蒈-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(F蒈-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% }iD 8?C[E \+ 5wD}h{a5#Fhh"F!0FL!O= O\;iB # F3p!F hF`(яChh:sцP/Rh:oFFF1F^E\.уCFxkMn蒈-MF;mFO # FF` "K` :PF "K1F"F1#+U;m.#RFymh'l:m`C0s@0(OpAFP(F@F0+<(F (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(Fh+ѻhh:mBTPAFl`!h(KHh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HcX0Fh9m(?QHk蒈nn0oFF$'khB *hX+40G(FFKJKF(F)F0FJFGB);F J0DBؿ$p)J0D0F ~oy:aoF F!ǿ"iF iFH 3]-M F'<"   $+C C$ C  2K]fF1HMù : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$Hr!FHm1FHu3owo{oo-MFF@+FFFF@ F$)F F3XRF0F-IB('FO Dj  E #D0B2#.&}C!LB."P3kDH,I-0K*00FIDD  - 00۲ +0 0;xg\ p32oH1jo-M=kF@+FFFF@ `F%1F ZF3O {`-kFzh УF`h2FQF@F#FF8`h G;hDD8o 7F , F-A FFFB(F7GE(GF!F:F(FZзB!eE!F pPB=D5ӬE4  3eEO 7003 ` A0þO00#0FNF F4hhO D4hdDdhB#4hDD@dDE(O2RE  *F!F( #*F90$ F "p@Bdp FFF 2F)FH FpOp#FF F "czh DB hD2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`xppqq.q7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpF1O2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80_F,F F8!FGF 0\1FXF"@ PF11F@F@" 8F$!"@ "!- "   !(F"  F!XF" PF!@Fo-MF"F FhFI0F"IKnFOOFO*zO- s] F 9F*J44-텀텀RFF=(D@nF%65-F ѽ0"[ CC[00iF?C F0vp0 FFhF*F!FhF0FhC3SCC`pGH⇀K`pG⇀ #FFFVQ AHqF &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '6M7N FEO | ӽM(FF  O O @  'HA A" OC O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@ F O  &>+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p3N-AF*K*FFF 9 F'B<"pB "B0Bp;2B+Bȿ#D#F !!!F(CD? B ,B"p7B8p<3䅀F%KF*FFF0FF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2q-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p|$L-+G0+gУ0 *M FO F;0 .[ x.+kKxN0 *_1F# F+0 O#s1xz)]g)^L)W62xx*b*j%*X*WE<%#;p3x|+E{pDFsxq++Э +#+*+UDDDD@D30O8"0*+U;FO3#Z)O1HhҲ l)pxl(L!6Fc:*P"xzvvvvzvvvvzzxvvsxvzvvzBF;F !SE8p3:*ܸ3ؿODؿ#DWE8U;8;p !#FGD* ܸ3ؿ#D'F6SE8p3l)U+QF48FCFFl)FQ+qxFU)I)M)RD) и? OD D! i)tm)@a)O hDa#QF8F#B4QFCF8FFFbF(FQFCF8FF(F_JIsx\3FRFD@"@ OF    I* O:2p2*"$@ p4 CFND@x$@4)w; F F <9)E"*T  FO.xl* B*L*""(F s*(F@F"4CFQF8FS"1l)"0I o  F+h t)ѫF[+5%Fih[+8F FQF]FFF![+F[[*E1qd F`B ` F S+Q]pGF FoAFR]pGmF F@AF F mQ ]pG#F M Oku5 F !2#F$01 +.FO0F𒈀" Kt J]Fs] s𒈀l)7 F"F x x@ 07 FFJ(` x x@ 0K\D C9(Կ08W8pGOppG1px0+CxL\D۲x+"0F%&F0xB `(Fp*"* "1"ѿ "ο#`FFFFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`1xF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1A18 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`81pFFA)KB J \@Fl;]v `!p@)B!`O0p1"տ!xF]F#Fy"?'_xe!F#x F&0F -FpF%@ F0D5BFh F@ۿ-EFo9K5b2$d!@FlF)Oq@Fd!Կ''@mD K :S*0!DhDN a'O0Q(Ņ KpF F\d!(F*)Oq(F$!cXBXA0Dp y-AFAJC$4%FF>JeBOu4$$S8N#D- EE!((Fa@m1Kxp2@m/%%RD,,%ca(FAF#F$*F -#F*F3`K2:a#Oab f`K#<"[ f{`#>`;b8d!@FYOq@FI m D!JrE.€QQų-EF&O8 jD# uB ci+#kHh#CЩh@F!D #BB!@Dj(??1!? 6pF&Bki++kHhpj,DhC#Cch+!q!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@D8ii(??1!?6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? {6+Bۨi!i)DO&('KhFBH_ +H ELFqq#J`J`J`J`KJ#?`pGX`\TEH-M KFhFF0F@I!"42TO &F! apppqqRFIfq 2F RFAF 2FKhMH~8μp N MI2h+h hS@ B L Kh HX3h#`"h(hp@I"``ļ༈\ܼr8KhP A1JhB  L#h3 +#` H&#"#`K```PL.r-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQFC B ѣyyC#г6@0F{#q#qFBFF4:F!FPFBFF&I:FYF F F51F*F)F8FMO;h+"KhSEN0h"AF#MFFRF FLG"AF(h!h(h#;`#`3`Yrļμ`\X,TKh8 pG`-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*{ [2!!p!ppap#qbq4GH4FhK'F #;F`pFAF8Fy>H!(b"!;H(\^##p#'cp#6Hpp'q F(Z(Ra#cq#qq:F0F4+H*K'F(FF@F<#;FFAF`p8F77"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)tw ]##p#cppp41F H 4;9_ֆ_mrzr-AFFB!x)ѽ)ex3C)[2))@5,D3+R#ˇ///ˇˇ//////ˇ)S!7}//////////ˇ/ш)"/H}"-H",Hscx+")H- #*F&I'H':F%H^##JU~/F?-@#*FIHn?':FHJ#J/F"HxKpa"HKWO*F8F,MHDIO5F༈ܼؼԼrrrxldhr"sF1F KB#MEq+p+x1Fl+xl,p@pcScd-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDylKx l4 F8@hKx+Ob!FfHeI xdHQF"cH\#3`aKhp^IF_Ho!F)M 3Zx2DWHMؿ"TIF( "QF++?yLN7h/?}/?q/ FAFO FjA0BI@)F@R F=IOb F#D#wcw#0JwFwh 5J R$ "% 4BF#&IF8"IBF BFQF!J9Fhp D# FC"O1i)DcScȼd_ļs3sμp,}~8Mbh K`K`"K`K`-M$cOcH<`(!F%_K`_K`Hh%1`p@@R! FYIOb F\O #VJDwwFhOQJ R$ "% ("#","0"4#FAF8":IK+F*FQFpF 0FC# (FCC Cc*K-h*1 "@FD$Kh;H#P " C" FD#O1sKIh#H;`)DLpIH"P2`pHst,Ys~8Mbμ}݉KhKhBH@Ƽ J Ih@oOcFF`@@tms}( (h] 8FkF#h FkiG"!( 88FjL !F`h0ahHCo8+y+ F8@I!ssFCl hki㱀l1 F,yByCyCyCzCBzC#h FkiG&ah@H(ah@HssF F(F#3`3qFIF"lF(MBI"lF(E+hki+SO Fp $oos( ,#H Fp!H0F(4F(/$[lHHZhl.BHK[lDo+Hn  o%utv݆tth#` "FFm(opFF FFt)F j}hBi}+}}C#}8A! H[IhG𽼼⇀⇀ļu@KOsB @s@ B   pG pG⇀pKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjt⇀μ8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuμE"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "`" Y! Fr rFFB"w"JFh!4{rd+uu#",v$kuulvvvļ-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(Fz 4$K`K`K`K`K` F O0o,~88`XTLP$$) x"+219:*K? "+#ppG;:!HQ8 (()) + #@J?O( KhcH  Kh#HKh H"IH(CF(Hn H H 伈/uRuļqu텀μuuu H`" K` (H>"K @feφu("\K-M`O"YKYNhZO`F$e F#;`MK`-/'7 )HLY4( DK` "AKo`>H[7":K`^/"6K`@"hb-Jh/JhB"h#`G3h+3h++2+0(F((woLE"hbFH!hHKHh --Z$h)o?伈(84` vļ0vF~8膀-AHF FF:!@FF@FCop8`*Fq F# ,D<(*FIFCF#IҲ]2vhx0; +!@@pOpFK ⇀FK ⇀"K`$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fh%!J!ueu[v#vuu%vevK6`uK u(F` K`@伈Dv顅,`8ļ輈TLP-M }F FF#+" 1 N%KhB"#K`0+Ob% QFrrqqF","YFPF'! F~r r%uuuqu u FFD9F2F 1F(FM"伈ļ LhFl hF!h8K"h` K`dO0~OKONh2h:*\fs\\OrREI F(CH0D FAIAI@K@Jh42?I F Fl'0;KD:F Fh9I8KD F:F6I3hD+ 4K+ F:F2IDe$/K0J0Ihh h/H"-K`ObR+K$h[k%ObRO@s(k%I$%ObROs(kI$%ObROc(kI$%$%F,𼈀UvE㇀Mbwo[v⇀gv⇀uvȼvvv-MJFh BѤO9h)УJhBЊ*- "o𙁲oв@`"o:`J L`BؑKKM IPF/Fx(FJJBFH#;`IPFFx(FwKh2ЀH#;`IPFF a{K`{IPFF VlK5.uN`@ EEnL#E^J3#D\J~璲)2` WIWI!9`RI* `O`I0 `_I `_H1h^Hj]HM9)0B?PDrkNI h3 `0C0MK`BO9h)Tи03B( F2"SCEK 9hB53h@I0@K=h?K`-Kh 3h!9L#h ,"" *B&H|/Hy"-K# #K2K !hBP.)F# Mbv⇀⇀vE㇀vw~v w-w⇀㇀Bw@!F)g8Hb# 5+3+24L3h"Bw1J#D#nb.HR!rc[;+?)Hl*f*FC0E0B[ M;h00+H8hMJ[(h>(`pH)hOzs!XCJGH0J#h IH"K`>wqwwjoy؆jw𼈀_Jh3`JhBIH@' Hm K Ih Kh+н@㇀www㇀-EL0##0|HO "! yHF( "!vKvHK2h`=K>I(h`"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0xGX:' Ne NX8'>>$>+>2>9>@>G>N>U>\>d>l>t>|>>>>>>>>>>>>>>>>>>Fj B ? `[R1=C.)DyPAA(;S(;(;]e(;(;(;(;(;(;(;(;(;(;(;P(;W(;(;(;(;(;(;R_oy_IPV9k II*I , ? O Y e o <ↀކEↀކNↀP`Y.k †@D݂݂W遀遀遀2a35253110m膀`^ PX`hYwC(", *$.)#-!+%/=i6=5.55M5ل5=5= 7=6=6=5=m6==> >>56U  c_????EnnlnnoommEo_໅໅.--q-![NYd9ir;sMstttctGt+tts5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +NYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIi-тŃAa͉UQ'hUh=OtUR1h񹄀2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b)Ag ɟ]8(Ht@ @ ^-_'@Bdddddd ee-e>eQefexeeeeeevt~qu̘ܘk:fkO@x}uu@x}e 9NYpqu3;3;3;3;e4;3<=4;4 <3<4"<41<3@<3(;RReRRR  @ @    @Eނ)ނMBZMM]MLM"M(M݄LɁՄ}ˁ߅󅁀 ㅁ煁مmѱWلI $YM$MMM"1!ME$MWM W녁ʁKKEK K KA_K L K KK]eKKKKLLL&Lނmπ}EπɀɀK=߂ʅ ˅ D̅4P̅Ft̅ Xͅ  ͅ $˅ưQcmy9xCv `ppp@@@@@@@@@q2;Zx0NU~?󀃀Ņ ņˆ󀃀͇LJц_mqف䅀X䅀X䅀8䅀8䅀8䅀8J䅀X^䅀X  2FUdM7U7^7r77{"e!!!!a     c9\r9Lˇ/+.+{+e+CA{AWA""""#9| c{Q{z ZY^77777779999!1-,0 ! (  9 2X܆!܆Tv~0!%(,/269=3Dh&oy.9#@ "',38?FP[wfglv66p     Ŵ?ᰆ  / I e Tl    ܳ $<1IR^l. ?. ?:S 1  Ȳ ٲ T沆% 1  > I Td   ϱ 鱆 Ie߂Q߂ @ @`00P]`FC=݋#1--'?Mބ}fa߄ބf݄fM܄܄.낀낀7삀)삀.  A. @@/ @@/ A/ A / A+/ A6/ DA/ J/ DU/ `/ Dk/ t/ D/ / !/ !/! / "/ "/,[A/,[/ / / / /  / @/ / @0   0 q a0 q0 #0  *0 @100800?00 F0` aO00@V0@_0Ph0`q0@@aF0` ax0`@a0p a0p@a0@a0a000`a0pa0`a0pa0a0`a0pa0qa0` a1 a1@ a1@!a'1P.1@a71@ a@1@@aI1@aR1@aZ1@ab1aal1qav1"ah(s*K>;K99::-:A:R:e:v::mU6;2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.BootCurrentBootNext1234567PlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      'hUh=OtUR1h   +,;=[]__of_translate_addressfdt_fixup_memory_banksrequest_and_set_gpiodo_bootvx_fdteeprom_rw_blockraw_accessdo_gptusb_setup_descriptorwrite_mbr_sectordfu_fill_entitydfu_read_medium_mmcdfu_read_medium_nandwait_for_eventomap_hsmmc_init_setup__put_mtd_deviceverify_bbt_descrnand_transfer_oobphy_device_createfastboot_mmc_flash_writeg_dnl_registermusb_g_ep0_irqallocate_instancemusb_host_rxalloc_double_indirect_blockext4fs_put_metadatafs_devreadefi_free_poolefi_runtime_relocatewrite_sparse_chunk_rawdfu_readdfu_get_medium_size_mmcnand_block_opwait_for_bbmmc_write_dataadd_mtd_devicecreate_bbtnand_scan_tailcomposite_unbindmusb_rx_reinitext4fs_log_journalefi_free_pageswrite_sparse_imagenand_fill_oobnand_detectdfu_writedfu_flush_medium_mmcdfu_write_medium_nandmmc_read_datamusb_ep_programdfu_get_bufmmc_file_opdfu_flush_medium_nandmmc_reset_controller_fsmmusb_h_ep0_continuedfu_write_medium_mmcdfu_fill_entity_nandomap_hsmmc_send_cmdmusb_h_ep0_irqfdt_find_or_add_subnodeomap_hsmmc_set_clocknand_waitnand_select_chip(((((AAAAAABBBBBB$[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead $demo - register cyclic demo function cyclic list - list cyclic functions bootcmd=run findfdt; run init_console; run finduuid; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x82000000arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxmtdids=nand0=nand.0mtdparts=mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)loadaddr=0x82000000kernel_addr_r=0x82000000fdtaddr=0x88000000dtboaddr=0x89000000fdt_addr_r=0x88000000fdtoverlay_addr_r=0x89000000rdaddr=0x88080000ramdisk_addr_r=0x88080000scriptaddr=0x80000000pxefile_addr_r=0x80100000bootm_size=0x10000000boot_fdt=tryfdtfile=undefinedfinduuid=part uuid mmc 0:2 uuidconsole=ttyO0,115200n8partitions=uuid_disk=${uuid_gpt_disk};name=bootloader,start=384K,size=1792K,uuid=${uuid_gpt_bootloader};name=rootfs,start=2688K,size=-,uuid=${uuid_gpt_rootfs}optargs=ramroot=/dev/ram0 rwramrootfstype=ext2spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}ramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzspiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootz ${loadaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootz ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A335PBGL; then setenv fdtfile am335x-pocketbeagle.dtb; fi; if test $board_name = BBBW; then setenv fdtfile am335x-boneblack-wireless.dtb; fi; if test $board_name = BBG1; then setenv fdtfile am335x-bonegreen.dtb; fi; if test $board_name = BBGW; then setenv fdtfile am335x-bonegreen-wireless.dtb; fi; if test $board_name = BBBL; then setenv fdtfile am335x-boneblue.dtb; fi; if test $board_name = BBEN; then setenv fdtfile am335x-sancloud-bbe.dtb; fi; if test $board_name = BBELITE; then setenv fdtfile am335x-sancloud-bbe-lite.dtb; fi; if test $board_name = BBE_EX_WIFI; then setenv fdtfile am335x-sancloud-bbe-extended-wifi.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fi; if test $board_name = A335_ICE; then setenv fdtfile am335x-icev2.dtb; if test $ice_mii = mii; then setenv pxe_label_override Pruss; fi;fi; if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; init_console=if test $board_name = A335_ICE; then setenv console ttyO3,115200n8;else setenv console ttyO0,115200n8;fi;nandargs=setenv bootargs console=${console} ${optargs} root=${nandroot} rootfstype=${nandrootfstype}nandroot=ubi0:rootfs rw ubi.mtd=NAND.file-system,2048nandrootfstype=ubifs rootwaitnandboot=echo Booting from nand ...; run nandargs; nand read ${fdtaddr} NAND.u-boot-spl-os; nand read ${loadaddr} NAND.kernel; bootz ${loadaddr} - ${fdtaddr}static_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offnfsopts=nolockrootpath=/export/rootfsnetloadimage=tftp ${loadaddr} ${bootfile}netloadfdt=tftp ${fdtaddr} ${fdtfile}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpnetboot=echo Booting from network ...; setenv autoload no; dhcp; run netloadimage; run netloadfdt; run netargs; bootz ${loadaddr} - ${fdtaddr}dfu_alt_info_emmc=rawemmc raw 0 3751936;boot part 1 1;rootfs part 1 2;MLO fat 1 1;MLO.raw raw 0x100 0x200;u-boot.img.raw raw 0x300 0x1000;u-env.raw raw 0x1300 0x200;spl-os-args.raw raw 0x1500 0x200;spl-os-image.raw raw 0x1700 0x6900;spl-os-args fat 1 1;spl-os-image fat 1 1;u-boot.img fat 1 1;uEnv.txt fat 1 1dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw raw 0x100 0x200;u-boot.img.raw raw 0x300 0x1000;u-env.raw raw 0x1300 0x200;spl-os-args.raw raw 0x1500 0x200;spl-os-image.raw raw 0x1700 0x6900;spl-os-args fat 0 1;spl-os-image fat 0 1;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_ram=kernel ram 0x80200000 0x4000000;fdt ram 0x80f80000 0x80000;ramdisk ram 0x81000000 0x4000000dfu_alt_info_nand=SPL part 0 1;SPL.backup1 part 0 2;SPL.backup2 part 0 3;SPL.backup3 part 0 4;u-boot part 0 5;u-boot-spl-os part 0 6;kernel part 0 8;rootfs part 0 9mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; run extension_init; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; run extension_apply; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileextension_init=echo Extension init...; if ${extension_need_init}; then extension_need_init=false; extension scan; fiextension_overlay_cmd=load ${devtype} ${devnum}:${distro_bootpart} ${extension_overlay_addr} ${prefix}${extension_overlay_name}extension_apply=if fdt addr -q ${fdt_addr_r}; then extension apply all; fiboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 mmc1 nand0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_nand=run nandbootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=extension_need_init=; setenv extension_overlay_addr ${fdtoverlay_addr_r}; for target in ${boot_targets}; do run bootcmd_${target}; done !Device Firmware Upgrade0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1hEthernet Gadgetarocsdxbimask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  Android Fastbootaddr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.$0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to LZO  Texas Instruments - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand'|'spi-nand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel) #(-27 not set. Validating first E-fuse MAC eth1addrice_miiserial#board_serialunknowncdce913@65(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... CACHE: Misaligned operation at range [%08lx, %08lx] Clock enable failed for 0x%p idlest 0x%x Clock disable failed for 0x%p idlest 0x%x AM335XTI81XXAM437XUnknown CPU typeCPU : %s-%s rev %s TSTEMUHSGP1.01.11.22.02.1Clock synthesizer reg write failed at addr = 0x%x failed to get device for synthesizer at address 0x%x Failed to send command to clock synthesizer board_nameboard_revCannot read i2c EEPROM BeagleBone Cape: %s (0x%x) Error in memory allocation %s-%s.dtboRamdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid ## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command ## Booting Android Image at 0x%08lx ... Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsizeloadaddr## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command VNDRBOOTANDROID!boot_hdr or data params can't be NULL Incorrect boot image header For boot header v3+ vendor boot image has to be provided Incorrect vendor boot image header #BOOTCONFIG Android's image name: %s Kernel load addr 0x%08x size %u KiB Kernel command line: %s Kernel extra command line: %s Error: malloc in android_image_get_kernel failed! Error: Boot Image header is incorrect Error: header_version must be >= 2 to get dtb Error: dtb_size is 0 RAM disk load addr 0x%08lx size %u KiB Second stage bootloader is only supported for boot image version <= 2 second address is 0x%lx Error: Invalid FDT header for index %u Error: Index is out of bounds (%u/%u) Content print is not supported for boot image header version > 2%skernel size: %x %skernel address: %x %sramdisk size: %x %sramdisk address: %x %ssecond size: %x %ssecond address: %x %stags address: %x %spage size: %x %sos_version: %x (ver: %u.%u.%u, level: %u.%u) %sname: %s %scmdline: %s %sheader_version: %d %srecovery dtbo size: %x %srecovery dtbo offset: %llx %sheader size: %x %sdtb size: %x %sdtb addr: %llx Error: index >= dt_entry_count (%u >= %u) Hunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkdhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-stdextlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efiPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootefi %lxbootefi %lx %lx/dtb/dtb/currentbootmeth_efiu-boot,distro-efi#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesetherneteth%daddrlocal-mac-addressranges/__symbols__failed on fdt_overlay_apply(): %s base fdt does not have a /__symbols__ node make sure you've compiled with -@ The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeadtb_idxfdtaddrERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Unsupported %s address size descriptiontimestampdatadata-offsetdata-positiondata-size%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable %s Timestamp: hashHashsignatureSign%s Description: %s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: %sCreated: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): ## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into vbecompatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s aslr-moveaslr-randefi-runtime-randrandom-randarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetVersion: %s Vernum: %x/%xvbe_simplefwupd,vbe-simplecur-versioncur-vernumU-Boot bootloader-versionfwupd## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Android image found FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 14.2.0-4) 14.2.0 GNU ld (GNU Binutils for Debian) 2.43.1 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s serial addr width shift clockbdinfoprint Board Info structure%s is not a valid uclass Cannot find device %d of class %s %s is not a valid driver name %s is not a valid node path Cannot find a parent device for node path %s Unable to bind. err:%d Cannot find a device with path %s Unable to remove. err:%d Unable to unbind. err:%d Cannot find driver '%s' Unable to remove all. err:%d Unable to unbind all. err:%d unbindUnbind a device from a driver unbind unbind Bind a device to a driver bind changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticfunction: %s, cpu-time: %lld us, frequency: %lld.%02d times/s cyclic_demoRegistering of cyclic_demo failed Registered function "%s" to be executed all %dms cyclicCyclicNo extension registered - Please run "extension scan" Extension %d: %s Manufacturer: %s Version: %s Devicetree overlay: %s Other information: %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. extension_overlay_cmdEnvironment extension_overlay_cmd is missing extension_overlay_addrEnvironment extension_overlay_addr is missing extension_overlay_nameWrong extension number Found %d extension board(s). extensionExtension board management sub systemscan - scan plugged extension(s) board(s) extension list - lists available extension(s) board(s) extension apply - applies DT overlays corresponding to extension boards apply-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s: Cannot find udev for a bus %d EEPROM @0x%lX %s: addr 0x%08lx off 0x%04lx count %ld ... eepromEEPROM sub-systemread addr off cnt eeprom write addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quit## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx Working/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d readingError %s the chip: %d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32loopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %0lx %04xZero length ??? byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: User Capacity: WRREL User Enhanced Start: User Enhanced Size: Boot Capacity: RPMB Capacity: GP%i Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc setdsr - set DSR register value wperasesetdsrspi-nandinvalid partition number %d for device %s%d (%s) Device %s not found! %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect mtddevnummtddevname%s%d,%dcannot add second partition at offset 0 mtdparts%llug%llum%lluk%lluinvalid mtd device '%.*s' partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition 0x%08llx@0x%08llxunexpected character '%c' at the end of device onenandincorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=nand.0mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable mtdparts=device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions no partition id specified partition changed to %s%d,%d delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: no such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null current partition deleted, resetting current to 0 partition %s not found define flash/nand partitionschpartchange active partition of a MTD devicepart-id - change active partition (e.g. part-id = nand0,1) of a MTD devicenot same typ %d != %d Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx Device %d: %s.jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Fit image detected... ** Unknown image type ** Bad FIT image format Not a NAND device bootdevice ** No boot device ** ** Device %d not available %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b ecc strength %8d bits ecc step size %8d b subpagesize %8d b options 0x%08x bbt options 0x%08x nand_writesizenand_oobsizenand_erasesize (bbt reserved)quiet no devices available Device %d bad blocks: 0x%08llx%s scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu rootpathdnsipdnsip2domainautoloadNET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part type : - set environment variable to partition type part set type - set partition type for a device part types - list supported partition table types-ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-am33xx-am335xdefault-arm-am33xxdefault-armmallocReadWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-systemHex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent-pext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr' time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneKeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** udptcpusb_dnl_fastboot USB cable not detected. Command exit. run as a fastboot usb or udp device[-l addr] [-s size] usb | udp addr - address of buffer used during data transfers (0x81000000) size - size of buffer used during data transfers (0x7000000)## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Argument image is now in RAM: 0x%p fdtargsaddrfdtargslenWARN: FDT size > CMD_SPL_WRITE_SIZE Argument image is now in RAM at: 0x%p Subcommand failed SPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatagsusb_dnl_dfuDevice Firmware Upgrade [ ] [list] - device firmware upgrade via on device , attached to interface [list] - list available alt settings dfu tftp [ ] [] - device firmware upgrade via TFTP on device , attached to interface [] - address where FIT image has been stored ${Failed to get partition driver count Error insufficient memory gpt_partition_listuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname | %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d | status: %i Error: %d (%s) Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s First, set the PMIC device! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: --PMIC max reg: %d Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx Can't write PMIC register: %d! PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read address - read byte of register at address pmic write address - write byte to register at address %s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: Please enter '%s': %zX## Error: %s: only one of "-b", "-c" or "-t" allowed run commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprintexistssaveenvsave environment variables to persistent storageNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildonebootcountbootdelaybootlimitWarning: Bootlimit (%lu) exceeded. Using altbootcmd.altbootcmdkernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: NAND: %lu MiB Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! modelModel: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: Auto-update from TFTP: updatefilefailed, env. variable '%s' not found trying update file '%s' netretryCan't load update file, aborting auto-update Bad FIT format of the update file, aborting auto-update Processing update '%s' :Error: invalid update hash, aborting Error: can't get update parameters, aborting %.*s%*s y Y yes YES stdoutstderrpre-reloc realloc() is not supportedalloc space exhausted (unknown)Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> md5sha1sha256crc16-ccittbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKRKMTDVirtIOBLKMAPUNKNOWN(%d) device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** ** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsd%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type MBR%s: failed writing '%s' (1 blks at 0x0) DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOu-boot,efi-partition-entries-offsetPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl %s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtd#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesclock-frequencyfixed_rate_raw_clockfixed_clockfixed-clockclock-divclock-multfixed_factor_clockfixed-factor-clockti_omap4_cmti,omap4-cmti_ctrl_clkti,clkctrlxtal-load-pfcdce9xx-clkti,cdce913ti,cdce925ti,cdce937ti,cdce949/clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Index Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p bootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxdfu_bufsiz%s: Could not memalign 0x%lx bytes DFU complete %s: 0x%08x %s: Wrong sequence number! [%d] [%d] Wrong sequence numberDFU write errorBuffer overflow%s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... dfu_hash_algo Too many arguments for %s MTD support not available! SF support not available! virtVIRT support not available! %s: Device %s not (yet) supported! &dfu_alt_infoDFU alt settings list: dev: %s alt: %d name: %s layout: %s RAW_ADDREXT2EXT3EXT4RAM_ADDRSKIPSCRIPTeMMCOneNANDRAMSFVIRTRequest would exceed designated area! %s: Layout (%s) not (yet) supported! dfu: fs_set_blk_dev error! dfu: fs_read error! dfu: fs_write error! dfu: fs_size error! mmcpartext4%s: invalid nand device %s: nand_%s_skip_bad call failed at %llx! Failure erase: %d partubiCould not locate '%s' %s: Memory layout (%s) not supported! %s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%sinputoutputunusedfuncgpio@%4x_gpio_omapti,omap3-gpioti,omap4-gpioti,am4372-gpiou-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvu-boot,i2c-offset-leni2c-chipi2c_genericTimed out in %s: status=%04x Check if pads/pull-ups of bus are properly configured i2c_probe: pads on bus probably not configured (status=0x%x) I2C read: data len < 0 I2C read: NULL pointer passed I2C read: address out of range i2c_read (data phase): pads on bus probably not configured (status=0x%x) I2C write: data len < 0 I2C write: NULL pointer passed I2C write: address 0x%x + 0x%x out of range i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! Error : I2C initializing first phase clock Error : I2C initializing clock ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! i2c_omapti,omap3-i2cti,omap4-i2cUnknown modeSelect HS400 failed %d Select HS400ES failed %d Man %06x Snr %04x%04x%c%c%c%c%c%cMMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)cap-sd-highspeedcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found %s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed MMC: block number 0x%lx exceeds max(0x%lx) mmc write failed mmc fail to send stop cmd %s: timedout waiting for sysctl %x to clear ti,dual-volt%s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s: timedout waiting for status! OMAP SD/MMCcd-gpioswp-gpios%s: timedout waiting for cc2! %s: timedout waiting for softresetall! %s: timedout waiting for ics! omap_hsmmcti,omap3-hsmmcti,omap4-hsmmcti,am33xx-hsmmcti,am335-sdhciti,dra7-hsmmc Warning: MTD name "%s" is not unique! drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work nand%ddrivers/mtd/nand/raw/nand_bbt.cToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNQGAMA 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R‐BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitbad blockbbt reservedAttempt to erase non block-aligned data Size of erase exceeds limit Skipping %s at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx drivers/mtd/nand/raw/nand_base.cWARNING at %s:%d/%s()! ONFIEPPSJEDECnand-bus-widthnand-on-flash-bbtnand-ecc-modesofthwhw_syndromehw_oob_firstsoft_bchnand-ecc-algohammingnand-ecc-strengthnand-ecc-step-sizenand-ecc-maximizeInvalid OOB size valueCould not get ECC infonand: error: invalid bit-flip location nand: error: Unable to find NAND settings in GPMC Configuration - quitting omap-elm%s: uncorrectable ECC errors spi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave jedec,spi-norn25q016an25q032n25q032an25q064n25q064an25q128a11n25q128a13mt25ql256an25q256amt25qu256an25q256ax1mt25qu512an25q512amt25ql512an25q512ax3n25q00n25q00amt25ql01gmt25qu02gmt25ql02gmt35xu01gmt35xu02gm25p10m25p20m25p40m25p80m25p16m25p32m25p64m25p128m25pe16m25px16m25px64w25p80w25p16w25p32w25x05w25x40w25x16w25q16dww25x32w25q20clw25q20bww25q20eww25q32w25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvm25p,fast-readSF: Detected %s with page size , erase size , total (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYqca,keep-pll-enabledvddio-regulatorregulator-min-microvoltregulator-max-microvoltqca,clk-out-frequencyqca,clk-out-strengthAR8035AR8031/AR8033AR8021SMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700cpdma_process timeout cpdma_channelserror: cpdma_channels not found in dt slaveserror: slaves not found in dt ale_entrieserror: ale_entries not found in dt bd_ram_sizeerror: bd_ram_size not found in dt mac_controlmode-gpiosactive_slaveerror: phy addr not found in dt error: phy_id read failed max-speedrmii-clock-extlink up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc Updated phy address for CPSW#%d, old: %d, new: %d ti,am3352-cpsw-phy-selti,am43xx-cpsw-phy-selti,dra7xx-cpsw-phy-seleth_cpswti,cpswti,am335x-cpswcpsw,am33xxdavinci,emacti,dm8148ti,am33xxti,am3517-emacti,dm816-emacti,am43ti,dra7sysconregulator-nameregulatorstps65217 pmicti,tps65217tps65217_ldostdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartomap_serialti,omap2-uartti,omap3-uartti,omap4-uartti,am3352-uartti,am4372-uartti,dra742-uartti,am654-uartspi-max-frequencyInvalid bus %d (err=%d) spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported spi_genericomap3_spi: invalid wordlen %d SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x ti,pindir-d0-out-d1-inomap3_spiti,omap2-mcspiti,omap4-mcspitick-timeromap_timerti,am335x-timerti,am4372-timerti,omap5430-timerti,am654-timerfckickti_syscti,sysc-omap2ti,sysc-omap4ti,sysc-omap4-simpleti,sysc-omap3430-srti,sysc-omap3630-srti,sysc-omap4-srti,sysc-omap3-shamti,sysc-omap-aesti,sysc-mcaspti,sysc-usb-host-fsrsa_mod_expmod_exp_swFAILOKAYfastboot_bootcmd0x%pBooting kernel at %s... 0x%08xN/AU-Boot 2024.01+dfsg-5+b20.40x%016zxplatformplatform not setBoard not setValue not setfailed to set partition_ayesinvalid partition namemissing varfastboot.%sVariable not implementedversion-bootloaderdownloadsizemax-download-sizeserialnoversion-basebandproductcurrent-slothas-slotpartition-typepartition-sizeis-userspaceExpected command parameterExpected nonzero image sizeStarting download of %d bytes DATApartitions not setgpt write mmc %x $partitionsCannot set recovery flagCannot set fastboot flagCannot set reboot flagUnsupported commandunrecognized commandReceived invalid data length downloading of %d bytes finished getvardownloadrebootreboot-bootloaderreboot-fastbootreboot-recoveryset_activeoem formatoem partconfoem bootbusoem runACmdUCmdinvalid mmc deviceerasingpartition not givenfastboot_partition_alias_fastboot_raw_partition_invalid partition or deviceno such deviceno such partitionunknown partition table typeunanticipated error%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success mbr%s: updating MBR %s: invalid MBR - refusing to write to flash invalid MBR partition%s: writing MBR partition failed writing MBR partition failedzimageFlashing zImage cannot find boot partitioninvalid number of boot sectors: 0cannot read header from boot partitionboot partition not initializedunable to read boot image headerzImage flashing supported only for boot images v2 and lessmoving second stage is not supported yetcannot read ramdisk from boot partitioncannot write back boot image headercannot write new kernelcannot write back original ramdisk........ zImage was updated in boot partition Flashing sparse image at offset %lu too large for partitionFlashing Raw Image failed writing to device........ wrote %lu bytes to '%s' Erasing blocks %lu to %lu due to alignment failed erasing from device........ erased %lu bytes from '%s' misctimeout-sechw_margin_msu-boot,noautostartu-boot,autostartcyclic_register for %s failed every %ldmsWDT: Started %s with%s servicing %s (%ds timeout) WDT: Not starting %s WDT: Failed to start %s watchdogomap3_wdtti,omap3-wdtdr_modeutmiutmi_wideulpihsicUNKNOWNlow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusotgtimeout sending packets to usb ethernet USB RNDIS network up! RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:ef:00:01usbnet_devaddrde:ad:be:ef:00:00usbnet_hostaddrmusb-hdrcRNDIS/%sTexas Instruments%02X%02X%02X%02X%02X%02Xusing %s, OUT %s IN %s%s%s STATUS MAC %pM HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready cdc_connect_timeoutusb_etherEthernet DataRNDIS Communications Control!cdev->configcompositeusb_dnload%s: failed!, error: %d DOWNLOAD ... OK Ctrl+C to exit ... f_fastbootstatus: %d ep '%s' trans: %d Error %d on queue Bad status: %d buffer overflowfailed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in couldn't find an available UDC usb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No working controllers found usb_dev_genericu-boot,bootdev-usbep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! idlein/statusout/statuswaitUTMI-16UTMI-8musb->config->num_eps <= MUSB_C_NUM_EPS, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%sERROR musb int-queues only support queuesize 1 ERROR int-urb is already pending on pipe %lx Failed to enqueue URB to controller MUSB host is not registered Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! usb@ti-musb-peripheralti-musb-hostti,ctrl_modusb%dmentor,multipointmentor,num-epsmentor,ram-bitsmentor,powerti-musb-wrapperti,am33xx-usbenv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s *** Warning - %s, using default environment bad CRCimport failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacks00:1Unable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... Unable to read "%s" from %s%d:%d... ** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsunsupported** Can not find directory. ** ** File not found %s ** part_offset is %lu total_sector is %llu error: overflow occurs no block left to assign No Memory %s: Device read error! no block left assign no block left invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no inode left to assign Badly aligned ext2_dirent Please supply Absolute path Invalid path It is a Directory file found, deleting Failed to iterate over directory %s < ? > %10u %s Error in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported feature metadata_csum found, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** Invalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required File System is consistent update journal finished Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driver/EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed 1234567Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting kaslr-seed ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx out of memory%s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition Cannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### Failed to install ECPT linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellstargettarget-path/__local_fixups__/__fixups__/__overlay__//__overlay__manufacturer01/01/2024Unknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassis%s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!Malloc failed for: CHUNK_TYPE_RAW%s: Write failed, block #%lu [%lu] flash write failure(incomplete)Bogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILLWrite failed, block #%s: %s %lu [%d] flash write failureBogus chunk size for chunk type CRC32%s: Unknown chunk type: %x Unknown chunk type........ wrote %llu bytes to '%s' sparse image write failureevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d No valid device tree binary found at %p okayseparateembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\Could not initialize timer (err %d) Could not read count from timer (err %d) %s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotateethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskiponce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octettsize%c%u%cblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *   probe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'[][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. !R\248>Ž ;tׁoyoy-ׁoyoy㷆ׁ9oyoy{ׁMoyoy{ׁ oyoy~ׁoyoy~ׁ宀oyoy~ׁoyoy~ׁoyoyjׁ=oyoyׁoyoyׁ]oyoy솀ׁ)oyoy㷆ׁٳoyoy솀ׁoyoyNׁ!oyoyll5€YK=Ň /UׁI怀oyoypׁM뀀oyoy]ׁ}倀oyoyvׁ퀀oyoy >ׁ瀀oyoy{ׁy퀀oyoy~ׁ退oyoyׁ퀀oyoyׁ 倀oyoy1ׁ 退oyoyׁMꀀoyoyMׁ瀀oyoyׁ怀oyoypׁ䀀oyoyׁ]䀀oyoy@.ׁoyoy1ׁ1oyoyׁoyoyׁ-oyoyׁ oyoyׁ᷆% oyoyʆׁa oyoy]ׁ- oyoy솀ׁoyoyׁMoyoy솀ׁ4oyoyφׁq5oyoyeׁ=oyoyMׁq@ׁaЁoyoy ׁefoyoyj@ׁyloyoyׁioyoyQ8 `  V9 6  }ˁʼnm#ρE@MMM Mٝ! ňM Mρn$MMM ĈĈ̈̈ԈԈ܈܈䈇䈇숇숇􈇀􈇀 $$,,44<). *N0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?& Xˇ!ˇ E DFEthernet Gadgeṫpyg)F1}4̇yy+̇"̇̇  ̇pyg)F1}̇yẏ̇̇@@    %x4͇͇g\ ͇ ͇6.8Q"y]\^[\I\[MSFT100|͇ ͇ ͇6͇ ͇ ͇!(·͇͇͇͇0(·:·1·(·L·C· B@@`·t·WINUSB··{4866319A-F4D6-4374-93B9-DC2DEB361BA9}DeviceInterfaceGUID··@                  @  @  @ )闃[ᘃᨃs5چaUe$I"M"I!!3"$&xăqăăăǃダŃٺ {QǺͺѺ׺ٺ BOOTSERVdy:?W:;::99=)@>A<59>-DSQ1U!8BFaENSQUT%;9]>8KHYHEQABmF@R_S888}=҇҇҇҇҇҇Y^Y9_YZZ(Ӈ(ӇuYYeYY[%YXXIXXXӇPP2vӇӇӇӇӇӇ1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@-(m峀H$}A~c@ׁykj1ׁ6RGxׁNxoyyׁͥ=zWz{ׁѧ{4{MׁMsoysׁMsoy}ׁ}5@ׁQЀ?v@ɢׁvFm膀@ׁtlІׁ7І@ІׁЀlj扆}@ׁ}>džׁ %džMdžׁ-*H~ׁYP~oy^ׁMYpׁ֩q@ׁxK ꆀ@ׁ!Zꆀꆀ^ׁ7І@І~@ׁ~^鮀 @ׁWlFׁjNhӁ ׁM%+ׁiǀ5oyO@ׁufׁӀoy\ׁqӀe2ׁӀׁGӀŠꊆׁUӀׁ9Ӏ%=ׁcӀ⌆]ׁٱg܆@ׁyH܆=@ׁaU8憀\憀.ׁӀ6Y ׁӀ(OׁӀׁ)ԀׁԀ ׁӀ%=kׁ Ԁt]eׁՀM!ׁ4똆ׁ󘆀oy-@ׁ]q7qׁက#~@ׁ_Tt@ׁYtytׁ　a})r@ׁ9rsA膀ׁuVJ膀{-Ģׁʢׁؙ`ׁǜׁͦӦ<ׁ! -ׁ󀀝<ׁ <vׁ稆b^ׁt >ׁ,SׁXnׁM{ׁ)󪆀ڪ ׁ컆ׁûׁ]!džH.~ׁM~k@ׁ)Ά{4_Άׁ'eΆ{ΆDׁq4nφ}φׁ;ڪtׁݟttʆ@ׁY:hццφׁ)5φІ6@ׁbs󆀃@ׁ)gӁ=_ׁ5@ׁaЁӁ ׁ)ׁefoy톀@ׁylӁ؆ׁ>؆y,@ׁp4TIwׁ%~GׁAMkvׁ!v|ׁX,醀>醀nنׁDsننۆׁ}FۆEۆŢ@ׁH܆܆jІׁ7sІ@Іf@ׁG1܆[܆n܆@ׁ}Hs܆yׁͥyyHׁQↀↀUↀׁQQ]ↀrↀquׁ񟀀Nuoy4 S^l~_Eo~ _o~^@jjyj0p d5(̹"$HXP[л[&s ⇀5( ! \8$E(NGG܅ 7𹅀(2DžRQ 8𿅀6ȅ^iZ ȅ.r΅낀삀΅ Isą ą)x`:I$Ņ>7lpƅ"  ƅY9q4Dž/i/LDžCpDžyBDž"HDž|y{<,Dž7l8ȅ"%# ƅ9zxȅM171ȅ6[ׅ@ˇCm=نsTK}kd(ЇAK穃ɩ(ЇKGׅ)m(ׅ9m8ׅ1111H?܅3~G~K݅ KB݅q8/ ݅pŚ ~:yOd:%MmHmHUUuHH>v;gH?vѡB  a$Y e ꆀ i冀ep[`쁀1iꁀ@]k3@M]3tM9V3rM923=I 3=3=3 =r30=3=I ]]9]5b ^^M`&m*,7b(я2CIJI6SSW1XB8CG H:I!L?S6[F7lCmM* _9q#'# 8s.r 낀9z00H}w}@ $vH~HKם}D@ $KBCa?0tąhlptx| HL      H L   Px $(,048@DHLPTX\`dh          $ ( 0 4 8 <         x|,0D H L P T X \ ` d h l p t x |      $!L!t!!!!p##x$|$$$$$$$$$$,%%%%<'@'''($(,(4())))*******----------------... ....0000000000000`1d1h11(2,2022(3,303\34444444445(5555D7H7|777P8T8X8:::::::::::::::::::======================>>??????????????????????T>X>\>TAXA\AdAhAlApAtAxA|ADDDDD D$D(D0D4D8Dl?p?t?x?|????|@@@@@@@@@@A\A`A>>>>>>>>T?X?\?????@@@@@ A$ABBX>x??`@DAHABB D$DLEPELGpJKL4NNNNN8QDQLQPQXQQRTTTT$ULUVVV\V`VdVhVlVpVVVVLWWWW@XDXXXXXXYYY YXY`YYYZZZL[[[[8]<]@]D]H]L]P]T]X]\]`]d]h]l]p]t]x]|]]]]]]]]]]]]]]]]]]]]]]]]]^^^ ^^^^^^^______````xa|aaaaaaaaaaaaaaalbtbxb4deg gghiijjkkllllmpppppppqqq qqqqq q$q(q,q0q4q8q>>>>hAlApAAABBBBBB0H@HdHhHIII4M8Mclock@0 ti,clkctrl#=clock@18 ti,clkctrl#<clock@14c ti,clkctrlL#clock@400 ti,omap4-cm+ clock@0 ti,clkctrl$#clock@14 ti,clkctrl#clock@b0 ti,clkctrl#clock@600 ti,omap4-cm+ clock@0 ti,clkctrl#clock@800 ti,omap4-cm+ clock@0 ti,clkctrl#/clock@900 ti,omap4-cm +  clock@0 ti,clkctrl#^clock@a00 ti,omap4-cm +  clock@0 ti,clkctrl$#prm@c00!ti,am3-prm-instti,omap-prm-inst ?prm@d00!ti,am3-prm-instti,omap-prm-inst prm@f00!ti,am3-prm-instti,omap-prm-instprm@1100!ti,am3-prm-instti,omap-prm-inst_target-module@3000ti,sysc disabled+ 0target-module@5000ti,sysc disabled+ Ptarget-module@7000ti,sysc-omap2ti,syscppqrevsyscsyss fckdbclk+ pgpio@0ti,omap4-gpio R 4 ^ G  l I    J Q  `Ptarget-module@9000ti,sysc-omap2ti,syscPTXrevsyscsyss fck+ serial@0ti,am3352-uartti,omap3-uart0lHokay!!txrx)default7"target-module@b000ti,sysc-omap2ti,syscrevsyscsyss fck+ target-module@d000ti,sysc-omap4ti,sysc revsysc fck+tscadc@0ti,am3359-tscadcokay!5!9 fifo0fifo1tscti,am3359-tscAJ`w"3adcti,am3359-adctarget-module@10000ti,sysc-omap4ti,syscrev+scm@0ti,am3-scmsimple-bus +  pinmux@800pinctrl-single8 )default 7#$% matrix_keypad_s0<TXd h l #volume_keys_s0P T $pinmux_i2c0_pins00Hpinmux_i2c1_pinsX0\0Jpinmux_uart0_pinsp0t"pinmux_uart1_pins0x(|01pinmux_clkout2_pin %nandflash_pins_s0000 00000p0t0|\backlight_pins d8cpsw_default  $(,0 4 8 < @ Wcpsw_sleep    $ ( , 0 4 8 < @ Xdavinci_mdio_defaultH0LYdavinci_mdio_sleepH L Zpinmux_mmc1_pins `(Opinmux_mmc3_pinsHD0H0L0x000Epinmux_wlan_pins$@(Flcd_pins_s0P $(,048<bmcasp1_pins0  D 3dcan1_pins_defaulthl 7scm_conf@0sysconsimple-bus+ phy-gmii-selti,am3352-phy-gmii-selPclocks+ simple-busclock-sys-clkin-22@40# ti,mux-clock&'()@ clock-adc-tsc-fck#fixed-factor-clock bmclock-dcan0-fck#fixed-factor-clock bm5clock-dcan1-fck#fixed-factor-clock bm6clock-mcasp0-fck#fixed-factor-clock bmclock-mcasp1-fck#fixed-factor-clock bmclock-smartreflex0-fck#fixed-factor-clock bmclock-smartreflex1-fck#fixed-factor-clock bmclock-sha0-fck#fixed-factor-clock bmclock-aes0-fck#fixed-factor-clock bmclock-rng-fck#fixed-factor-clock bmehrpwm0_tbclk@44e10664#ti,gate-clock*d9ehrpwm1_tbclk@44e10664#ti,gate-clock*d:ehrpwm2_tbclk@44e10664#ti,gate-clock*d;wkup_m3_ipc@1324ti,am3352-wkup-m3-ipc$$N!+*,-dma-router@f90ti,am335x-edma-crossbar@1< I!Mclockdomainstarget-module@31000ti,sysc-omap2-timerti,syscrevsyscsyss  fck+ timer@0ti,am335x-timer-1msCU.fcktarget-module@33000ti,sysc disabled+ 0target-module@35000ti,sysc-omap2ti,syscPPPrevsyscsyss" fck+ Ptarget-module@37000ti,sysc disabled+ ptarget-module@39000ti,sysc disabled+ target-module@3e000ti,sysc-omap4-simpleti,sysctx revsysc /fck+ rtc@0ti,am3352-rtcti,da830-rtcKLext-clkint-clktarget-module@40000ti,sysc disabled+ interconnect@48000000ti,am33xx-l4-persimple-bus0HHHHHHaplaia0ia1ia2ia3+HHH H 0H0FF@F@F@@segment@0 simple-bus+``pp  00@@PP @@PP   00@@PP``pp            FF@F@F@@target-module@8000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@16000ti,sysc disabled+ `target-module@22000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 04fck+  serial@0ti,am3352-uartti,omap3-uart0lIokay!!txrx)default71target-module@24000ti,sysc-omap2ti,sysc@P@T@Xrevsyscsyss 08fck+ @serial@0ti,am3352-uartti,omap3-uart0lJ disabled!!txrxtarget-module@2a000ti,sysc-omap2ti,syscrevsyscsyss 0fck+ target-module@30000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ spi@0ti,omap4-mcspi+Ad0!!!!tx0rx0tx1rx1 disabledtarget-module@38000ti,sysc-omap4-simpleti,sysc revsysc  2fck+ FF@mcasp@0ti,am33xx-mcasp-audio F@mpudatPQrtxrx disabled!! txrxtarget-module@3c000ti,sysc-omap4-simpleti,sysc revsysc  2Lfck+ F@F@@mcasp@0ti,am33xx-mcasp-audio F@@mpudatRSrtxrxokay! ! txrx)default73  dtarget-module@40000ti,sysc-omap4-timerti,syscrevsyscsyss 0Hfck+ timer@0ti,am335x-timerD4fcktarget-module@42000ti,sysc-omap4-timerti,sysc   revsyscsyss 0Lfck+  timer@0ti,am335x-timerEtarget-module@44000ti,sysc-omap4-timerti,sysc@@@revsyscsyss 0Pfck+ @timer@0ti,am335x-timer\target-module@46000ti,sysc-omap4-timerti,sysc```revsyscsyss 0fck+ `timer@0ti,am335x-timer]target-module@48000ti,sysc-omap4-timerti,syscrevsyscsyss 0fck+ timer@0ti,am335x-timer^target-module@4a000ti,sysc-omap4-timerti,syscrevsyscsyss 0Dfck+ timer@0ti,am335x-timer_target-module@4c000ti,sysc-omap2ti,syscrevsyscsyss0t0t fckdbclk+ gpio@0ti,omap4-gpio@  Z   b`target-module@50000ti,sysc disabled+  target-module@60000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ target-module@80000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ elm@0ti,am3352-elm okay]target-module@a0000ti,sysc disabled+  target-module@c8000ti,sysc-omap4ti,sysc   revsysc  0fck+  mailbox@0ti,omap4-mailboxM,mbox-wkup-m3  -target-module@ca000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  spinlock@0ti,omap4-hwspinlocktarget-module@cc000ti,sysc disabled+  segment@100000 simple-bus+h   `` pp                     00 @@ PPtarget-module@8c000ti,sysc disabled+ target-module@8e000ti,sysc disabled+ target-module@9c000ti,sysc-omap2ti,sysc   revsyscsyss 0 fck+  target-module@a0000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  spi@0ti,omap4-mcspi+}d0!*!+!,!-tx0rx0tx1rx1 disabledtarget-module@a2000ti,sysc disabled+  target-module@a4000ti,sysc disabled+  @target-module@a6000ti,sysc-omap2ti,sysc `P `T `Xrevsyscsyss 0<fck+  `serial@0ti,am3352-uartti,omap3-uart0l, disabledtarget-module@a8000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 0@fck+  serial@0ti,am3352-uartti,omap3-uart0l- disabledtarget-module@aa000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 0fck+  serial@0ti,am3352-uartti,omap3-uart0l. disabledtarget-module@ac000ti,sysc-omap2ti,sysc   revsyscsyss0x0x fckdbclk+  gpio@0ti,omap4-gpio0 " M 8   target-module@ae000ti,sysc-omap2ti,sysc   revsyscsyss0|0| fckdbclk+  gpio@0ti,omap4-gpioP B b K  d >Gtarget-module@b0000ti,sysc disabled+  target-module@cc000ti,sysc-omap4ti,sysc rev05fckosc+  can@0ti,am3352-d_can 5fck )D4 disabledtarget-module@d0000ti,sysc-omap4ti,sysc rev06fckosc+  can@0ti,am3352-d_can 6fck )D7 disabled)default77target-module@d8000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  segment@200000 simple-bus+segment@300000 simple-bus+00 0 000@0@P0P001@11  1 P1P`1`p1p010@1@22 2 020@2@P2Ptarget-module@0ti,sysc-omap4ti,sysc revsysc8 0fck+ epwmss@0ti,am33xx-pwmss+okay pwm@100ti,am3352-ecapti,am33xx-ecapF*fckrecap0okay)default78acounter@180ti,am3352-eqep* sysclkoutO disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF9* tbclkfck disabledtarget-module@2000ti,sysc-omap4ti,sysc   revsysc8 0fck+  epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecapF*fck/recap1 disabledcounter@180ti,am3352-eqep* sysclkoutX disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF:* tbclkfck disabledtarget-module@4000ti,sysc-omap4ti,sysc@@ revsysc8 0fck+ @epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecapF*fck=recap2 disabledcounter@180ti,am3352-eqep* sysclkoutY disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF;* tbclkfck disabledtarget-module@e000ti,sysc-omap4ti,syscT revsysc 8  <fck+ lcdc@0ti,am33xx-tilcdc$okaytarget-module@10000ti,sysc-omap2ti,sysc revsysc 0Xfck+  rng@0 ti,omap4-rng otarget-module@13000ti,sysc disabled+ 0target-module@15000ti,sysc disabled+P`target-module@18000ti,sysc disabled+ @target-module@20000ti,sysc disabled+ target-module@22000ti,sysc disabled+  target-module@24000ti,sysc disabled+ @interconnect@47c00000ti,am33xx-l4-fwsimple-busGGG aplaia0+ Gsegment@0 simple-bus+@@PP``pp``pp@@PP  00  00@@PPtarget-module@c000ti,sysc disabled+ target-module@e000ti,sysc disabled+ target-module@10000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@1a000ti,sysc disabled+ target-module@24000ti,sysc disabled+ @target-module@26000ti,sysc disabled+ `target-module@28000ti,sysc disabled+ target-module@30000ti,sysc disabled+ target-module@32000ti,sysc disabled+  target-module@38000ti,sysc disabled+ target-module@3a000ti,sysc disabled+ target-module@3c000ti,sysc disabled+ target-module@3e000ti,sysc disabled+ target-module@40000ti,sysc disabled+ target-module@42000ti,sysc disabled+  target-module@44000ti,sysc disabled+ @target-module@46000ti,sysc disabled+ `interconnect@4a000000ti,am33xx-l4-fastsimple-busJJJ aplaia0+ Jsegment@0 simple-bus+ ((0088target-module@100000ti,sysc-omap4-simpleti,syscrevsyscsyss8 =fck+ target-module@180000ti,sysc disabled+ target-module@200000ti,sysc disabled+  target-module@300000ti,sysc-prussti,sysc2`2` revsysc0 8  >fckQ?Xrstctrl+ 0 disabledinterconnect@4b140000ti,am33xx-l4-mpusssimple-busKDKHlaap+ Ksegment@0 simple-bus+`HH @@PP00target-module@0ti,sysc disabled+$ target-module@3000ti,sysc disabled+ 0interrupt-controller@48200000ti,am33xx-intc H target-module@49000000ti,sysc-omap4ti,syscIrev @fck+ Idma@0ti,edma3-tpcc edma3_cc  'redma3_ccintedma3_mperredma3_ccerrint<@1dABCm  !target-module@49800000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcpredma3_tcerrintAtarget-module@49900000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcqredma3_tcerrintBtarget-module@49a00000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcrredma3_tcerrintCtarget-module@47810000ti,sysc-omap2ti,syscGGGrevsyscsyss  2fck+ Gmmc@0ti,am335-sdhci disabled! ! txrxD)default7EF +wlcore@0 ti,wl1835 Gi2c@44e0b000 ti,omap4-i2c+i2c1DFokay)default7H0tps@2d- ti,tps65910 I,I8IDIPI\IhItIregulators+regulator@0vrtcregulator@1vioregulator@2vdd1vdd_mpu tregulator@3vdd2 vdd_core t0regulator@4vdd3regulator@5vdig1regulator@6vdig2regulator@7vpllregulator@8vdacregulator@9 vaux1regulator@10 vaux2Lregulator@11 vaux33regulator@12 vmmcw@2ZNregulator@13 vbbi2c@4802a000 ti,omap4-i2c+i2c2HGokay)default7J0lis331dlh@18st,lis331dlhst,lis3lv02dKK&8J \ n xx#&2&Atsl2550@39 taos,tsl25509tmp275@48 ti,tmp275Htlv320aic3106@1bti,tlv320aic3106okayPL\LiLvIci2c@4819c000 ti,omap4-i2c+i2c3H disabledmmc@48060000ti,omap4-hsmmcmmc1 MMtxrx@HokayN)default7O Pmmc@481d8000ti,omap4-hsmmcmmc2!!txrxH disabledwdt@44e35000 ti,omap3-wdt wd_timer2DP[usb@47400000ti,am33xx-usbG@+ usb_otg_hsokaycontrol@44e10620ti,am335x-usb-ctrl-moduleD DHphy_ctrlwakeupokayQusb-phy@47401300ti,am335x-usb-phyG@phyQokayRusb@47401000ti,musb-am33xxG@G@ mccontrolrmc peripheral RhSSSSSSSSSS S S S S SSSSSSSSSSS S S S S Srx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15okayusb-phy@47401b00ti,am335x-usb-phyG@phyQokayTusb@47401800ti,musb-am33xxG@G@ mccontrolrmchost ThSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSrx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15okaydma-controller@2000ti,am3359-cppi41  0@@#gluecontrollerschedulerqueuemgrrglue1okaySethernet@4a100000ti,am335x-cpswti,cpswcpgmac0UV fckcpts   &  2  > E R bJJ+()*+okay)defaultsleep7W sXmdio@4a101000ti,cpsw-mdioti,davinci_mdio+ davinci_mdio }B@Jokay)defaultsleep7Y sZethernet-phy@0[slave@4a100200  [ rgmii-idslave@4a100300 cpsw-phy-sel@44e10650ti,am3352-cpsw-phy-selDP gmii-selsram@40300000 mmio-sram@0 @0+pm-code-sram@0ti,sram pm-data-sram@1000ti,sram emif@4c000000ti,emif-am3352Lemife gpmc@50000000ti,am3352-gpmcgpmc P d !4rxtx  + okay)default7\nand@0,0  bch8 ]   / @ N, `, r " ,  (  6 @ R R true $true 7 N h  ( +partition@0 NAND.SPLpartition@1 NAND.SPL.backup1partition@2 NAND.SPL.backup2partition@3 NAND.SPL.backup3partition@4 NAND.u-boot-spl-ospartition@5 NAND.u-boot partition@6 NAND.u-boot-envpartition@7 NAND.u-boot-env.backup1partition@8 NAND.kernel partition@9 NAND.file-system`target-module@53100000ti,sysc-omap3-shamti,syscSSSrevsyscsyss  @|fck+ Ssham@0ti,omap4-shamm !$rxokaytarget-module@53500000ti,sysc-omap2ti,syscSPSPSPrevsyscsyss @pfck+ SPaes@0 ti,omap4-aesg!!txrxokaytarget-module@56000000ti,sysc-omap4ti,syscVV revsysc 8  ^fckQ_Xrstctrl+ Vmemory@80000000memoryfixedregulator0regulator-fixedvbatLK@LK@Ifixedregulator1regulator-fixed lis3_regKfixedregulator2regulator-fixedwlan-en-regulatorw@w@ ` p Dmatrix_keypad@0gpio-matrix-keypad  $ ``` `` (ijlvolume-keys gpio-keys 5switch-9 volume-up @s P Kswitch-10 volume-down @r P Kbacklightpwm-backlight [aP$ `358>Ke rpanelti,tilcdc,panelokay)default7bpanel-info         display-timings800x480p620À    ' ' /    , 6 Csoundti,da830-evm-audio PAM335x-EVM Yc hd |J Headphone JackHPLOUTHeadphone JackHPROUTLINE1LLine InLINE1RLine In__symbols__ /cpus/idle-states/mpu_gate /opp-table /ocp /ocp/l4_wkup@44c00000% /ocp/l4_wkup@44c00000/wkup_m3@100000< /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0C /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocksS /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-32768S /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-rc32kW /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-19200000W /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-24000000W/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-25000000W+/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-26000000P/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-cpsw-125mhz-gclk[O/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-cpsw-cpts-rft@520]a/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-gpio0-dbclk-mux@53cVt/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-lcd-gclk@534M}/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-mmcZ/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/gfx_fclk_clksel_ck@52cV/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/gfx_fck_div_ck@52cX/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/sysclkout_pre_ck@700V/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clkout2_div_ck@700R/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clkout2_ck@700I/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clockdomainsD/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@38M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@1cM/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@24N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@120M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@e8L./ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@0MB/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@18NO/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@14cFa/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400Ni/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@0Oy/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@14O/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@b0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@600N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@600/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@800N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@800/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@900N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@900/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@a00N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@a00/clock@0D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@c00D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@d00D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@f00E/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@11008$/ocp/l4_wkup@44c00000/segment@200000/target-module@7000?1/ocp/l4_wkup@44c00000/segment@200000/target-module@7000/gpio@0A7/ocp/l4_wkup@44c00000/segment@200000/target-module@9000/serial@0A=/ocp/l4_wkup@44c00000/segment@200000/target-module@d000/tscadc@0ED/ocp/l4_wkup@44c00000/segment@200000/target-module@d000/tscadc@0/adc?O/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0JS/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800[a/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/matrix_keypad_s0Yr/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/volume_keys_s0[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_i2c0_pins[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_i2c1_pins\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_uart0_pins\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_uart1_pins]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_clkout2_pin\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/nandflash_pins_s0Y/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/backlight_pinsW/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/cpsw_defaultU/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/cpsw_sleep_/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/davinci_mdio_default]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/davinci_mdio_sleep[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_mmc1_pins[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_mmc3_pins[(/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_wlan_pinsV2/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/lcd_pins_s0V>/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/mcasp1_pins]J/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/dcan1_pins_defaultJ]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0Wf/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/phy-gmii-selQs/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocksg~/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-sys-clkin-22@40c/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-adc-tsc-fcka/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-dcan0-fcka/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-dcan1-fckb/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-mcasp0-fckb/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-mcasp1-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-smartreflex0-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-smartreflex1-fck`/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-sha0-fck`/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-aes0-fck_/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-rng-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm0_tbclk@44e10664h /ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm1_tbclk@44e10664h/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm2_tbclk@44e10664P'/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/wkup_m3_ipc@1324N3/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/dma-router@f90L=/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/clockdomains9N/ocp/l4_wkup@44c00000/segment@200000/target-module@31000A\/ocp/l4_wkup@44c00000/segment@200000/target-module@31000/timer@0?c/ocp/l4_wkup@44c00000/segment@200000/target-module@3e000/rtc@0g/ocp/interconnect@48000000Bn/ocp/interconnect@48000000/segment@0/target-module@22000/serial@0Bt/ocp/interconnect@48000000/segment@0/target-module@24000/serial@0?/ocp/interconnect@48000000/segment@0/target-module@30000/spi@0Az/ocp/interconnect@48000000/segment@0/target-module@38000/mcasp@0A/ocp/interconnect@48000000/segment@0/target-module@3c000/mcasp@09/ocp/interconnect@48000000/segment@0/target-module@40000A/ocp/interconnect@48000000/segment@0/target-module@40000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@42000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@44000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@46000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@48000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@4a000/timer@0@/ocp/interconnect@48000000/segment@0/target-module@4c000/gpio@0?/ocp/interconnect@48000000/segment@0/target-module@80000/elm@0C/ocp/interconnect@48000000/segment@0/target-module@c8000/mailbox@0P/ocp/interconnect@48000000/segment@0/target-module@c8000/mailbox@0/mbox-wkup-m3D/ocp/interconnect@48000000/segment@0/target-module@ca000/spinlock@0D/ocp/interconnect@48000000/segment@100000/target-module@a0000/spi@0G/ocp/interconnect@48000000/segment@100000/target-module@a6000/serial@0G/ocp/interconnect@48000000/segment@100000/target-module@a8000/serial@0G/ocp/interconnect@48000000/segment@100000/target-module@aa000/serial@0E/ocp/interconnect@48000000/segment@100000/target-module@ac000/gpio@0E/ocp/interconnect@48000000/segment@100000/target-module@ae000/gpio@0D/ocp/interconnect@48000000/segment@100000/target-module@cc000/can@0D /ocp/interconnect@48000000/segment@100000/target-module@d0000/can@0C/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0K/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/pwm@100O!/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/counter@180K'/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/pwm@200F//ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0N7/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/pwm@100R=/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/counter@180NC/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/pwm@200FK/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0NS/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@100RY/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/counter@180N_/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@200Dg/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0Dl/ocp/interconnect@48000000/segment@300000/target-module@10000/rng@0p/ocp/interconnect@47c00000v/ocp/interconnect@4a000000:~/ocp/interconnect@4a000000/segment@0/target-module@300000/ocp/interconnect@4b140000#/ocp/interrupt-controller@48200000"/ocp/target-module@49000000/dma@0"/ocp/target-module@49800000/dma@0"/ocp/target-module@49900000/dma@0"/ocp/target-module@49a00000/dma@0"/ocp/target-module@47810000/mmc@0+/ocp/target-module@47810000/mmc@0/wlcore@0T/ocp/i2c@44e0b000/ocp/i2c@44e0b000/tps@2d0/ocp/i2c@44e0b000/tps@2d/regulators/regulator@00/ocp/i2c@44e0b000/tps@2d/regulators/regulator@10/ocp/i2c@44e0b000/tps@2d/regulators/regulator@20/ocp/i2c@44e0b000/tps@2d/regulators/regulator@30/ocp/i2c@44e0b000/tps@2d/regulators/regulator@40/ocp/i2c@44e0b000/tps@2d/regulators/regulator@50/ocp/i2c@44e0b000/tps@2d/regulators/regulator@60 /ocp/i2c@44e0b000/tps@2d/regulators/regulator@70/ocp/i2c@44e0b000/tps@2d/regulators/regulator@80/ocp/i2c@44e0b000/tps@2d/regulators/regulator@91'/ocp/i2c@44e0b000/tps@2d/regulators/regulator@1011/ocp/i2c@44e0b000/tps@2d/regulators/regulator@111[mii col][mii crs][mii rx err][mii tx en][mii rx dv][i2c0 sda][i2c0 scl][jtag emu0][jtag emu1][mii tx clk][mii rx clk]NCNC[usb vbus en]P9_31 [spi1_sclk]P9_29 [spi1_d0]P9_30 [spi1_d1]P9_28 [spi1_cs0]P9_42B [ecappwm0]P9_27P9_41AP9_25NCNCNCNCNCNCNCNCNCNCtarget-module@b0000ti,sysc disabled+  target-module@cc000ti,sysc-omap4ti,sysc rev.2fckosc+  can@0ti,am3352-d_can 2fck D4 disabledtarget-module@d0000ti,sysc-omap4ti,sysc rev.3fckosc+  can@0ti,am3352-d_can 3fck D7 disabledtarget-module@d8000ti,sysc-omap2ti,sysc   revsyscsyss  .fck+  segment@200000 simple-bus+segment@300000 simple-bus+00 0 000@0@P0P001@11  1 P1P`1`p1p010@1@22 2 020@2@P2Ptarget-module@0ti,sysc-omap4ti,sysc revsysc  .fck+ epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck5ecap0 disabledcounter@180ti,am3352-eqep( sysclkoutO disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm4( tbclkfck disabledtarget-module@2000ti,sysc-omap4ti,sysc   revsysc  .fck+  epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck/5ecap1 disabledcounter@180ti,am3352-eqep( sysclkoutX disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm5( tbclkfck disabledtarget-module@4000ti,sysc-omap4ti,sysc@@ revsysc  .fck+ @epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck=5ecap2 disabledcounter@180ti,am3352-eqep( sysclkoutY disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm6( tbclkfck disabledtarget-module@e000ti,sysc-omap4ti,syscT revsysc    7fck+ lcdc@0ti,am33xx-tilcdc$okay %straightportendpoint@098Etarget-module@10000ti,sysc-omap2ti,sysc revsysc .Xfck+  rng@0 ti,omap4-rng otarget-module@13000ti,sysc disabled+ 0target-module@15000ti,sysc disabled+P`target-module@18000ti,sysc disabled+ @target-module@20000ti,sysc disabled+ target-module@22000ti,sysc disabled+  target-module@24000ti,sysc disabled+ @interconnect@47c00000ti,am33xx-l4-fwsimple-busGGG aplaia0+ Gsegment@0 simple-bus+@@PP``pp``pp@@PP  00  00@@PPtarget-module@c000ti,sysc disabled+ target-module@e000ti,sysc disabled+ target-module@10000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@1a000ti,sysc disabled+ target-module@24000ti,sysc disabled+ @target-module@26000ti,sysc disabled+ `target-module@28000ti,sysc disabled+ target-module@30000ti,sysc disabled+ target-module@32000ti,sysc disabled+  target-module@38000ti,sysc disabled+ target-module@3a000ti,sysc disabled+ target-module@3c000ti,sysc disabled+ target-module@3e000ti,sysc disabled+ target-module@40000ti,sysc disabled+ target-module@42000ti,sysc disabled+  target-module@44000ti,sysc disabled+ @target-module@46000ti,sysc disabled+ `interconnect@4a000000ti,am33xx-l4-fastsimple-busJJJ aplaia0+ Jsegment@0 simple-bus+ ((0088target-module@100000ti,sysc-omap4-simpleti,syscrevsyscsyss  9fck+ target-module@180000ti,sysc disabled+ target-module@200000ti,sysc disabled+  target-module@300000ti,sysc-prussti,sysc2`2` revsysc0    :fckI;Prstctrl+ 0okayinterconnect@4b140000ti,am33xx-l4-mpusssimple-busKDKHlaap+ Ksegment@0 simple-bus+`HH @@PP00target-module@0ti,sysc disabled+$ target-module@3000ti,sysc disabled+ 0interrupt-controller@48200000ti,am33xx-intc H target-module@49000000ti,sysc-omap4ti,syscIrev <fck+ Idma@0ti,edma3-tpcc edma3_cc  '5edma3_ccintedma3_mperredma3_ccerrint@\=>?e!target-module@49800000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcp5edma3_tcerrint=target-module@49900000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcq5edma3_tcerrint>target-module@49a00000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcr5edma3_tcerrint?target-module@47810000ti,sysc-omap2ti,syscGGGrevsyscsyss  /fck+ Gmmc@0ti,am335-sdhci} disabledi2c@44e0b000 ti,omap4-i2c+i2c1DFokay9defaultG@0tps@24$ ti,tps65217  Ochargerti,tps65217-charger5USBACokaypwrbuttonti,tps65217-pwrbuttonokayregulators+regulator@0dcdc1 vdds_dprregulator@1dcdc2vdd_mpuHLregulator@2dcdc3 vdd_coreH0regulator@3ldo1vio,vrtc,vddsregulator@4ldo2 vdd_3v3auxregulator@5ldo3vdd_1v8w@w@regulator@6ldo4 vdd_3v3aAbaseboard_eeprom@50 atmel,24c256P+*Abaseboard_data@0tda19988@70 nxp,tda998xp 5B EB 9defaultoffGCYDEc_ports+port@0endpoint9E8i2c@4802a000 ti,omap4-i2c+i2c2HG disabledi2c@4819c000 ti,omap4-i2c+i2c3Hokay9defaultGF0cape_eeprom0@54 atmel,24c256T+cape_data@0cape_eeprom1@55 atmel,24c256U+cape_data@0cape_eeprom2@56 atmel,24c256V+cape_data@0cape_eeprom3@57 atmel,24c256W+cape_data@0mmc@48060000ti,omap4-hsmmcmmc1o}| *GG/txrx@Hokay9defaultGH IJmmc@481d8000ti,omap4-hsmmcmmc2}*!!/txrxHokayJ9defaultGKwdt@44e35000 ti,omap3-wdt wd_timer2DP[usb@47400000ti,am33xx-usbG@+ usb_otg_hscontrol@44e10620ti,am335x-usb-ctrl-moduleD DHphy_ctrlwakeupLusb-phy@47401300ti,am335x-usb-phyG@phyLMusb@47401000ti,musb-am33xxG@G@ mccontrol5mcvbus peripheral  Mh*NNNNNNNNNN N N N N NNNNNNNNNNN N N N N N/rx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15EOusb-phy@47401b00ti,am335x-usb-phyG@phyLPusb@47401800ti,musb-am33xxG@G@ mccontrol5mchost  Ph*NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN/rx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15dma-controller@2000ti,am3359-cppi41  0@@#gluecontrollerschedulerqueuemgr5glue+Nethernet@4a100000ti,am335x-cpswti,cpswcpgmac0QR fckcpts9HT ` lsJJ+()*+okay9defaultsleepGSYTmdio@4a101000ti,cpsw-mdioti,davinci_mdio+ davinci_mdioB@J disabled9defaultsleepGUYVethernet-phy@0Wslave@4a100200Wmiislave@4a100300cpsw-phy-sel@44e10650ti,am3352-cpsw-phy-selDP gmii-selsram@40300000 mmio-sram@0 @0+pm-code-sram@0ti,srampm-data-sram@1000ti,sramemif@4c000000ti,emif-am3352Lemifegpmc@50000000ti,am3352-gpmcgpmcP d *!4/rxtx+  disabledtarget-module@53100000ti,sysc-omap3-shamti,syscSSSrevsyscsyss  <|fck+ Ssham@0ti,omap4-shamm *!$/rxokaytarget-module@53500000ti,sysc-omap2ti,syscSPSPSPrevsyscsyss <pfck+ SPaes@0 ti,omap4-aesg*!!/txrxokaytarget-module@56000000ti,sysc-omap4ti,syscVV revsysc    XfckIYPrstctrl+ Vmemory@80000000memory leds9defaultGZ gpio-ledsled2beaglebone:green:heartbeat ?B heartbeat4offled3beaglebone:green:mmc0 ?Bmmc04offled4beaglebone:green:usr2 ?Bcpu04offled5beaglebone:green:usr3 ?Bmmc14offfixedregulator0regulator-fixed vmmcsd_fixed2Z2ZJclk_mcasp0_fixed# fixed-clock0w[clk_mcasp0#gpio-gate-clock[ BB^soundsimple-audio-cardOTI BeagleBone Blackfi2s\\simple-audio-card,cpu]^\simple-audio-card,codec___symbols__/cpus/idle-states/mpu_gate /opp-table/ocp/ocp/l4_wkup@44c00000%/ocp/l4_wkup@44c00000/wkup_m3@100000</ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0C/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocksS /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-32768S /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-rc32kW !/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-19200000W 2/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-24000000W C/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-25000000W T/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-26000000P e/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-tclkinM o/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@490V |/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-x2Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m4@480Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m5@484Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m6@4d8M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@488Y /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-mpu-m2@4a8M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@494Y /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-ddr-m2@4a0Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-ddr-m2-div2M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@498Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-disp-m2@4a4M #/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@48cY //ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2@4aca >/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2-div4-wkupdmZ Y/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2-div4S m/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-24mhzS w/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clkdiv32kQ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l3-gclk\ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-pruss-ocp-gclk@530W /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-mmu-fck-1@914X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer1-fck@528X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer2-fck@508X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer3-fck@50cX /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer4-fck@510X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer5-fck@518X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer6-fck@51cX /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer7-fck@504Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-usbotg-fck-8@47c[ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m4-div2[ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-ieee5000-fck-1@e4V /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-wdt1-fck@538U &/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l4-rtc-gclkS 2/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l4hs-gclkR /ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0NF/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@100RL/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/counter@180NR/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@200DZ/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0T_/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0/port/endpoint@0Df/ocp/interconnect@48000000/segment@300000/target-module@10000/rng@0j/ocp/interconnect@47c00000p/ocp/interconnect@4a000000:x/ocp/interconnect@4a000000/segment@0/target-module@300000/ocp/interconnect@4b140000#/ocp/interrupt-controller@48200000"/ocp/target-module@49000000/dma@0"/ocp/target-module@49800000/dma@0"/ocp/target-module@49900000/dma@0"/ocp/target-module@49a00000/dma@0"/ocp/target-module@47810000/mmc@0T/ocp/i2c@44e0b000/ocp/i2c@44e0b000/tps@240/ocp/i2c@44e0b000/tps@24/regulators/regulator@00/ocp/i2c@44e0b000/tps@24/regulators/regulator@10/ocp/i2c@44e0b000/tps@24/regulators/regulator@20/ocp/i2c@44e0b000/tps@24/regulators/regulator@30/ocp/i2c@44e0b000/tps@24/regulators/regulator@40/ocp/i2c@44e0b000/tps@24/regulators/regulator@50/ocp/i2c@44e0b000/tps@24/regulators/regulator@6&/ocp/i2c@44e0b000/baseboard_eeprom@507/ocp/i2c@44e0b000/baseboard_eeprom@50/baseboard_data@0 /ocp/i2c@44e0b000/tda19988@704)/ocp/i2c@44e0b000/tda19988@70/ports/port@0/endpointY/ocp/i2c@4802a000^/ocp/i2c@4819c000"0/ocp/i2c@4819c000/cape_eeprom0@54.=/ocp/i2c@4819c000/cape_eeprom0@54/cape_data@0"H/ocp/i2c@4819c000/cape_eeprom1@55.U/ocp/i2c@4819c000/cape_eeprom1@55/cape_data@0"`/ocp/i2c@4819c000/cape_eeprom2@56.m/ocp/i2c@4819c000/cape_eeprom2@56/cape_data@0"x/ocp/i2c@4819c000/cape_eeprom3@57./ocp/i2c@4819c000/cape_eeprom3@57/cape_data@0/ocp/mmc@48060000/ocp/mmc@481d8000/ocp/wdt@44e35000/ocp/usb@47400000#/ocp/usb@47400000/control@44e10620#/ocp/usb@47400000/usb-phy@47401300/ocp/usb@47400000/usb@47401000#/ocp/usb@47400000/usb-phy@47401b00/ocp/usb@47400000/usb@47401800&/ocp/usb@47400000/dma-controller@2000/ocp/ethernet@4a100000%/ocp/ethernet@4a100000/mdio@4a1010004/ocp/ethernet@4a100000/mdio@4a101000/ethernet-phy@0&/ocp/ethernet@4a100000/slave@4a100200&/ocp/ethernet@4a100000/slave@4a100300-/ocp/ethernet@4a100000/cpsw-phy-sel@44e10650/ocp/sram@40300000"/ocp/sram@40300000/pm-code-sram@0%/ocp/sram@40300000/pm-data-sram@1000/ocp/emif@4c000000 /ocp/gpmc@50000000%/ocp/target-module@53100000#1/ocp/target-module@53100000/sham@06/ocp/target-module@53500000"A/ocp/target-module@53500000/aes@0E/fixedregulator0R/clk_mcasp0_fixed c/clk_mcasp0n/sound/simple-audio-card,cpu compatibleinterrupt-parent#address-cells#size-cellsmodelstdout-pathtick-timeri2c0i2c1i2c2serial0serial1serial2serial3serial4serial5d-can0d-can1usb0usb1phy0phy1ethernet0ethernet1spi0spi1mmc0mmc1mmc2enable-methoddevice_typeregoperating-points-v2clocksclock-namesclock-latencycpu-idle-statescpu0-supplyentry-latency-usexit-latency-usmin-residency-usti,idle-wkup-m3phandlesysconopp-hzopp-microvoltopp-supported-hwopp-suspendinterruptsti,hwmodspm-sramrangesbootph-allreg-namesti,pm-firmwarestatus#clock-cellsclock-frequencyti,max-divti,index-starts-at-oneclock-multclock-divti,set-rate-parentti,bit-shift#reset-cellsti,sysc-maskti,sysc-sidleti,syss-maskgpio-rangesgpio-controller#gpio-cellsinterrupt-controller#interrupt-cellsgpio-line-namesdmasdma-namespinctrl-namespinctrl-0#io-channel-cells#pinctrl-cellspinctrl-single,register-widthpinctrl-single,function-maskpinctrl-single,pins#phy-cellsti,rprocmboxes#dma-cellsdma-requestsdma-mastersti,timer-alwonsystem-power-controllerti,spi-num-csinterrupt-names#sound-dai-cellsop-modetdm-slotsserial-dirtx-num-evtrx-num-evtti,timer-pwm#mbox-cellsti,mbox-num-usersti,mbox-num-fifosti,mbox-send-noirqti,mbox-txti,mbox-rx#hwlock-cellssyscon-raminitti,sysc-midle#pwm-cellsblue-and-red-wiringremote-endpointresetsreset-namesti,tptcsti,edma-memcpy-channelsti,needs-special-resetti,pmic-shutdown-controllerregulator-compatibleregulator-nameregulator-always-onregulator-min-microvoltregulator-max-microvoltregulator-boot-onvcc-supplynxp,calib-gpiosinterrupts-extendedpinctrl-1audio-portsti,dual-voltti,needs-special-hs-handlingbus-widthcd-gpiosvmmc-supplynon-removableti,ctrl_moddr_modementor,multipointmentor,num-epsmentor,ram-bitsmentor,powerphys#dma-channels#dma-requestscpdma_channelsale_entriesbd_ram_sizemac_controlslavesactive_slavecpts_clock_multcpts_clock_shiftbus_freqmac-addressphy-handlephy-modeprotect-execpoolti,no-idleti,no-idle-on-initgpmc,num-csgpmc,num-waitpinslabellinux,default-triggerdefault-stateenable-gpiossimple-audio-card,namesimple-audio-card,formatsimple-audio-card,bitclock-mastersimple-audio-card,frame-mastersound-daimpu_gatecpu0_opp_tableocpl4_wkupwkup_m3prcmprcm_clocksclk_32768_ckclk_rc32k_ckvirt_19200000_ckvirt_24000000_ckvirt_25000000_ckvirt_26000000_cktclkin_ckdpll_core_ckdpll_core_x2_ckdpll_core_m4_ckdpll_core_m5_ckdpll_core_m6_ckdpll_mpu_ckdpll_mpu_m2_ckdpll_ddr_ckdpll_ddr_m2_ckdpll_ddr_m2_div2_ckdpll_disp_ckdpll_disp_m2_ckdpll_per_ckdpll_per_m2_ckdpll_per_m2_div4_wkupdm_ckdpll_per_m2_div4_ckclk_24mhzclkdiv32k_ckl3_gclkpruss_ocp_gclkmmu_fcktimer1_fcktimer2_fcktimer3_fcktimer4_fcktimer5_fcktimer6_fcktimer7_fckusbotg_fckdpll_core_m4_div2_ckieee5000_fckwdt1_fckl4_rtc_gclkl4hs_gclkl3s_gclkl4fw_gclkl4ls_gclksysclk_div_ckcpsw_125mhz_gclkcpsw_cpts_rft_clkgpio0_dbclk_mux_cklcd_gclkmmc_clkgfx_fclk_clksel_ckgfx_fck_div_cksysclkout_pre_ckclkout2_div_ckclkout2_ckprcm_clockdomainsper_cml4ls_clkctrll3s_clkctrll3_clkctrll4hs_clkctrlpruss_ocp_clkctrlcpsw_125mhz_clkctrllcdc_clkctrlclk_24mhz_clkctrlwkup_cml4_wkup_clkctrll3_aon_clkctrll4_wkup_aon_clkctrlmpu_cmmpu_clkctrll4_rtc_cml4_rtc_clkctrlgfx_l3_cmgfx_l3_clkctrll4_cefuse_cml4_cefuse_clkctrlprm_perprm_wkupprm_deviceprm_gfxgpio0_targetgpio0uart0tscadcam335x_adcscmam33xx_pinmuxuser_leds_s0i2c0_pinsi2c2_pinsuart0_pinsclkout2_pincpsw_defaultcpsw_sleepdavinci_mdio_defaultdavinci_mdio_sleepmmc1_pinsemmc_pinsnxp_hdmi_bonelt_pinsnxp_hdmi_bonelt_off_pinsmcasp0_pinsscm_confphy_gmii_selscm_clockssys_clkin_ckadc_tsc_fckdcan0_fckdcan1_fckmcasp0_fckmcasp1_fcksmartreflex0_fcksmartreflex1_fcksha0_fckaes0_fckrng_fckehrpwm0_tbclkehrpwm1_tbclkehrpwm2_tbclkwkup_m3_ipcedma_xbarscm_clockdomainstimer1_targettimer1rtcl4_peruart1uart2mcasp0mcasp1timer2_targettimer2timer3timer4timer5timer6timer7gpio1elmmailboxmbox_wkupm3hwspinlockuart3uart4uart5gpio2gpio3dcan0dcan1epwmss0ecap0eqep0ehrpwm0epwmss1ecap1eqep1ehrpwm1epwmss2ecap2eqep2ehrpwm2lcdclcdc_0rngl4_fwl4_fastpruss_tml4_mpussintcedmaedma_tptc0edma_tptc1edma_tptc2mmc3tpsdcdc1_regdcdc2_regdcdc3_regldo1_regldo2_regldo3_regldo4_regbaseboard_eeprombaseboard_datatda19988hdmi_0cape_eeprom0cape0_datacape_eeprom1cape1_datacape_eeprom2cape2_datacape_eeprom3cape3_datawdt2usbusb_ctrl_modusb0_phyusb1_phycppi41dmamacdavinci_mdioethphy0cpsw_emac0cpsw_emac1phy_selocmcrampm_sram_codepm_sram_dataemifgpmcsham_targetshamaes_targetaesvmmcsd_fixedclk_mcasp0_fixedclk_mcasp0dailink0_master