Hx  9U @w,w www@ST0SX0@S`0Sd0@Sh0@Sp0St0Sx0S|0@S0@S0S0S0@S0S0SSSS0S0S 0S$S(0S,0c5455cMDLDc|78c;-]> w////////00S+ Q \& /A-P@ ` pV: \ : "& \*000C0@0//(w$w w@-@ @ Q/00 0@00000wwwwM-`@qQ4G1U:1`M/8"ÌŌT 0 W030#X0S0 CRS  R 0 0T0F0 C 0??)0tt!9P S :!  Q *  9wwwhww?dw w: w@-@T000Ѝw0@- @P @oRPPU P @@oT RS   P004w@- 0 8w4wE-P@0 `R` T 0S0:00P긠pP  0P T 0S0#0%P ЍPPV0 0S%P T00PUT8w4wRQ00P0SA- ЍP@`@pP  P0SX: 0@T CR  SQA-p  P RP`  @rP W00V 0 R U @T:P/p@-p0p@Q#% PU00C B0@  Bp4w8wM-ࠟ`PD@0040p C@Q&"     i e 0a4 8] P    B  BTЍ8w 00 0S `2#>2/8w//a*0@P/ R/0@- R 0 R0#s01 # @0 PUS0A00X "r !\ "0 p .~. p .~. h w@-%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHw$ wDas U-BootwwRUNTSERVdPwxwwwww "w"w"wwwww#w,w,w0??Oo////@-e@/@-@@-0???Oo/p@-@P?0 00#0b0UOp@>?0/p@-@Po0P  0``&UOp@6?0_00;0 0Q@o0  CA_ov^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovVY@T S@No/N-N//@-@v `fVQYO@-0//tРFРFPHРP L8g((0 SGPGP 8 wwZw _/_ РP/8 /0Od@P TP  Q:< 80QR:/||10- $M<0 @ 0DH ! 0 $Ѝ/s@-0`40P@0ԸP  M5Pl4L`0T\\4F #| !|m0S 00 8 T6/Ѝp4fw;fw@wfw`fw/@-@4妸0S P@0͙wyfwfwp@-`` @P p  @-@P (!PڠP b@ fwfw0/@-%$0 4& 8' <|S S@@ hb)(0 4* 8+ <0-,0 4. 8/ <0 \4(oboxfwfw0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l  0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0<4"4",D"$H"@)3gw*gw3gw:gwDgwH D H  BH /9 4 (BD0 00/@w//@-3/bgwp@-@M p8 <`@P2 b L8L <0 @C02,00 4 2 0$ (2000 200 0 2VnNz Z c0C0vV2@0 @01 0x2tcTBT>s@3?sx0PPg lA 0AWDЍ0_ _@ $ظl$00 0_  0 /[w[w6nP P 0P0[w@-4@0_P 0$0_!0!jA[wp@-d0 _0$0_P P PEIR RSXS[!QAp R [w$0 0550$0==$0/[wP0 p02>p0/[wQ  000!lP  l //[w0 030/[wP0 x0;5x0/[wP0 x0:6x0/[w@-$00@_02@[w[wd0  _T0 00_S6S S S 00H/[w[w@-d@00_ @e00_ 500_S#!0!@[w@-0000_SK@ @[w` 00_S5S S @-S0@ _T@_[wp@-P@!.!.!. |!.t.l@h!.X!.H!.8!.p[wClw3lwGlw[lwwMbolwlwlwlw0P Em@-d0 _08@_PPPR`&0K #0p|#PP&PUjQ ,> D lA ,- S-!7-&  HQ O PH`v H0Ss [P\$0SH0k 0P0C0"SdRRPPT P$$ T Qh2$ $$0 QP/\$, D $A (= : ( (3 , (( ,  UP( %x!P0 0$0P 0$0!% P0 H! UX0H0 0S 8%eWP0D0H0@@S@` uHH0PS @D0S0D0 0Q <0 BP XHH0S 6otwutw͙w~twtwtwtwuw1uw8uwAuwKuwSuwcuw@wluwtwtw*uwuwuwuwuw.wmwׅwltw⣅wuwuwuwvwvw@-0@P 0 çЍE-@P`p(P ` A,%@ Ѝ @P (%0 ( ЍEvw;vwM-8MPX0S ,%@8Ѝ e @0`.40S S S  A$ X0 0 00 P@| @H`T@P5 H wkP A$@ @00@D 0 (`,0"Sv0  0`40S S0S 5P @6N A<$*PP e`P P 00p[RP ` @OT oW0Sp 0S $0S$(0S(0840,0<0` @d$0 S'00 `@V P xS`T |X0 0 00 6PD (A@Qvwpvwvw2awwvwHawvwp@-@PKSIS`Pp@BS@@`s@-P`S@P  0000 00P@ЍpM-@P 0(M 0!1@0@@a0 L`P\ x唧 p W"0S T@@#Z;$%L@LT>$P; @[8 0S@D@@G00e# LP (ЍMLQ <P0S <P @p KP p(U#t (ЍgfffIwvwvww wwA-@`p P0U 0 0p`0  P1:PP U0 /0P 0C0 @wp@-P`5@P0#pV00Ep"ww@-@M@@ @ 03?@o@Ѝ@-@ @82/03?@o<0 R/p@-`@PP @1<3?A0<@Tp03?00 0S/S/ @-@P@ wwOw wwTNw xwPwM-0pPs`@U $, 0V"V(000x~"U hy"%( Z:8  (0T&p P xwxwxw(xw=xw `xwOw@-@M 0 ddP"X\M"`Pp0 <"9" 0 2/1" 2/,"0 R#A`""PUЍ 0 : t" e0U0C?o20S  <\"P S @12/*B@AЍ@!$wtxwxwxwxwxwxwxwxwywyw@-J"0/[w@-ƥP @;"|wp@-X廥P  z"p0P<@4 @T(4@P  l"PDp膁w|w@- 堥P@ ]"葁wQ/xP  "0/[wM  Ѝ $0R @-o/'V/M-p(,PpPpb[_ `P 000 R0 00! !@P8Ti! L1RHP[P4 U NcP NЍN0S0V SV0S d CdPp Gh 0  2 $P w $dP 00v0pX0@pvwzwqwew\w@-`0 P F/@-@ 0( $ @ ˃w탅w@-aa(PP00`P00S@-aa(P0<00S //0<00S /%/0<00S /%/-<^ /%p@-0<`0S P@ c0p@/%pM-MPpP0`Ve`PpЍM0P p0 @ 0000+ 0 dP ` 0 R 0!@T0X [t@T Z t0Tsp0000l@|00Q/娥p@-@MR0`|00p 00JP0  ݥPPU Ѝp0@00(0@wuw0@-@Q0@0kP0(00<0ЍA- MXp@`8P E`P⦥P0 R0P 0 00 ᝥP00 Ѝ@-"`@-`000p@-`@FJDJPPp@p@-``@D0PP0 0S Ppp w@-_0PL;w7@-Pzd@P_ Ѝ07@-P@P Ѝ0@oPA-0P耟@Ѝ c 0S `bpW@DDA2d48BT0S pDPTh h 0`P H0P 0 0 `^P wwLww!w-w/p@-XM@P  0<`000L 00 0<0P@ P XЍp<"P ws@-P @`p! @0 WЍp@-M_00wwA-M@cP!0S 0S H`PV 1_`pU P0 P00S 0SЍP P@ < @0 P 0 P H P 0S ,P iPH Gw>wWww@-^00<&w@-@P P Q+@-0`Mq犝P 0 tЍt}@lzPdwT\@X 0T0UPP( 00 @X/3wuwwuw.ww@wׅwwM-0FMSP B `@0tP `PP4htP {^0 PP#0(0MpPP0   p0  R S0TpP0X00X0Fߍ0 0P 0L PꟄwwwuwA-1M Ppp0 0p 0$t!LlL*@P X̜@PLߜPD1` S`,) 0"@P P@ލ@ÜP t@0 000 嶜P , `PZP @L 0 0!PX00X00峜T`P0(0궄wwۄw儅wtw[ww{sw@wwuw wp@-X0P0X0@$^+^(Pp@wp@E-M@㊜`^^(PM PU ]P P@00@0/0 0 0P3<`@] U0H0   2 0(/(P00]BP ]<00  X00TpX0 02\ ((LPЍ43p02 p(twwwwuww0@-P @\*  0S*0P*SP: S*S0@ 2/ <Ͽ03?0M-@`p P 1!1\ȏUA@4O>@PA@>4O@M-@ pP0 `0S* d@ `X P6o4O`@`@4OA-PR`p@ AT0 P003?0PwM-HMPp`0Z@P(0$ $ 0BS(0S  uHЍ!8R90P0 $08 0S:000, ,0HS00S 0 (00 40$``P 4@T08 0@4OZ*!80 08g 0@$(0@pp0  10Gq[4p 08qp@ pG0` ! 8ycw\wM- P`p$@PZ 0  M 0 P@A-`pPXp P@ 0  dwww7@-P@P\T寚@P@ Ѝ0'0 ^@P ꃅwwwwM-Q M@ Ѝp`x!P@P X 0 } SR0F 0P @P7 0ppP e@p 0ppP6o`H 0P@y,J6o`rwхwᅅww#w4w$͙ws@-Pe@Pa2 A@P`P 0p `PI\@ЍpH{400 @P@5awrw͙wqwwww7@-@PP  0 Ѝ0@ Ѝ0ↅwE-SpLM0 00@LЍP`@P  @P000 hP0H  @\  ! \ 0 D 0C@P( @cw w{wwawmww@- 0 ЍA-p(M@PUPT `V:QH0 b p P+ P-mEP `P 0S`V0` 0`0C00h `0;P` Mp P $(Ѝ萇wwwwww@-@PM$ P`pV 0  STg A <Ͽ2/ PT0PPPPE5?P0Ѝ`0 P0*P0UƇwp@-@TpP `Ph v1Q H03?S ,1$00p͇www.ww@-@JBHB@EBFwNwM-0M@PP U `!PP(U0Ѝ 0 w`P0p 0 0$* PB 0`wP0 `P#?P  P,p(p pG0 ` p$` P4A 0(p`I}P꾈wswwwΈwM-0Su Pb`P xЍ00zP+ p0  UIlAS* 5 @PD= @P 0-?   /PA2>@0 101 0 Q :S0!* 00 P Z 0!01 0R@T 0S` @7?00-? @ @0@p+ Ոw舅wwwjwwpw=wA-$p(`X @%P5D0SL "0SI0 0S> @P0 3?RV PXP PP PH @ A(pAdP  rP @0S Ѝ0S@~PU @4OTU 2/0S00U0#St`5@03?0D-@⊅w wՈwBwwwowىwwpw ww3wLww\w/@-`M@p>P\PH P@IP,HPU b 000 ih0 `T0S0  #FPP W  2/GPP0S 0S 2?0 W o PP ЍYwxwww‹wrwҋw0/Rp@-@@`P0H@ F@P@pwCwE-BXP`M0@p00S:S#SQ iGP 0 S SliЍ8 00 GP000 0?0 0L[wwMw@-@ 1@Fww@-@@Pt p? h0Rd,PP?<?3P, (?www'Vw̍wow䍅wpwR@0A-Pp`@k@U`[ws@-@P`P `(0(` 0 ]Ѝp[w w@-@ (0$$LL GЍwwwm۶wwR@- @w-M `?^?ЍpwwM-@P`QXpC .Xa Py    0 @L QP< 0  >S2T" P TX  P6@ORP@v  PRЍ | P &RP \\ L P QP  K  P@QP  8q P    0 @  rQP 0  R 0TP < `wew␅we…wwiw(w萅w쐅wۅwwCwGwwۑw@- 0 @FЍH\wp@-M `@.PP#V 00-SP܍p@ 0`@(0`x CTpxTP 8PT0Sxx@wW(wA-`0BSpP@X EP 0 DRU(0^p0A/H\wǁwR@-rD@ @/H8w0 ~tw@-  w Ѝ䄒wp@-@8fMP`@0S 0< 0@ 0S`PM8L xxC7@PF  d$ TN@~D3T;8.0()$hlph R h uP ⶂP|yfߍp  tꕒwwwwwǒwђwݒwwww ww P lhwЍpJ  g@2T ,WQ R눶wUw-wMw000 000/LwHwE-@РM00p SP` 0T Px0@  0P @H0 T   V 0 ЍzLwHwPwTwA-&M/ X+a@0X*PD  @PD  04 8< `ɒP TŒPH:A&ލ5P( `P A 0 0?@4OJ@0$FJ 0 `PV &AJHp %L%T\2/@@@0  ~PL壹@P ,hwP  `PE@—wŗwȗw@-%[@-Z@-ZA-`0BSpP@X AP 0 DRU(0^p0A/\wǁwRA-`p`@PP @P0S d:D:0PUT Z:$ws@-PBU`:@-Q@sQpQ-PR`  pPE`000P@ T 0pSQڐ@P Pr :03/@P0@h Ѝp@@^[w|wwA-R2ՀMpP@ Up dP/P @B <98&P,: Ѝ PPJ`P Pi  6` R@_  @ P  `P@R 0/ @x P h @` P P @H܏ P 8 @0ԏ`P LJP ! 3BP!3   P  p p9 7/X9  x pK9[ww˘ww1w:w͙wewww1uwwKuww8uwwAuwwwÙwʙw֙wwrweww>wwR @- ` ` /@- Ѝ@- Ѝ@-彗 Ѝ@- Ѝ@-屗 Ѝ@-ߖ Ѝ@- Ѝ@-埗 Ѝp@-RMlP Ѝp@00 0{GPP `ǥP 0 9 w=w@-囗 Ѝ@- Ѝ@- Ѝ0QS -lQ  Q0 S 00S0\0S /ewA-PX@Pp U pT$ `P 8`TAy8Vu8s8B``>PW* A  T00`CA᐀pDVA Vt t 1 `W:X @pTL0DV0  4 `ewuwrwwww>w'w@wwwՅww@-@ 0@ @]ꛣwXwwM-RHM@Fp P@PkpGPW 0-S  X`1P Z65cS qS0SPpGZ 0@>h00S0@aP Z   F  < HЍePZ= ` h W   2/P*X H(PX ?T   HS@P.Wf P  ] W`03? T 0 2/Q*  P  D@\l0Sp j7 dPWE @VP,  P  @PW* ;PW@c 0  R ŻQ }000<SpG-Ph;P>QE WP Q@QP  0  0?R 0      0BQ  P Q [S0Z0Z*0]Q 0 Q Q@10 0D0]Q0 0 ,:P]e U 0*00W 04 0 @ WP 0gS0W0W0sS  @P >n[ s[W4p 0@nSM P0 RS PnR U  0@P 00sSⓌhx0@PP QN0vSBQ0 WP PpW P`W  `'UW!O2/U ``PE@W;W P Tg`W<aSDsSl@C@lS W覟 W@ @ PPT  0lPP IkUPtBQ ?\;]Tv 0@SS00 ?X P& 5Q A@TM@DXPA T tP* P10 3PXLXAX0@AQ $AX P`PW PP0hSSW00gSc@hdP @ TX 1-01P0  5O2/010 10101T01xU 0 1qT0$1jmpe&h PW00z 4@PW  p  0O PG00pS7P/-XN0 @POt000 0X0aS   p@ 0AP%-dSv [TP 4P@G@aWPC@ ?PPE %P PHW ,U`=tbwXwwwãw䣅ww!w=w@wsw㤅w椅w wFw*wXwqwPwewww@ww2wĥwޥwe]w!xw+wwBWwˣw⣅wd]wwww"w)w&w1w>wwRwlw?wwwwæwڦwwww-wDw[wrw9wwvwwwwʧw觅ww㳅w/R//@- Ѝ@- Ѝ@-ђ Ѝ@-妒 Ѝ@-a Ѝp@- @*R T T T0t@A0*S$S/0{S  /S 0}S00 M-Pp`PAh ^PEyXAVP @B0U90 oPPP @0U0 DoTTTTT@ T4HwfwfwwR@-@<P0Pp0 0G3P  /ᝳw 0 0 0 /ጙw|ww,0 (0 $0 0 0 0 /xwtwwwww,0 (0 $0 0 0 0 /twxwwwww@-r3P @2@-AM M`P Fg>@Pp@ ?YP*@p7 > P`V x??h 0`@L???? ,/$Aލ Ѝ7wԀw@wp@-`8PP9@P U0U0U00U0 R  BU0 R  BU0 R  B0P  /pE-R@M4`8@P<0DS qpܠ0P0 ` HP @ T0S PBP0 @dPG@ PBЍT T00  `@9wѸwwָww@-p`" 81@41P,"U  U U-P1 Pp0-SV0e+@/8PP^00@ 0ST0@P0P ЍUV@U UV 0@ęww*w1w7w=wCwIwƆwwR /R /A-p0BS&7PP"0 @ XX` 0P*U`0U U``輙wR M-@7`P\Pp P P, . T/ἙwMwp@-P @Q(`0 Up@Y WpwwwwM-RXMXP7` 0p=07< 00|7x7@t7p703h70$060<0P0ӅV=+ @p0@00-S@pV @zp@@0-S@ppV jV dp0$0Z  t<BP dPXЍ<0rS iS; mSP`  <*Pm [ TPPcPwSP` V p 0T0 RP `  Vqp5< =  `5 X5#P5@L5H5 D5$ VpP pP4UP;00:0@ P":0@ (0;0, 0`MP40 0ğ,P  0 000, (0`xPuP0 3>0lP  LhPpwp W0S (^`v`X  URp \P  EPpwp W3`v`h0 4@03P4$ $0# 0 47P L"D<Ppwp W`v` VOp0G 0 P  0P,0pwp W,0S 00s000 S.p@`ꄂ0 00S 3 # S R X 0C0aS  0 @ 00C?o2000(0( 0R:2S 0( pr' 0q" 0 S#R@Q!V3  Q!  H(00R%40\V3T1P 0QV2R40 40S !S 0RQ000,0| D<PuV虆wwܙwؙwԙw䙆wЙwvwмwww#wʼwwwwDwwswwww彅wڽwhwDwJwLEwtw3wwwwwwwww̼ws@-P`@  R 0-Q  R  ЍpQ0RM-`0hMP4p000404040@040D0408040<040 04@P_P00xSP 8000400S ( RwU $0SrU0@(r+hЍ0rU0pH wU'W /Hpp0 0W .FP, J Hh00D @H 0KuP< 8nPpGW 0GSW@P 4 0\PlU0D0@0eP 80@4000T4 0BP,0p(0W(`0VڀZ 0 000;/0S   0hPk 0Xp 0 ( 0 $80`,0Fp0SO80=`(0V-pZ0 ,;/0S   *hP P".0 $0 V {  0X`$/T} `00rU0400@00D0(080$0<0 0 wU t0 PL0 H0 @0 80( 00$ (0 0 Cwwwww왆wwwŅw ƅw3ƅwHƅw\ƅwcƅwgƅwp@-@`T)P$?.0P d 0xRQ@P :p0Aq ^1#!0*PdppM-p`@ 1PP 0@DSV l0Rd0S \P00D * 0 M/p]wǁw^wȅwRp@-@ h`@[PPPS@pt\Z80@P44HT @W@P@^wɅwȅw␅w!Ʌw@-pMPp@`nP*?`?`SP0 48 P0   5b 00 4;0A0 Rߍ Q 00Ceׅw @-[E-@0MlWd0TS!qHX @r00R40TR8",dR (U,UtŸPP4 P(Q 0"SI) "0S" <)d" t20p"SkfPdP`g`O`))"8") 2V(" h0?d )V ) ! )!) 1Ua` (  z`㸠Ugp0 `Wvpp0 W<1WT! eh0S62 <(VR@PP(?0S S S  40S@%QߍqT*X _00r00R40TR8",? ( (DɅwPɅweɅwnɅwɅwɅwɅwɅwɅwwwɅwɅww1Ʌw-ɅwɅwqʅw@w4Ʌw ʅwʅw?1ʅwDʅw9ɅwTʅw9˅wP˅w\ʅw>Ʌwlʅw˅w|ʅwʅwʅwʅwʅwɅwp@-`P}Z@PH@pJYPPU0 0UPZ=ɅwR@-@0oR'0^wM-@M , `a40P0 0St=(@@Ѝ0S{@p0TJ@/(0S 0*(($#( $0 3`P 0@S` u@01$0S 3# ~@0A$0T t3t# x^VP Ʌw˅w˅w ˅w˅w˅w˅w0w0w_Ņwe˅w˅w#̅wA-Pd1 BRT  L1@`PU)  H:1pP! WW0@i0S/M@@P`8p_P@P` 1X (p1Ow^we…w␅wS̅wq̅w,̅w̅w@-L@6P HA:0P 0S Y4 &^w̅wR,A-@R`Np@PP 0 l=WPXX :P40T, , T/^w̅w̅w␅we…wͅwR1A-@p` 딀@PP 0 pWP\FX0 C:P40T, , T/^w(ͅw̅w␅we…wXͅwp@-Pt0`@P 0SPv@pV (QP@fQ^woͅwͅwR)A-@pP |@x`P 0 XEW0 9P80T0 0 7T/^wͅw␅we…wͅw@-H@PWP(%GP ^wȅwA-p`P@d ,P 0 DS U40Q 0A/^wǁwp@-M` P(?P 0d`@,@D 0, 0RЍpH 4T,00H 00,@,@D@w ׅwE-@MP7`, k:p, _:BP, : PB,9T:}PD , i:VX 0 Cx W | 0 0`0!00CS8!8!!100Pp(H` 0 `, 9 PЍ:Ppp 9s PPD0 9@P 9P 9P 9P }00 9ꇼwׅwׅw8wׅwׅwׅww>w@-@ M  e Ѝ@-@ }<PЍD0 <l9P D0 R94/Q/@-M?@?@< PݍׅwM-@ 1@!  100101S l\Pp1S@ЍM0 !$ #!"!T$1S $`ذ%1SpP*0  +1J0S S S0+10S.d( `"؅wׅwׅw@w8؅w ؅w؅wwV؅wj؅w؅w؅w؅w؅w؅wօw؅ww؅w؅w؅w@-@]w, 8PЍD0 9P 9P  9P 8P 87@-P ;P0@ Ѝ0D0,@0,@D, 0R80S 8P D08p80Sw@-oP0^wwR/p@-$P M@gP 30SЍp WP m MPU =!m|20Ss  :Pt h 0PULC@4p@P$h  P`Uӳ+P\`P  9PP0SSESF0Cf0Cs Rx! S0 d@U, PdU0h  0TuP#0$  hp~@z@v@r@nlT PЍp@} 0Ѝp@ꮒw\w؅wmjwمwمwمw%مw5مwwwfمw萅wxwxمwمwwمwمwmڅwBOwمwڅwۅwۅwڅwڅw5څwNڅwڅwjۅw^wR[M-RpP`rDӐMU@ 0 X.PP0D00$0 000 3 P   ЍfP"P  0?3?  @p0 3 P ʿ00@u/ޅwޅw*߅w߅w[wM-`2p@#vW&+W@ %WP `Pc  1RPtЍP`00SH20[0W0S()Z P  U%* 0W ??[EuBu[ [ hd-dl[ 0@P L[wow߅wA߅w'Vwύw'pwt߅wow獅wpw߅w#P #b-#tww/ /?@- @ xx0h!h x `x Xx P x Hx @x 8x0! x x$x(x,x0x4x8x<x@xDxHxLxPxT xX x\ x` xd xh xl x px |tx txx l|x0d 1wܠwhwwxwwLww1ww\؄wׄwpw"wHw.ww@wwӄwww҄w1w`w0 0R00/0 P/0/ @0S/@ww@-P w@-    @-6P"wM-R00@ `@p㼰@T r~P @Ѝ0PU z`^@pW0P$0P0ZPP4wnw;ww0P D /   _P R=@o//ewp@-P0@S `d00ePz0S  P0 00ppA-0@Sf Rc  000|Sp0hQh!00[0 ` `P41`,!0PU S a0SP00P :P 000S* PP S P%`t"` V* 0P0@ R D0 ,0 00 0p!wƆwP @TPP P$N*PW'0S$p@ 0S @W0S00/lg@p @ 0ZP@ew4wSwM-@P` pPX @ P PЍU G  @`p  :PE fnPPR PPN0S P ]PP ` 0 O@ PX:00U 0pS7 `` 0@S. T0P0000-S =S0 +S00P [ P)PsT@uX:00iwA-PP@M% @T" p aP㬀@ 0S c\`0@0 0` @EtD0@Ѝ0@0 0P@3w3wwDwM-0@8MS7 `Pp 0(0$00000T6 00CS 0P0, 0 S00000 0 VPPU# PPUP0 `S@ @ R Q R 0R RS 6 p8Ѝ Q0J0 0J?o 2R0S00 0_oRZ00SZPPUZ0Sx [00[ 000(0,0K$0$0P$00(0 0$ 00P0UJ(0$ 0 P r` 0S$0 0S  S` x0P0 C} 00 0 ,00 iH(h0 %0, `00 P0  N 0  0S S PU  p_ Z Z0S Z0S000 00 0 R`ph`1,  0xpP 0, `V`S`Vm030,0 1 01!004 b`P4 `Q p2P,` 00SS00,000C 0p0000S 0X0  qh2pw 0T"pCpp=`P00 `B  R P P1p0Sp Z?o2 Z000W 0[SpPP` !R   B p, s 04p00VP` >0S 8 540p0S -u0 000R c`s;]1P  0`0,(0PAG S0 0w*w|wM-`@M@ ↳0 P0p<`,p$p8(,$0p8p4p-kP&  ,j    0S 00 03/p/40S $4$(pPup8%pQp(P{  5R00SPUP@Ѝ 4R p [  2/W GQQ  W$P [$0S0S00S "0KS0 \[ |[ ;[$$ 00#03/ Pp 0y 3/z   03/ 03/\sp   $ 00003/p0000_P0SJ 03/ ?P {P $ $   $  03/($ 000 03/ 03/}Pp}Pb0 0 03/'PpqR0SP x0 00?o20$6&Z@ 03/e$,|Z6 03/[0 0 03/Pp 0S& N 1 40S 8u 0 000W  X '[#![[ 0 40S0SdM000(0 00 Xww@w@wwwwZwew06003 PT!00U?o 0c p0C" ?L1cs0敧10 C `c2,# / 2#&<. R 0QP 0$ T@wgfffMww4 r4//"p@-0 0PP4P@ @44 8 p@H00C0H0j 00M @- P\Bw///0<00/@-@- Zw@-@3P Zi0@h, h hhbw[wvw-w@-NBsw@- +83,/(-0 ( Ѝ{wwwwT X T+@-8 @ @4 @-4404 0C0L  =8宪wGwLw@-////////@-08<0080d)`w0@-h P @%wwp@-PP<`@ 4@pP @TTw w 0000 /TwPw@-@P Z@@p@-@P ,0S 00S PP 8p,0 @00 @ R@pwTwPwP 0 0 00Q0/PwA-tp@ThnP4`V 0 @d 0S ,^P U@WTwHwMwUww@-@{P 0 EPw_wp@-@P@P uPpP pPw0/PwA-`ppPU` @40S 0S PP@@ TPTwsw 0P/PwA-P`@P0 ,p7/Ps@-@P`P `0 0`6/Ѝpp@-LPLp@T <k80Qp,p@@TwwwPwwwA-`P 0pP Ѝ?@T  0P0!50Q20 07@- 0@PP 0   0P d` 0P <0 0 d Ѝ0 wwww7@- 0@PgP0   0\P` 0TP @<P0 0 , Ѝ0 w ww-w/0!-!" *,-+!0 10|0 R|0S|r\0@-M@T: G? ) )0 !) Pn\PT9S Ѝ0S@Dd@-h00Čd00$r  Ѝ@-MGP?P`0 pPP@<ߍ $@  ⦭@Qw}w@- @R@00RQ1h|00  @P1 S|00 S S0 44@S0h000cwwE-@`pPXM0h d0080s0 00 SPPUЍ@-r` qP  p@P0 00P0 00P Ѝ R0S P    R0 PS s R0  ewSp@-ɀ@[PPpU 9PES)0  Pp/7|/@-@0wh`K?M0000 0 ```PP C @t07t0l07l0Ѝp@- `MG@?@q 0`PPP Ѝpww@-@00q P40Ѝp@-0PGAMTʄ `V &1S00hqČ}?00r 00 0 mЍp*wQRA-P  pS00S M  ݍ0(?@R`?@ 0P0S08090 0PpG@ QP10#0%*Q?@ M-M@`PP]pP?@?`P 0 mpP !B? &PЍ`p pPQHg R8b Q PpE?0 SQ  R8 0RW R( Q5 RY0 S" QU ڤ DP1U[`S010 G ẫ 0%! &!0pu 0E#&! &! A S!u 0%Z %! J1Q Suzt,   n L`0VP0hd000 000! XPP )pPJlPpP(p H`    Q 0 Q 0 Q& 0 !Iwwwwww6wYwwwwww1w0A-pM0P`Y@P *Ѝf@PXYd0p00wp  000p@P@ tV ЍA@@P iww/A-@p`,Y!$0S00$9$P $000$P@w@-d0h00Čqr 00 #0 Ѝd0@-M\*)@h00Čr 0 0Ѝ@-d0h00Čqr 00 #0 ~Ѝ/@-.$Pp@-0hMČd0 0@0 q 0 0Pa`P, P 1S 0 $ 0< <0#40ЍpM-M??`p P@P@ j@܍TP  p㿀? g@P$  P@pWȰ@ S@  S@@ , 0,Y@P mt ( b< S@wM-P.M, 3#@P `?` P5Pp W p ,P ҩ0 0  㓩  ⏩01 S 0 0 0R 0 000 90 t1S P0<0`0@S[ S451S2 @0`Sh: 0h d000 00` P]UX&00?W, `P0,980p2 ` pp 9VJtaP  Wp1dWd` 9V;`,s 9V; 0S003@TD00 7p`P 8`1SV0hv`d000 000 0`)P.ލ` d`P 1 PP0  p0` 0 0C!0 0S R0P(:_0?` }P D0P:0 0 00Რ0 0002 0P:   00L 0@ 0  7  1S .p  %00SP ^0     q   R w aw`w/wVw@-!@9 R  /@-@M0h}?00 00  0 !0jP09h 0h0s8 0h0h ЍIp@-(MP@  410hP}?0 0P 00 0!0P+X 0h0<`; 0h02(Ѝp`M-!0!0@R3P0MhD% 0G@A@000h }?00 000 !0`PI 0h0I0Ѝ 0G@ApW  200 S0 0}?0,00 0$ `$ 9S  00 9,0Z`9 00S0,0Z [0K ,0Z  0pWZw0s@-00@0%0 0$0` _0S PU0S dP 0S 0SS P`Ѝp1S S wE-@PpQMG`?`> 0Smp 1#4L01M01SPF Z 09,03/Qߍ 0S3 00020000@0060S 000 0SZ09 B0S$R W "M  L @ 0SSS S X M D L @ $m  pPwwp@-h@P `圦00020000@0060S0 00003/`p耝wM-pRJ `@^ U U0A 000`S 0 U{P&0  ``* " (, (( / %$ 6 R   0 P2/P    00S 0 pGTTЍ [`ꀝwM-pRJ `@ TT0A 000`S 0 U{P&0  `( " (, (( / %$ 6 R   0 P2/P    E 00S 0 pGxTTЍ [`ꀝw@-}? h00Č 00 0ЍM-<"0@ᣁ 0RMX'0 pwh0tp`1?`000003 00 0 P֥}?0 00q0 PGX0O?G `0gd0h 00`aS ` X}/  P 9 X  Pp} 00 0 p' 9 wPpP P0R0 0CS 0S Q03ލZwhwUSBCUSBS7@-}~PPU8v Ѝ0@nPr)ww 0 /dwP@-(\$@$XP`[wdwwA-XF`&!1PSp?"10CS;@8 pP"1 0#1S 0'PS(!1W!,000 !R" kP 0S 0S 0S 0S 0S! Q"  !1 Ѝ+! R*   +! R*!  .!% 0 Q060 Q %0S0%00 h0 T0$9SP0 S47:03IDw8xww|wywwxwM-`PpMB忀?㈀0 0 00 \00020$00060S0 00003/P pWXB0S L0:S M0L B  0S p ܍[p1 320 S0 0ŵ T IP   ^J(Yb p 0儀2060S0 0000<3/P0??00 ሀ %000200060S 0 00003/P Z*- 000 02/  3?|    d0!QS030#!20 p|ꀝwJww :w̪E-M'P@R,  `P@4RЍ0h_@}?00?@ 0@000 pPܠ0  0 000<000, }0 @P0 0 p0S000#@PHH@P #P@#@PpXdw\wbwrwA-PP p` @TV P@P@T @QPM-MU (0@S 0`S#0S0AG 0S 3/p 0PS0S9  8:P, 0W ?P R 0P2/P 0 PC`oUP 00pt܍3/P 0W P 0 PC>0U0P0S wwwM-PP/ @p `V @P P? W P `PV  $0 $ ` 0 (00(0A-P,p`@P 0 U  0 p` (0 EP@P 0 0$0A-@PP 0` pCP 0`SP  ,0Q R R  / /np R  / P Pa R |BQ- OP[P P/ .81@Q [Q0P ~P 1AQ 2Q0@Q     /~P /  /  /  /  /  /  / /}GwGwGwA-`0PS0Q@ SpA"0XW 00C0ts00C00 Sh0000P|[00C0vZwRwA-pQP; W@j0ЍW%0GS900 0S2Q `A`F eK H DBV`F8<00C00S 0 000 S*'000S 00C0AP*`F`V  ( \ W `V*00C00S*$AE0 0CS00S 0A0*40 00# 0Q`A 0 S" V 0F R p B0A0 ``X`X`pGpW``F`` `00C00SQj "0 0CS0^ 0S[ x"W0S CqXXPH20a}ESQ 00S00Q !aV 0SQP# @laS00C0d!dJ0 0CS00S 0 S:  0 00000 P 0 000C! `R0S00CV`R` `FV F%0p H R000`V 0p  CVww@wwawƆwƆwƆwA-@Pp `ݟ0V 0Pp`0 S GSX  000wM-0p0P@Mn |0S`#0\#0X#T#T0P#0S 00W e,(@TЍمwwww캁w躁w gqp@-@ Pa`P P `WVP p C0@0`RA-`p@P7OP@0IPpV/w@-@ 0P0Pwww@-PT(oJ?0P0 @ 04/ www@-M-pP`@.^PPPEdP0`J*ZX 7PRU `@`0  B0B!wwwm۶ww@-@ 80P _\ xww%wM-MS`@PH100 M 0Sc"!`DVpP0 ( $0 P( $0 0pZW PU 00 K!0`FapPW 0  LxP eP P0UfFwPw7@- NoP^P@  00D0D0wˆw$wwp@-@P5P 0P.S0Pb0Cs0SP PpXcw- /- /@- @4/ЍM-P `0pLP 1@ T ,@P PЍ@0 S 0RP W 000 ;/WP 0 u00wwww>wpww@-0    㪧 PЍ00@p R/a CRWC/A CR7C/@-@p pM-@P`0S SS[  p Ѝ10Kpp [c @p ppwp PpwpZ;p ppwpP@0@00p 0pp@00p0 pwp@@0@ p pppPlZwp@-@PP}PPpp@-P ЍA-B*4S 40*4`p䁟PP`UU 0ES 0 U$4p0W$4P404`P Ѝ 40 4V P UQ;0TPEp`44SP (4S4 $0#S P 0`0}P(4$S \r 40?s0S0s0R $s0R͆wZwцwцw͆wцwцwE-dB0P 0(4T *T04PTT T$T8T4T+T, JP ^?(40SC4S+4 4f p`P ^, 0 4W A\J7 AuVpGW0h(4!(4SCc40404S ,04PB`V p`(PP4S/4 $0S0 Q  Q 0Q  R  ABQ r xR00 ArAPA ^Ua AR\ 0S Q40*40 404 ЍuP͆ww_ >wM-p`xB)4S4SVS-+4S 04S ,x04P0004 PPTQ+4S+T$ 4R@0 Q*4 $ 44S 44S,)4STUUP 4`F0C44p04$40SP Q SPSPS sPC8$ S0C08$450Cs0RP'[u u4S0)4(4SC404DP}0)4U   +40# P(4SCl404͆w/P@- x@40CS\ZXVTRPN 0)4@4/P@͆w0%'5/3ww4400C ,0P/Q/̉w䉆w̉wp@-`T T0P0CL@P p@03/P00p@T@̉w䉆w̉w 0S} E-@;QMB Q? qn ЍEB'Q 5Q Q kQ H AR132 xI0^ #}Q Q X#^00I00  00, 0S  1Q10 I0^ pW$ X! @4US0e03몦 &Ed 0@xЍlhd`XЍEjw+w@wwA @www[wnwtMwwyww̧wwwwwwp@-`H H0PC0<@0PTp03/P00p@̉w䉆w̉wp@-@-PPp@ `/NQ4 5Q/ Q4 'Q0 Q ;Q HQ ~0Spp@/kQ ]Q fQt }Q Q` XTPLHD@<w+wCwswww_wew?wօwHwLwQwVw<&wlwp@-@0RP`P0 P 0S  3/Pp\p%p0 p@-P@P000LP0,, )PPpwwM-@p.kPP ᦾ0@E0@Pc0`0S  `RЍZ O00S d @P00` P@ 0S 0HS wwM-PMpx `mU tGPPh@ЍP 4P :P  : J }@P Z R ½P  R0  hs@PZUPP2 R (b@0OoBZ@T U\@ 110001QR 3 #120 z z @PUL  R  U ZU(f @P \R  Px x ,` HP   @x    `!PQ3#!" (w wׅww(w-wVwuw̪wwwwM-p`UPP@ 0S@ %@ P @0S  03/P @M-PQp (0 0 0@P# #`P . 0F  s@P ` @P ~ TЍ(w w@-0kS`  HST  P SH  < <;S 0a0(D Ѝ }SwOwUwGwXwJw0@-P@|M PL0S@T@|Ѝ0A-p@P_`SP0S@S!3#%A-@`pPPA0 AgA-@`pPP. AA-@`pPP0 Ak1US)p@-1PS&0s/ R R0PS @S@QPp D6Pp (R P dp/pmwqwH-0?00@0M?P?P0 @TP K`Ph0S1Sh`l0M-M0 ?0?0@0MO0`px K@?3 Xl00 K 0 !P  0q!UQR W1K 070P0 o/ P60PS\. W P\* 0 S<30 0800 080 L,C0 0C?o2R00 L0K0% KPⒻ0u0W P P\ PUPPUPP0W0 0@000 0 c z R PqP0000LP S<3,0PPfwwwwww@-0  0@ЍM- M0 X?0?0@0 MKW@?@0 pjP  P !|oo`PW1O0@QH @oW Q00S 0S>PT0 SR 0W 0 00 0 `VQPAo0 (0 8xx\$0 l0P\ 00$0@ ]W SR wwww@wwww@-@ I 0 kЍ4wp@-`P@PT@p\0S@P p@-MPN@d0S+ G`P$@0 P@ 0p ⧺` 0}P *x 0@ P s @TЍpbw_w0( \/0S/Mwhw@-Pp@`P0avP Ѝ@T}VB`yP0@0,@D, 0R 0PSLPiP ,@MwMw0E-p0`SP@0P,PE0, 0RT 0S 0S?P Ѝ@,P,PE@-@`P p P p0S U@ PT Ѝ@- @P 0S@ Ѝs@-P@ p P` 0S A@Ѝpw7@- P@P1 Ѝ0ow7@-@P\& xpp<@ Ѝ0P@P 0S@ww0<0S 0S /%//|p@-@Pip@p@-@Pmp@A-`pPP0@ Ѝ0S0S@ ,@0,@D, 0RP@-@P@|@- P Ѝ Ѝ@-@ PЍ@ЍE-@p`0<0S% 0P0 0P0 :/V@0 00D ЍA-@pP`0<0S 0 A/%A-@P`0?0 0S 3/P 0S 3/3/P P P P@-0%Ѝ@-Ѝ@-PMp@`P W @0 000`0 Ѝp@-@PP9 D0 5P,P,P1 004P $ RDP- $0S 4P 00<P (0S@P (00SD0:D0PPD0  Pp0S@P P;L R3/PP s@-PP@ D0 @Ѝp Pt@P`@P2PD00D00S6@P%0S0S%D@P& /@PD0 000ZS  '0$0S 3/@P D00D03/@P 0S 000ZS & P@P HwwP/P /P/P/P$/P(/p@-P`4@<@D<0Sp<@`<@D40S0<0C0/ <0 4 S0<0C0/0040<0C<\/  Q0/<0M-0`p04@<@D<0SP  δPPW@<@p@-P`@ܴ0 p@//P0</ 00/P 00/@-P ЍD00S< 40Bo/D00D0//(/$// //@-0L`L@0ph0˦PPhѦ@Pl h0: P 01P T  h% Ѝ0PU*ꌇw07@-@Ph 0 L. Ѝ0@ꌇw@-pp@-`< <00C8@PT@pP D@wLww4400C ,0P/Q/HꤋwԑwwM- P0@@DAဠp`T uUP vXЍ 0 !0S00V0S`pLwLwLws@-@P`P 0 00`Ѝp@-00 ЍM-(MH0pR000`NH $ 0P44Q4A0 @DP00$0S@0000T ³PP$p(ЍZ T D@[ [ P ~P0S ZP@  [ 00   `ap PW 00wwwLwA-pQPP@TЍP`P@0 {0P0U0S` p@-`Q@LD0  P pP 0@04P 00p@0P09e`P_P1 @P P+ 0Q P) 0 00` d 0 0(0S 3/PP 00S p000 0 000e@P PA-`pPP@ ЍhLV@ ,@,@D,0SP@-P00 Ѝ/A-p`@PP@T@ P-V@- 0^ ,0C,0,0C,@^ SQ07@-@0PYP0 0R,0C,0A,0C, R Q0 Ѝ00@-0@=P 0S,0C0Ѝ0 0,0  S,0C0/7@-P@T 'P@ Ѝ0E-0`Q@0 p@PP  Ѝ 噱@P崱WP ,P,PE,0 S@p@-P`@ᤱ0 p@@-0@D  h R hS0 , B,QH, P0q7@-0 Ѝ0@PP 0,0C,Q HQ0 ,007@-@Q0 Ѝ0PP0,0C, R L R0 ,007@-@Q0 Ѝ0PP0,0C, R L R0 ,0p@-@0P0L DP p@pQp@-P@qPPp/0@-@0  Ѝ@0@-@0 \ Ѝ@0@-@0 w Ѝ@0@-@0  Ѝ@0@-@0  Ѝ@0@-@0 n Ѝ@@-@000 Ѝ@@-@Ѝ@@-00 Ѝ0@-0@P0S@@-@P0S@-P@T P/d000Cd\/00C 0, 0,00 0S 000S @-@3/P00, 0 0,000/ 00 0S //0 ,0 ,0/@- 0@00S P 00 0S @/3/P @-0@S 000S  00$0S 3/P @/ 000S //@-eP 0 ,0,0C,Q ЍQ00P0Sp@-` @P0S0P P @` 0 0pQ Q 0/p pQ00P0S  0 S/0 S/-^ ^00Q  P R  0P / P/@-^ ^@ 0 @@/Bo/M-pP@`TX 0S03/ 0 p@`@-@WPP/@-0@@T c 08@Sdwμw wp@-0`AV@P m 8088&D0P@ 0S300`@ 0`pTdwμw wM-`pTPP U0S W@ 7/PP@-P 0@ 0 0@-P  Px Pup@-P@P pw0@-$ $P%!@0Ȱwwcwμw"wp@-@PH D0E@C 00S:>PP8rPP4D0 *D0 %D0 }[PP0S @0< 0 P-Xp0 038s0.PX{0pwp0W0 0P  0S 0 S0 @ 0 @P @ ?w w.wUwwwww]wR0 0 Q !Q1 H/E- P$MU@ `r n010P01P OP&p ,0>>,0RPP $ЍAP}9EPIPPp0Pl00Q0  PP]0 P00 10S10 00 0P0Sh10sXX70 000 P%)00000 0 R0 0 1 0P0SpW/ 00S?00 6Q(B PnpP㗠pUtP00SዠPd㽠P00mVF^Pnwwww@-@002,0P $1z1P00wM-@bMP@ P PbߍP0SG P0PSG030800 4<0{PP0 @Tp036 8<00480\PP0 S@0#86ı 03080648<0JPP  @0DPHL`RD0HPLP`.S- BR'  PP 00PS`PP00SPdS?!00 6X* T! L01 p0l00US!  VkUR8| 8?8.8 P0`N%n&3.5"1 0 0 *++,,-<Qtt0P|0\ 40s  # 84<08 036 848<0PP|p`pi`<PPt PP* R7056P (8 TX0PP[3000` 0 0?` XPT`pp*PPI03/< 0S81 S8  800(0 2(07@R! pQo`?`0p07t0@0000$ l⼆$`,0(0VPP03? pW 03?(00(0(,0@g><7V4գ0W0 0$'% '#'!'?1.?: 03`0 Q0 Up UrEopr037 70B/00&(!B 1 PpGoB?0rpBq 1pPUP URE_oPRP 5R0S1p l0n70p86 8p0P 08@0x00Q_Pt0p00?Pl plPaP0E< 2/S Q6 S$P%1q0 P%  ?70U  oʹUXP1 10S<t0|000 0t 4 |4000dP1QR 3 #1200 10t106 05W X0_  s  S$ S( T #`w@Yw>w LwLww@@@@dLw̪PwfwɅwT@w@wtEwEw2w|>www4/@-0 R H @PH Cp@00,@, 0R,@Ѝ P 0ġ0,цwsw/@-@JP@k0<0 0S /%/0<00S /%/0<00S /%/0<00S /%/0<00S //0<00S //0<00S //p@- P@LP P0 P UX"TT^p0100200 20 LLfP000L_P0 00LXP0 00LQP0@00LJP000LCP0<0L<P0x<0L5P0`00L.P0H00L'P00;0L P0;0LP0;0LP0;0L P0:0LP09 LP080LP 090|LPp020wwwwwwwwwwww ww'w4wCwRwawpwwwwwD00 @-/A-@P0wwwww0<0S' @-M0 0@0 H0p0t H0pP4PX`pP|P 04008 000 0P1Ѝ%/rwww@-00M-(Mp`PF@PP(ЍH PPᖱ`ᒱ` x0S 0G0 e000C PU*`GQ 0S V`!0 S|0B Q #  !0$0  0 P0 t0 0 P&000 0P:PP P wfwM-8M`plP@P H P|JP0P`XP1 `V0  U/ p8ЍU) U  !| Q$00   P0j P dU 010$ 0[P0P|0X*wxwwM-0pS0000P0 1W`0 ᏰP[P. @ 僰P T % zxv, @D , , 0BD<0@,@d@$0DP$0,0 0,0(`Ѝ苰@Pp@-P@0 40Sd0SOP p@d$0@TTpp@-MP@h`Lpup`> 0P!,000P00!H 0!L0 !PXLdP040 LQP`8 d0` p0`0<0 P `Ѝ \` `P U0 L LL 9 <0P0<0wwwwwwwwwwww@w@-@# @A-P`#@0<00PUPp$04#S<S V %GP$04#S<Um` `0<0dP$0EP$0p@-@P < (0R 1R@ 40S,00 0,0(00(080S(00 S(00(0pM-@`P0p@00$0$0$00UT 0 80S $0l冝pЍp0S pP "1o DR0#D 0D00 0?00?S`xg| 0800<0SW0?o0cS0?, (8,00 0C0s00S0R 6"0 2 768 88 8 R,5?$ 00 00C0s0S U00 00! Ep,04,0,0U,03,0[0 SJtGR0#D (8g 0 0PmpU0300 0  , $0 !,$ #,$4 0U 00C0s0S  0000 0|??fp0004P $0d!X$尜,0<w]wpw/M-P@p+P0@0HHmP U0  (农`"Wy `,04,0寗,04_,  , H0<0h0<0S000140@0    (  & 0x!00 D 000\1 0 T1R 0?00`0@0(0(S 0L 00H 88400`P Q @@,04,0`P,0",0 0,0 8400040 0(0,088,0 IdPdm`U0 0 0D~`7Pm`vwww;w ww_ 0 _ 0  R40 R,0 (R$00 1_ 0/d$$Q @-//p@-@P00P# Up@p@-x 9+7  2(@8_@0P0_ _50pۖP 堛p+wp@-(@_%9 $7028_@0ÖP0_ _50@_ppᵖPzpAw@-@@p@-P@ _0_0_0 _0$048<3?_0 08<";0_ 0pp@-@pPd@ ^j0  0 0 0 0 0 pp@-U0@0_0__ 000_㇖PU0$0_0_ $00 00ps@-P,`2@ L{P # 0 { 0 0t40BP `LiP@L0@0 <L^PD(ۚ0D0ЍpVwawqwwww@-@(($A$0P A-P`5 ER,峚??p@?duP_0 1P_ 01p 010s0_:#;_ !0P@pd<0__$0 3  _ 0S0?o20cd 010s0_  `Vw@-@kP@@_< <0 8340,: B04_D0 w;U?KLk_kM-`r@pP@ e*0P0@ P7d0,0 e ,d)00 0嵀P U *0~?  d"0S $0(_"0 _ 0D!_0 1_ R$1i P6 ie P2 ik P. i P* iP& i P" h P h1 P h P h P h P h P h P h2 P< |a_,0! _0! _0!@_ 0 0 0P  __P0~S0_! _~?Pc0$0_0_ d$0_0?P0?0s0_)_ 0< _ 0? 0?0s0_ Rp(P (0h 0g_ S_R.0P!ǔ_$0 3 wX wM-`t Pp@@PㅁQ; P0__0  )P[00_0_ 0 00_ 00_0_ 0?@"c0s0_ =0:#: S P 0 R0C R#@b_$0 00 s? ?00bR 00s0_S_PuP_?pPE??b d ?S ji_`_0_dwu w wp@-P`@Pl巘@p\0v,0T0T00P0 (P␘P ,墘5 w4|w{w w w wM-PMp @`P@<P `PЍ@2P ,$d@(PQ k00PEu, d)0000 0 0Qb@[0  ~/0 0P0840S 4P@ओDP 0$0_0_ $0]눃P0$0_)H YPW $ QH> Q 0@0 DPP  `}5P)t b 0AS000000 LPP LPP,H0 $0P , (0 P0PP  H,EP=` `cw w: w w ww-ww/A-PP`p@PU @P Lc0 000 $ 40 0C8`0DpHPS00 ( , 0 0S 3/P ddz  " 80@ V00W0S`A w w䉆ww䉆wwcw+ wZZA-@,0P`p8/P Ƞ0 ,8/P0p00M-`(MpP U0@! 0TPU0V' 6//ob5??oPS4o 0P P 2s 00 R pAP (Ѝ3wp@-40@SP 3/ _p@00S //00S //P -,^ 0 8//p@-@ 0S 740S- P+ 0庖P K00pQV孖mPpP ᝨQ`h堖 PP  P @啖00 pA w} wq wv@w wp@-@ 40S<,0`00  _1     /  00p } Px  d0 00`kk0 V g  ? 0@ [ 0@0P40?  d00p@-P^@Pp@-P 0@T 00 84/Ѝ@- @00P;<@ s0A-4P@U 0<0@00S = dS"<< AR< s0(`,0 `(`P >2@00< ; ;@0 0P*  s0P P  pP",00   x0PWPU AP P  Pp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0gpp@-L@@ p9 P:P  {a@  `V,p m@P㶐 wE-QPMp LPZ`P :@P  t00` v@P 00 PV 0008  `$Ѝ wZZ wp@-P`@q0 v0 9p@ s0 QRp@-,PU 0p@/P@0 ^ p@ p QRA-`0pW A/P2`@0 0S0 A0 p@-@PP   d0 0 00P0pL00L0/0 @ <   0000//A-PpU 0MLPU$ `P 0 5P ` wЍ VdV 9VV'00V00S dP@P   `X@` \mTiH e000 000w-wk w w wÅw w@-PL`PMЍ`P@V  3 0Sp9pP p P 0@pvP  ,Pw w w0<0S /p@-@L(MP! P0PO 0 R   ⼓L `P%(ЍpP0#100U Y1TP @0U0P T0 D DD廓P   ZR0<0403/w www wM- M`@PLp 0S3??o00 h"0|P T0"凓p ЍZ  uQ T0 L8"8) `P p 0C1h!00ǀpP T0 !X0  0 p R! 0  0 prT0 !( ^0' ! P Q _Q@q_ Z     _\ P_ _- www6 w^ w w wA-P@`MUL T0 !Β0`p` `Ѝ p P P0 he h *P 0h0p 0``&P T0 4 4@h8 0ۀp Pww w w www@-@-@@p@-P@PX < `L < PL< @L< 0L< LLu$Lq% L Lh&LPP020ĵ ^ 24 P 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0ppfw~wwwwwwww1wEw^w@-P5`LP@(LP@( Ѝa`ce0P 0S0U0S hp(LV(Pzw@-@m0P 0S @/%@-@`0P 0S @/%A-PR@P* 0S' Up$0S @ `V `03/@P 0S VPPU P 0A,%@@-@&p p p00rp  @$0 0 c @-@PL`PL pppr0 p``  PL  @LP  ЍLwwwww0S /A-0`SR%P PRp@0 S00PP  p"S0CP0SqPVP ~00C P w000wp@-P@# p@@-@@@-0P 0S@-0P  0Sp@-@P0P  ,L$0Pp@  RpwWw@-Pp@-P`@0U00C00 P pp@-P@ p@d@-@@Vp@-`@0S%P ,0S$@ 00SP (@@T@ PP  倐pwp@-P0S @ 0R$0S,0p%ppp@-MP@P& 0` `00|LPP0 1\L `PV 0V,0 0$00000(0 Ѝpw4w;w R@-)/fw@-@@P,, 808 0<0dwwtewp@-P8`@8@D80S@p=P 8@tewRA-ЍppP-PXbX偽@PR8@D80S0! 0 ؏8@8@DW @PW  `PǏ0V:X P O崏屏`PW  PP H3 <噏0҉`PW p s徉PW (0Sw} 寉P( 0003/ 変Pxb$0S 3/(00St 3/qKӅwteww3wwmwwww ww`ww3wGwDwHw]wcwjw@-@0P<<; 0  H   @kdww Zw@-@0P<<" 0 @    @ |dwwZw0s@-P`@0P 02P  Ѝp0S S S  dhT(\Tt  @ r RO@dwww@-0`P@00P  0P  忎PЍp0  PP R R R lp媎P0 4P8800 0~Z 0R?s00dwwwp@-0 02P >*P 0 N0P 0 0_ 0 X 0 8P  T+ Ѝ@$Owgww/5A-ReMM"WP?P:p@  0T T T0h0 `3 0`0㇧eލЍp@-@P p@@-p` Pa@P  Ѝ # p R@T iT0  S8@DS0 C 0@-@'-MW0?0 h0Č#0  q 0 @06PЍp@-0`@d0P4 8,BP p AP0(0pp@-@aPO`U p@30@-MhP 00 00ČW@q?@0 0@P00Ѝ07@-P;@E 0 1P:m Ѝ0s@-@`PP mЍp#E%|PF @-@ ,@A-P`@pP F^#%E XAE-@P@` q0 0S'(P: QS  4u`0V00 0 0 0 0 0 Ѝ`\0!㳂p0 Q0S (݂᥂ P:@BA-`@P0p (00`P ,P㻂0` dVm`ЍdV  `P Pz㡂0` dVdV (0S@弴b` Pb080S <!= !  0PU 8PO*lPI lPC P= ," P5 P/ }P) P$$"rP GlP!, eP$ P ,YP P `q ( I`P$0 :$09=  P0    <  hfP h) `P$  $  $  $ p wWPgP ҁ2p3WX X W ZWw0wwwp@-Pr@LP @p0 00 $Lp0 00pww00@-  P@TN P@TF P@T> P@T6: @T0  @T*@ @T$0 SP  0 0^0  0P   0P  0@o000A-P@,@D,0SD0,@p4<`<`F<0S D0:<0<`C0 0<0(0S /%/0?o 20/цw@-0 <@T% @0 4/ЍM-0y `< 0@ 0[% 0P0 0@;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-}@PQp0P0,PE, 0R }Fg0 00 Ѝ40P0T0S` `TP@,P0P0V0S@ \w@-@T }P@M-p`'MM@?@pP%-0P0 ,i000$YpP  嗥PTG?$ 0 <0 $P&09LH00000PG0 졟 !Jq WQ0!"0 0傄 B P *  0P$ U]$ Dpp \P 0@0000 =P 0 0 0W0C0 'ݍЍ U <0Pp 0P$ 0R 1P Rp  0P0P 0 P0$0h$0 0pwԑwԑww,ww7@-@_PL- 03P0Q Ѝ0@ Ѝ0@@ww`wuw@- 1 } @P&,Pp0`,`F ,0S@,@D,0 S>0S@Q @P U8410S@ ЍpoP,`,`FP} 0bP00 0P q q 弃D0 0S|,@D0 0S p,@,@D,0 Sцww\wwwwwwp@-P@`Q,Y0 00p@9%-dO,Yp@-0000SY/\wQ / h0_00_h0/00_0S/00/P ~A-`pP@_~t @T PU@--!R @00_  0_00p@%꠆0w@-@JT00-1@A- PpU0 0E2`@@M0# al w''l  0?`0 0P?MP諪0@-0000CS @ 0 ;((50 00Ѝp@-@?`?PL P0@J @D^ * 0RPC専ppQw@-0_0_ 0 0Lp圂m蠆zw@-0_0_)0(08p刂m}蠆wp@-0`_0P_p@00_ 0 0P` tp@0 1 _ _00 V1P_*0P}=Pp꠆w@-F@pM- M, Pp  1P004@ Ѝ U``'?S`V@P `0 @0ҴPN 0 `0C03@0ĴP>  M M301l0'320 03<@00S.@0??K0??K0K$1SqP 0 000KK:P$10$1 '%#`@V 0` #   0姠 \Lo   W0  AQ00# 0 p   0  P 0`0# 0vP dw w@ M-`P@P$10C$1|}0@ p0W 000FK$1S @r|Z *,7@呰台፰GwA-P@0p  0`P $OR|T3?@P@G|T*, m@W, PЍtw0, M-M 0, ?0`S000 1o0媢 0 0 0S0Sᜒ 10S03@0剳PPXπQ`  wL sL3 010l0w,07 0@0000$00S@  @@够4X$8t0|,!0=1R(9  R B/o "601@0  1@S@/,0'320 A 0p7400<,0S *b 0pp R ,4<  802P80<  ]ḯ3  @@0Pl 0pSP @8000(p0 ّ 00 0# 0J80Z@0@ 1S  3# " @ 00@00p#J0 (0J00 0J00_?0_ 000_   0_ 0)<2p0 1{(?S㈃CD,C J (J J0倠0 ,{P:$0@@0I00_@0_ 0 7zph00_  _ 0 X`0 R00S 0??IZ jPJ!0@S0 S S0 S @"0 0 PS0 l   l TH90C0 ݮ0 P܍wwww w)w!Ϡ\ 0f/M-@, p04`$?S T4S:S0, 0 0@4/r P S P 0_ R 0*0D  1;1KD~_*0 0 $R R R R.   0R R 1;10 000_ 0:0 0 0 0`ЍMew3wRcwKwM-$P@p`2,VW00P0S@0U0  I2012412812<10001S20141S24181S281<1S Xp`DAP0_00_ 0 82ipu @1Sx00_x@`` \I0@0 :pD0@0PPpTpX0G_0` `$GIpppG 1SCP T 0P !P0 S G !_0 0_$1    $  "$   $  "$ 00_00_ 0 00@0_0_ @000_x0_lQ(!F}x\C}Pᝬs3/PP _ 0 P܂w܂wP݂w݂wewuwaw@-T0S P xp@-P@L@0hH 3fPPp4OwP00 HwP pwwԅw 1P   8<< <<88@ 448/ @8<<88@0@0  0 08l08` 11 11@008408( 11 11@008ZwSA-p`@P`LM"M'M0MxAH01aa/"P P V`P |)Ѝl_10121101~w100x 00k`wwEwM-`Q5 p0S1 v P0S( 0 @D T#@ 0R vP0=S P@D R !)HT: H<|Ѝ@w@-@<|@2@-@M |(Ѝ w$0P  Gw@-0(M@ 0T 0  00 (0kP(Ѝ |P|ew7@-P@P T|0S Ѝ0@-@W0  0 0 0 0 00@-MP@P {ɌЍ0 wp@-P@P{p wp@-P@P  p@{p@-P 0YPTP1S@-@o/w 0@-| P|Gw@-@P p{0K%`` 000@@mPD0DЍ@o{   ) Ѝ9wGwewӆww@-0+  %0 mЍGwewp@-QPM`  +G/C0P x)Ѝp@P0/P @@@lPP 000$0$${gwewӆwoww@-@M`P T@@p0`-lP404{Ѝ Cewӆww$QigwM- MD`[@p 0$SV0{S` SP`P[00@P 01 zjPP 02u00CS   0diU(01 Ѝ 00S0[p@0  t pH0 F [0H 00Ht00p0 [,00 @0@ew wwwwwQ/@- P 0000C,0PRꬉwĉwwp@-`P@P_@,P(0 2 8Wz03/@P$Qz,`pu*tP`wpw@-,@P `>z 0ST ( !<3z@3/@P *z'zw wwwpwA-p@`PP W@ th @  $ 0S 3/@P(01(0t(01(0$0pS@GwM-Mp`@Vt 00M  y #K}sP4 (010 P pMAt 0 #KsP .V 4t⻩P s!)tⰩPP sРKP Р  ywwM-PPP p,s`P$tP+ Ⅹ@P Ps:sPP mPmsP  7/PP ԨV b@P s @ŨVPPRP0@-00@M PH 0@P 0S@ Zs 姨奨Ѝ0wP@- 0\ X\@@0P D SRew0 /@-@,,k $$r neww0w7wp@-@tsP ,PcsP @p ypOwwp@-@`sP ,POsP @p xpOwwp@-P@0pP>w00@-| ,M  0 00 (0@h0S T 0 ,Ѝ0(sP P ew7@-@P0 l0S  S 0R XR U  :RPU@ Ѝ0RA-P㌀@0`S|pPP poPPT P Ѝ PrP  ewцww7wM-`R0d2Q@@VPp% <"0HS0 0 00S ,0  0 R# S00S00XS 0V@ VF V[ 01SyS tSXS0S F0Cs0S! D1 08xЍY0C$!s023 00  0S Z  .RZR8P 0 w 0  t@ IP@@@  Lw rP 0$ @wOwOww ?w\w|ww0/A-pPD D00C`Q,@UqP`LwwLw@-@,,ej $$ ew wX ww0@- (M  0 0 00 (0@Tg0S T 0 (ЍqP P  0ew@-pAMP@, C0`S E0000P XP Aߍ P qP P00ewцwww@-@w H{@P ŤwA-@M`PP' b0 v Pp P TqPpp 0@ ?@ 0D0 LY/rp00vЍR 0wwww w/@-@PL ╸P8 ,0  PЍ1wCwцwSwM-MMPR`P v@ݍЍGp?p@P$ ~@P vPM| j?  2PE P`  ,0 ;V !@0Lsw@wowR&wцwM-MMp`PP, FP.Pt j?  PE Pp  G@?@0 W+PP 0@ @40U ݍЍ`Pцww///// /$0 P D PD//ew///M-fM 1pa弱3/@P0 W P\ 0    V000S `h ljk +lX u@fߍw///0/цw0A-P0 02pP`|@pU 0SSP0S 0<3/P40 ,0pЍ`VD@x҆wцwewцwt҆wA-`QPt 共P@dpP`P 0P3/P @D0 <0`r@TDP@цwx҆wewцwt҆w@-@Y$03/00цw@-$0N03/@цw@-$0A03/@цw@-$0@403/@цwA-PD0@%b00`0 0`6/@ЍцwM-@p0P04p8``p0 ;/@P SR /u@Ѝцww7@-l0P@,0@3/PU 40PeP Ѝ0$0 0 000цwӆwx҆wt҆w@-@H<0003/@gT0@d@Ѝцwӆw@-@P00403/@Pцw@-PP`p 0` Ѝ0Sdt`@P <t S(tp tӆwwww w@-$0z803/@цw@-$0m<03/@ цwp@-@0P`@0`3/@P t@pцw/wR7@-@ P@P @ Ѝ0  P?{swM-P0BS8M@8ЍRpX s@P DWt@WE $t$0 `R 0SW@ WE tW>t  jo1000  0P   ( 8/00Lo0S (t Prd ht`P 咡 W  W ż (000d"sX z,0(4000t0?04` !fXhTfL(Dc0gUwцww-wwmw@wwwۅwww0020@j00 0@-PM `=5c@PЍ0.SpE @TTc7TcP "wA-pP`A@.TT T <cP a0DS@@PU_@rcwM-@p`0P RU10\R/R   \Q/Q  QP 0]c@X T@0@@00P S@ .S0S .S0S @c @UP0 S .S @⣅wM-0PS`G S SASzpAH0!zp@0S  0 S C0p  Pp000S$ S S !P0v`) P5 P :00V` ``Az@p@H0a0@`S00 060 0Vb000s00 040 0Vd00000 020A-P@T 0 S2 S0>T*`PA b@p@-P`@P@ RpM-XMQ Q4 !@P`800400800 0 00U Uj 0 Sn Sq?U?S_0 S0 1 1TU0 o P4S8H0L %* P P[* I0 S" S/  R [+ S2 S?> S# H0 P0L  P P [*0SH0 0 L /@ o@H L  Q  !* 0  RP0 R RQU R" R/.R @ 4H LP8p3`1:4pP8` P,  0 , X0  ,5, 05 R 0    ! 嶡R     ##00?(00p `x' 0ĦS(0 `0S 00 `D1P x2 O1P0pS 0`0N x00000W(0010PpT`txP?P0$0T0<0 0(0$   <0咣*$0"$0  $0<Ã>#/R PK0pW0 ` 00` Le 1P: 2 1P/x0 H0x0 00 L` 000,0 00H`0L`P 00;* R2 R?0UO*0@0HP0NDfXЍPZD04 e24 !D00P pW( `   $ Z<   P R2 R?0Su 0 S_ SRS_ ~e00S0 00 00 wL`H[-`P `HFZ0 S &810aV1pps'0P0 0T00& xPP0Q0pd20W 0P f  R2 R?0Sr ` ,PP Z0ï p S  :0!x PQ00 0  0 0 S_ SRS_ |0 @RP0) x !P0)     R x p0U px00 S2 S 0>S p`0 P R" R .R 0p2U2#*U?#:҆w"w҆w"wH-0?0?0@0M`?@x ?@O1 P 0P0K H6`PP 460`P  R*`P tӆw҆w#wmwqwA-0S ` pQ 0Q@%  Q"  0BUP!m JP0100 S 0 S  1 S:00P 00 S2 S?>P@-0@SP 020C00SЍ0C0 M-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D #0 s0Qs0/o"X R,0<1K 00410p  0 G0 .0`0 o0 0 x00p0` ,1S,! S0,1<1S< ` 0P `VQ ` VQ  Q ` ` [o _  .0H@Pd M-@PK0`SpP \S/S ^PP0S /S\S0S  ERc^P0$  $0000000SR E P <h^Zp1 p! <]P <1 S  ]P0 0 0Sv@wwp@-@PKoP <]P0Spp<1S ]P M-p MB 30s0Qs` @P Z/0D Q0  S 0@S` Q0   C0R02 0*` R R 0 S 0 `00?o2 PuPS P @00U$` 0 C0R0 0  +/0PES @DuP ?0S ݍP 7@-P P@P=0020C0 Ѝ0M-@Q0M@0Ѝ` p ..]0P.S P   0 S_0 S000 4P b +]P@  \P7J]@$A . X*_o^PE0%  b 5]P` U P .0 S  00\0 b P P X 0 b#wON$#wwM-M@h`PpY `Ѝ R RW 0  0pS 0 SF00 00py0S60PS 0 S/0!01 P  .P  R" R/ R/}p 0020C00S`P @-@pM0S 9|'b0t#bɜ 0`@P Lb@pЍ - & @+@ btӆw(#w;#wwK#wc#w0@-`P4M@㴔@P PP PLJo4Ѝ0@@-`p@4M◔PP @ jP @44Ѝ @P ) WP @P 0 00@M-PM@@pPa0P0 0 0T 2P0 0L X0P 0C0 $ PA @H Z3ᴃ0UP` U P?P@0Z%0U0PS0Z000 00c U  00?@?0P0 0 0 尐宐 PЍ  P@ XDa$ Q QT*0P  0P0 ,a ᇐ PU  S00 - y0 00 00 0P@$0 S2 S?>T*0S 0 P0 0 0  0o @[0  P0 P$ R" R/.P* 0   PU 0 0DP@u$0 S2 S?>Tl*0@x#w#wA-P`@h\@P P P }M,b*PP QPP@ p@-@` PP# --,Z1   1d 1@ ! 000 0!`pp@-@嶏@賏/0@-lMP (@P000 00+`lЍ0#wM-@ZMP80 `ᐡ唱+Z0P 0 ( $(pZ@P hP `@w8usZߍ@ƒ@P  8P` 1$  P  _hP# 0 00vu  R0H 001 01080p 85P2 _ P`0., P PQp f+0 S011 0,  0+, P #w@҆w#w#w$w0@-M0B@OЍ0A-@hM0 4+ Z`@6VP@z_ P-  YpYP|YPlg_PPP0 D2  PP prP  K_P奎ᣎᡎhЍ0 04 80 *@pP  8华ዎXX!x'_%0@??ˑP8 0T0'P p0  RQXYp^P$0S (0 0  R _<PP P@@P PU:NPP@$w⣅w@w0$w҆w#wK$w$wM-@ZM8`0 m*YY0P0@P, $ $pY@P hK@P ^@P@VPP *P` 2 @  MP  ^@8ߍ Zߍh@P ph @v^0S( JP ,hXP hXP PZ@p )0 S01010  (*q!@??@P  pP  ) D* 8 *+ R 0< R303?0 0 0 p@p  ^~< 0 R#(#s0< 1 R! 81#(0! 0 0p@p HP D]{:W@#w@҆w#wn$wv@ww$w$w#w$wM-MPP]K??@ ML\ʂ\*Sj? A?0 $0   0 ZP 44]$0 $ BR 0( )( `p@DT 0 c  ?0?0@0M?? 0 2 i)Р20 %Zdh0a@ 0 `o  0P$  F)$w&dw$w$w$w/0@-M@=l0< 0000PP 5/@T Ѝ0 P P 0Shw T RT TA P 0 0 3/@PЍpA0 |hw@-P`0S 0<0 P@0 4/@>T RT T AЍp@0 PP hwp@-0 PF@P $0 <0T03/@phwA-p`PW `@P`WЍ0<0@ 04/@sT0 RS &P P\0 @ B‘0 @Phw%w/M-pP`U@# *0&S4<0Sf\ Ab\ЍP 0p0000 0N@P  p@P0S 3/@P P  ᘋ&ADPvwwLw0%w[%wuwwwP  P P: A3<@S <S 0P  W V036 V @ !@P@ n#(0 00"P0P `p0 00 Ѝ`ws@-@`Pt2T 2T 0 0000 vЍp !s@-`@PZ0 0000 bЍpA-RpP`匀@TAc0S 0S (, U0:80S S080 @0040 (0, ^\ UR ?0Z/\ P3 0 0 0@0P 0U000 0 ZS  R Y  UAQ 0 R R R0&A-P`p(,@(QU ?oT20S !/ЍT T TTT P :P! T 0TP PU 0 @U M-M tPP p Q l@P W`  @P 0SSЍ0S RV@ X@P` &QW`00 S/ Z 0S ' @000 00dPU:Z* 0VS 0 `6/Q&0 W Q UPQ `0t0 ;/ZQ Q@ QPAЍ BRQ @@0嬀00 P0P @P 0V 0 @@唀W 0R:AA-`@Pp QX!Q 0PPpQ 0R>QP 'wM-P@pr@P 4m`PS&Q00:00U0    PP  PPP <|PP@` (P(&Qhw =w=w@'wM-P00M0P` T0S 00 P 0S U@   `P[DpP:A0Ѝ$5@P!?$  "&*(0P&Al$0( 3/@ST ?$  0#03"&*($`W 03/AT( $ T ($0U@PpjT0 U@/0 0"&*jTTW10 p PG X T PD10 $ pP$0 pp @ 0 4/@T? ``0&fj (08P&A(0 0@ 0 4/@T  p 0  tT( ` Z<0 AVU T00T 0EK=whw=wwP/0S  04 R//P/0S0S/@-0S0SPS0SSS0S/S/P/0S @-P/P 0S @-0 4P/M-MpP `@ T, W P @ P  0R0 0P  0U 0 V: CPU ЍV Z*000gw  :ncwA-PQ00P@`P ps`P  !00SUpP/0S@o/0 4p@-P@|U 0S*G`P |U0  0 pncwp@-0PS*`-@P  pA-`p@@T:PЍPP  0`S 000T40@00k00S `0 , xP?/P\ncw@-@P ۍ70000000 0 ncw@- N Nr@P N sncwM-p`P $@P. 00000000W40W80V4 0V8 0U4 0U80Z40Z80X40X8*,p`'|&l P0%\(< ( p `P07ncw0A-00p`@PP@&|@PP@0SX,P 000000@A-P0M` 00R0V0S Ѝp@R@P60   ~UT">@P 9@P[p2@P:000 P P P&(w(wwߍVU 0DSx(0P   012/Q1 RA325: /P @.B x@ 7@P  BXhw#wA P 0K@pp@-P`P@TA$ pp@-P@  0000 00000000p@-@`@:q@-@M-0MT0pR0X000P`2&0  $ $P\UXPP h<Pj s@P 0AЍPIp@P&A @]:P pp@PA  0RPA;wRQ00P0S,p@-P0@SM X0> 0PS @`P Ѝp0000$h.P H0L0 H0 L /p@-@P<T Q  PPP P?pp@-@P`& @2p@-@T A X0@>A%A-pPM@` UW00V0Sq00S0T0Sj :P,hp/:Pp0) S5S: PP?  !PP0P@S0 00@K@Ѝ :P"@0Q {P0)S*0!*  * 0 0 0 !!2{A <:PA0Sā00A A;w;w>wRQ@-00P0S $(`,P00C 0@ \^600 ` P@P:Ѝp @-M8P@`p]U A  @PP @\Ѝ@-P@`B @JЍp@-@P@`@@$p0p 7/p&WQ;o@P&Q /0$p, 7/PU00n Ѝ;wQPM- q(M P0`SP@`R @NP`0ShP`dqAd[` P `8 00)ppV`1q3d5+:U-  d `p ! H L8\(80 SH00H0 PP P0H0L 0 H0L p`)R q pPH0 L Q$00@P000$hWPH0`L0H00 S L05*(Ѝp@-@PxT Q  dPPP P{pp@-@P`b Q@nps@-PP0@S` 0`0`0H`LPЍpur jP`Pp@-@`P7 0@CpM-M@PP :03/P"U Ѝ0S0S y@T`pT 0S0S -> 03/P0TUPEnP   ` 03/PkmUD@ 03/00w*w@- 0@  %Ѝp@-@PpA-p` P@UoP (0 0p0`P&w$ 0S/S0/phwp@-@PT8 0 p0S S00pphw@-@T :@-y:p@-P@r0S pPU/oP"Uw&pp@-P@_TUm pj:pA-p`@PPW. 0SUP'V/o"Q!:A #1 RI V  X S@A   AphwYwM-pX 0PSPWPU  QЍ``#@@D0 Sb``[Q0 0 0p@@DhhwM-Pp`U 00S0V0S W〠@ @D0 S: 7P 0 $0S* @hhwp@-@P`Pp 0 PP2lp@-@P`Pp 0 0 PP0 P PlA-P` p @T 0 `` lM-` 0@4 8 <000S@000 SS 0#0C S0 S  04 8@ AЍmPP  [0 P P 0PT 0X 0\PX(mPP\ mPD ,0- .406P ;  0pt 0x 0|pX0 P 0PZ 0S SPPP0S S 0 0  !R 0op&A lk[hkfk A&AK &AkPP PP 0 40 X$0 $Pu $( kpP  9k&AW   80 pp 0 呲+fwhhwp@-`P&6 @5PP;PppA-@`PpT P:W R U RP ~  PPUsM-`Pp YV Pd: 0UWX@Y   E`F!pX`P 0QEj0aC@ T  P 0U0UalpP,&M-`p@$V eP:TW00X0SP  0 F!`P 0AD`P U  HP @@ @0t`S@*lP&A-@`pT PP : @PU  P 0S:0aFQU 0@S*M-`PpV P:W @@T@U@T  5@@Z0T@;p` @Up 4 4`@XPPuA-Pp@T` 0 pp0Si iii`@-@ 0 000@i@-@3T P>:9A-P`p VU, Q(/jx0P 00 00000 0@ 0$0&QwPPp@ phwA-`@V CP:AT A0PpT0X0\PUL@0 SS 0C S0 S  04 8TZw Q@- @0  Q 0# 0AS 09*wA-@ᬀPU`0VP  4Ppt9(  Bd 9T T:(00T*8D9Q $9 9`gw=w*w*w*w*ww?QM:\ <0 Q:P5PR/ /M-@ M `PPL# Hk9 ЍQ 0S 0  R 2QA00 0t5 2000 80@P B9& P( BV`1(0 0(0000! 0N/ X00T00E??0 @,00(`00Sj 1Q40 0/5 2000 80@P (0 0(0000|X PR R 0H(pG@P SP PRp"&P Rp ,( @    p p p8/0 0"&*>>(!00p   GR= 8.Cw*wA+wW(w*wOw+w*w7@-@P  P 00A Ѝ0=w0S / A-P0 @4 `8 <000C0 04000C0@A 0pW 0R: B 崀R:@ @uP0@0C0@0 SP P0*///p@-`0S:p$ P Ơ@.ʌ P 3#P@3 "\ @oP:p0xhwM- M@@0D0T  00 0  8$p0`000liPP T$T %1"0@ p`p`$ 003@3T 0 QS``0` /gF T   0$  0&#*60000"6":& 0X#3P#\@\ \X` p`1p1X*: R11R 0: 0 000fX 0( 0 *60 0S #6:"& 0$ 0hP 0 0S aa#6:"& 0$ `V0 p&fj'v@0bif& Ѝ0P@0D!Pi@014T0 `$P pƠ 0&ʌpWR"p W(,p(, WZ $p P0S00  0S $P0 0 000gf@P0PLP@T P  01P9@ӆwxhw wwP : xhws@-P @1P :Ѝp0`  UP  088PS6 00 09P dwg+wM-_p0#03 f'vjz(p0KpW @@W0@3T Ѝ [0* EP@ >P@P @ 0{ @PU  P %VZ"6"&  00 W R &fs@-@R  Q /@00 #fPj 0 P%V 0,, PP%! "` @00Ѝpʑd}7@-@ P $5P Ѝ0P i+wA-@P  }P@DPQ <@d0dp,\^8`4P .,UV  885  0#D A%:ʑd}1dw+w@-P `P@ R( S ^00 T:Q(Lp @ W(@DU (p000xhwӆw@-````P0 pP@ (J@P @0 @P z` ЍM-`?NP@PU0 #0p4*   T 0+ #6   0W 0 *     ЍW0* T0"&*#6s@-4@`@_o 0<@ R 0@ 0DH  @0Ѝps@-O`HtP4  B B 0"&*0`<0< 0  B00`"&Ѝp<ww@-4M"f@P&0 `P0p `0pP00000`P(0|0|`$0x0 0p00h0h0d0,P0\00X0 0T00P00L00H00p4Ѝ$>wp=ww 0B Ѝ=w/M-`@pEP'T  V R QЍ1p1@1P0S'Rԁ`V'0pW.0S ` R`P8@ 8@ |1@DDPUOl!l1(0d1,0t0P 0S 03/` &,*  Ơ ^`PpD0\  # 3P 3 "R D`V#3\ 3 "Z`` 0R  0(w w$wwwwww,whw@-(PP P0hw@-dQM@TR@PMn@PJ8a@0!,,` @@P=p  @p 0P! 0!0!00p@P(B@P% @P"@P@P @P[@P@;-P@D-0 040`0v@P (%3@Ѝhw+ww 0S6A00S2A, ` R  B- <#0€"\ :4@A@A?ps0SS 0 kPfWAs0 ~o AA-PPpB ` 0S"A30S6A/0S2A+ Q A- <#0."\ :~4@A@A9?p6s0SS 0 kPWAyr0 6o A@-@ P 0P P P Ѝ;w@- @P Ѝ  =@T  P0=wE-@$MrP $Ѝqr0&S" lr0 SP=-000x0P S  ,-PlP5P4@<@D<0S r wPr;rp7r` zP0Sl0`0`0 :P`6P '<@-w)-w F12121313131 3131313131 31$33>(31Q -0pQ h!P0@P T) 0DQT 0,!40@P 0@P Ѝ@$Y@!Y0SY80&AY)0@YTӆwӆwӆwӆw=w w>w?w4>w\:wH:w4:wt9w`9w:w=wD;w7w7w?w8w 8w8w8w$8w,8w48w?w<8wӆwӆw8ws-wӆw-w-wP(w 0@-  0@P @Pv)Ѝ  -w@-@TDh):Ѝ0*00pP Ѝ@j-wLwE-`OopP(#1BV@W@T @ Q`V % 03/  Ѝ0S0SZ`Q0>@P `Pp!):QPPX0 R*Q00 3/P00=w=w.w07@-PP A @Pl(:A; T T:D0D 0@@0@@x Ѝ0 03/@=w.w=wPOw Z 00 00000Ѝ0S 01 U+0V00S $> ,20 P0`W  pGeP0 0S 0 0 p&+1Q =0000S =&b$ 00Rl=5PE2:  30 0 0 P4 0W 0pGePUv0S` = 0SV$ 0   ,bP0`0U 0S`0   ,,`P0`0U 0S v  0&$ 0   ,bmP0`00; U 0@`S`0 P`000 ' @0W1!Z R P  A R R 0 B0 ! 0  5@0 pG 0C @0S+0@0000;g W" K00 0S P 0@ R02@0505070S W0  0 pGS E 0 0 0p0(08`Sl0L00T0/>0T00 l0p0P050h000`d00h0 8 P6cPE0 h0h R/*TL 0SWq 0pGePP PyPj6c0EaPCWWY pGePPR6cPEE30000S8 S>l0L0 0T0l00/T00pl0` ~0P0t3fl0`P00X0X00l0d l0P043U001 WR7T0L0S AW 0pGeP0&aPEP700P}  h W pGePW pGePP6c0E cPC0 0 0p08`T<:1P9Q7 2/PQ3\.  2/R3#RT\# 2/PQ3P 03? 030#Q030"S\ $<Ͽ 3#Q3 "/  03?0#3@-@(>T>^($ 2/Q/0A-0 P`P 0p 700G@S0 p @P 0S DP @@@ P  02/3? R@S@;Yw@-0Q Ѝ P@-0Q Ѝ P0s@-Q`P0P@@ P P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍA-@Pp`PEPT@ P @p@-`R @PPp 2/V:\pp03?*03?0CQ//7@-P@ P P@T @ Ѝ0P @p@-@`PPPUp0U3?`03?0pp@-@P`N0P. 1S C0S U03?S 03?U0C0 :0tSU0e 0SR !@)P V@p 0V@00 / A-`pP@ P}P 0 3?2/ 0 3?2/ @- @g0P  0  A-`@Pp0P0P07@3?@S@/TP @U 1 0U@0A-`Pp@P0@0#ЍS `P 0U P 0S  @P0@S  @0 ZS@p@-P`@ 0p@@-@[P@@-@bP@M-(`p,P@XP@ PP  1P 0W  )P[@Ѝ @@->^\ 00 ЍP@-Pp`@ 0p Ѝ@- @P 03?S 0 0 03?S ЍA- pP`@P X  1PV00Ѝ03?S P 03?S @-Pp`@D 0p Ѝ7@-\ 0@PP 0S 0 0P 0S0 Ѝ0i1wc1ws@-P0@`BP0 Ѝp萇wA-p@PP.0`/SP  /P HPP @PT:T 0@/S / F~P@@ 0DPPp@-P@ p@A-pP@`^PT Ѝ0SQV0S C0Q?0Sqq @- 0P Ѝp@-@P Ppp@0 B0Asp@-@`P@P p=P P@E-p0 @P` g` T`#*JP U P @` P Ѝ`0@-@000ZЍ P p ,0`$0P////>w1wq1w1w03?'S<Ͽ Q 0 3?R  12/P//p@-@PpP5?S $ 2/PU40p p pp@-` <Ͽ1@R  QVP!P3U C R :0R L B7pppp@-`@"2PPp0@D3?23?0 03?23? 0pp@-P`@Pp$ 0D2/ 2/$ 2/03? 0pA-@P1(p(` 30 16o7p$`  12/8 0 0M-(@pP A `u6o `P 1P PPB`0  P15_0k P& 02/ 2/  `U 010  0 P V  = 0 3?0C0C3? 0Ѝ05_07P0pM-Pآp@P` 6ob0I@P78:;p ЍA-Pp`@P P6o0A (@A-P`p@P  0JX p P0( 00 0 0 P4O@ Ѝ00 0@@- `P 0000V0P0S@   -Ѝps@-@P`P 0Q   0 ЍpM-@PP10 ]P)p'   @PPp5_P`p 0P40@  4 `0Ѝp@-P`@R 0p@p@-@P<PpPp @<Ͽ  p@0M-`Pp@P(03?S$@ 4O@ 00 T P@T P  @P40073?$0pЍ 0(3?Z 08V0#03X0S 0 S@0 B H(070402p00@0 @-0P0 S 003?S 0 Ѝ@- P p 2w@- pPw@-@0dP 0S@4OЍ@-@P 0$08`P2wt 0/@?w0@-$ AP _ o<Ņw3wM-PM@pz  $P@`#0  0`R/X  RR 6 Pl # `Pp Ѝ_ꐇwA-Pp9 ]I`@TЍ0 0/S000SS   PV`0@ꐇwp@-@PpP0 0p@rw7@-@0PP 0S R Ѝ013?1 @-0P ЍM- 08`@PPЍ0Z0P p0ppT:40S8X% 04 U0S  0PPZ 0 p 1W:40UX VP0P#T 03?0AP@-@0?P 0TЍ  Br/03E-pB00`%P  0!0q1P:40S  V@  Ѝ@A-@`pPPЍP00 0,0 P(0@-MP@`pP,0 0(00p0Ѝ@-0\ 0ЍM-0p@sP(?PF ` 0P  01PR @_@@@Ѝ /D @-@h tpP ht h#P@hGwvwRQ/M-@` A, @@R H P 03/P0 [EPET  W DR@ЍPꫪ[ 0V  Pp@-@  P @PJ op PpPi 0  p5wM-`pPM U@ @Pdߍ[   !0PP!0P @wA-`pP@TQ  0P`1@p@-`@P @ @ 0 00 000p-P 0 /p@-PQ 0S@ 0p 0p@`x"TQ `Q 00@AP 0 pӆwA-@PPp  H0 `0S??P U?00ӆwM-@`P p@0S \0 0 0  0S   P0 000@ӆwM-(M( P@ 0[2"Q`!`3p0P U H0X0C?o20u0< V PA!p0 0 0W0 00CppGV 0 0 0sGUP s ' P0S2 PU  T05/P 0"0L0(ЍPT00 0  #P 000?PW P000S 00L 000V6  P10S& 0S  T00 00 00 00S 0L 00w00 0SiH0S0 0R UPp0 `` `` `0S 0S 000ܗⰖ `V T06/P  }XpT00 0 PL0K  fVӆwE-,M00 (0@Pp`P @0 ,Ѝ Z 0 :/P  \0@ 0p 0 G@P  0@  )ӆwM- MPS,  P!  MP@$0 X 0pS00`00 ,0( 0 P 80 0S* 2(\ 0T A T@* 0!0K0 0S#040  0,00 80S 00.S 040 (0 ! 0ZP@ P04P 0 `\S SPP0S0@$0`V  =\(0CQ 00?$0P`0  Bp0W    Bp`W`pC\W W0``,w6wӆwM-8M <0 a00M0pP@0  3 @>PP |3 (  0X0  @0080 00S @ P #jP[=0S TQ=K0S@`0D0 0 S S> #S>@0< SSD0T*0S03=80S@0@C80SP  P 80080 QS* \  C0ZQ@DD0 @`0< =SSSQ @S <PS   P R =S @0X0 f@@ P  @<0SS0S  0 d\SP0 0 X0,` ( 000K00p00K00Sl ,G g@ xPa ӆwy6w6wH6wA-P`@p0S* 0S@6/P @-P`x0x Pp0h00` WU@E0D @0ES@EE  ЍZw@w,wuw6w0 -M   Ѝ䈼wM- 0< b3 pB>>3  @T  ЍM RP52> ` !B!b6; 00P 0UP5RX0W U ;A?o \20 S PE 40 0@S P, U   Zw7w6w6w7wM-PMp@p@SPt`@@T@x 0R0305 : Y Tp1` pZ 0@DD$V%0. S  P00H C < PЍU0 1 U00s0s00 0T )  `0@  0 *weww7wM- MP@@Sp`@PUP001(0 ! 0(  1CР0$0 $0 0P0n, $9 9,0@Dp:P  K TA-P`Qp@udf0@P0T  T # 2RW :pW`0?@ OP@-J9"7wp@-`?P?@a>@P    Rp0 0 /ew@-@0P 0C40S *000C ew 0#  BR / 0A-@P0` p Mpe 0 @S Ѝ 0000S  0N PL7wk7wM-[00 0`pJP 0@@DUW@@@@SЍZ.S3 0 #@ 0K S0@00 0 .3#0`PV6P `p 0Z0& 0U# C`G UZ&W0C 0  @@TS 0 # @0QU@@ \ ` 0 ,0` `ZT0[ 03K2 #0*\ 0C^ L 03#0 0S 0w7w@-0 B ^@ 0 L QT^@-@ )@%7wwօw/0E0M-p @ PȀ`A\ X( ^T @U@@D3#VZ p^ <.00C0T<. <# PEP DM0 0A-@P A`q\ \```L Q\0B C   A@ \PwM- pP`0F&  k S( R:Z  B@k X * # R@e @e @ T T 3R0C `F  08P 0 0 p@Ѝ p @U@Dp@-P`@P  p7w0p@-P`0P S# 0 F0 0CRP@@p ap p@- PP@ Q 00CS%0 00SCp 0Sp/@-`@~T 0 00*PP@Xp(@07U: Ѝ(0S ?o 2 1&P(@0p@-00000`@ @RP <H R Dp@p@-P0000@00p@@-p`W @ VP:NNUQRUå WQ Rp`LL\ 1!R  A- @ ^5PB\p*XR00` V` V ^ `V ࠑ000 S    /2S0 "2/8w2S0 "2/"8w0 tP/mPSP dP 0P//D n0@S 0 / / / / / /DYwp@-P`@" Bh202pM-p@0`4PQ* t#0AS0 0 0 0@0PP 0 0 00 0@P00@U0P JRPЍ0 6P000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00@ 0 @PP 0 `0 S   0 S h 00@o0 S 8 0 S R0000 Q^  Rz0000 Q^n P_oR@^P PE_oR[ 0 001@,[ 0 0!00C0 YwewA8wM-P`0@p0 00 PЍ00 P M-P`p0@0 00  P 00 P Ѝp@-P2 E0CS 0@20pY8wA-P@Q`p0S 0C0Pl0hfRPE `20CS 0@20Y8wM-@P`p200 .R#R R: 0b0QE$B Q \RU ?R [R b^R00@^R |RW M002p0CS2 20000Ѝ b \Q ]Q   A0C0 RD12b @ {b h0 0)S 02 W0!0St0*R  ?Q00 K 8PV0 KSwY8wp8w8w8w8w7@-P RRRRR0^0C?o2 2x@u00S0Shfeo Ѝ0E-p M\@` P   0 000 Ѝ0  PPU00\0SR @-h0@@ P R P  p "r RQ @B/ew  @0S0/@ Q/0S0/ 0\ 0C R /R/- 0^A \S  0 S00\0S / P0/-P^\S0q R0/R/0 0QB/A-@`pTP P@1@D" e00p@-P@t@0 SRpUp R0  \C/p@-@P M5PP@pd0 R/^^ R A-p@-PU @0P  0pP@-@0S R sb0A S/ P/0A-@pw`P sPU@H@ PPE qP/0\/ R/0 0@s@-/0<# 0r Ѝ @- R  @-@@@-?!!@-@@  @0LT3#," !4ׂCp@-`@P@P 0P:pp@-@`TP1P!@Tp耖P/0 -ddQ S0#$R0#R>2 -0A?o2 0D00ew!/M-P@`P6 V p2 00   '   01   Ѝ  x  pM- MP @ x pd0 ``TpPp-0 :5P@@U Ѝ+cw;cw#wDw 06#8##/dww0/dww @-1y10 @-^1-@-@-8w 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p P@` Q`*M`` !bRR&8`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M`倠V Z `pP@ / S& r0Q-p@D) Z^ ZJ @ `r 2 + 3,30+p@Dp p@DQ Z@D@D 0000Q0@D4 W Up5P R U0 3 5 ZPX PX  E R  0 PZ/@D@DP 0 8 @R5 PZ/@D@DP R5 R5 @QC 00S ZQ 0  RZT`ЍR 7 B5S50MwA-R `(@ ,0P 0pS 3 5W T'ЍV… 0C  S U00E@0  e0P0?S0%*0S 3 5pP 50@D00bwRA-``Pp@0 0 CPPP  LPTDS50 APP @ 0D@D@P@0 S 40 C5R5 8wM-0!0!P#XM`0%0S  R V050X030H50Ft%S V05p@#-S 0S7 0 C R p "00C \.0.SP40P0 C R &*S)P%@P0+S S #S *SppWpg@@@@@@7#0pC:#0CP00C Pʯ0zSgSLSP xRbR"%R XR V%03050pS- X0ƅp<ZS 0h Cr 1" lS lQL0P Pc BR   0 S50 BRW0Gpgpp0`V0405 0` FRWpGpp`PCS50lS 0@p 0 00US ISg MS= DS wp @!@iS[ mS1 aS p a@000 @R0@up ᰽P 0 @hp 2 wv0 0PP@@T30#s0 0:00 ! SQ0S  @@0@0 {@@0@@4S 0K 0, $0, @$0KQ*  S00.0lS BS  LS  [ 0xsS P0@ 0 pXЍ Fp+V 5 @ ERP@@ lS ZS hS LS 0  PEtS  ?00  @0 0p p 7bwewKYw8w@-@(P8TD -@- 00 ЍЍ/0 -@-   Ѝ Ѝ/@-M 0@P -ߍ-@- ЍЍ/0A-@p0S  00 S`P  N0P\P L@;/ 00009wwwlچwhچwdچw8ۆw`چw 0P/lچwA-Pc9}5S @R  @ 6 2 A( A$  @S 23/0B80B40 @\WP D局P]0000@40@^000p000pp<`P7 P1 a000p0 @+P㬀p<00` 7   0           0B?P0@儅w9wۄw9w9wM-@`q堁VQQPCQ2QQTP@30ASN0 QI0 Q $  U 0  0 0?U@0 ? 0   0  tl0[` HP|MwMwwww9w9wچw :wچwxچwpچwtچwww:w s@-`@t \0R0PP0q0 lk0 l,Ѝp@cЍpcScpچwM-M8XPPCSPDQPU0@S0S0S 0  0<$30#SЍ PZ 0 *2 R0 R 5R@0SP 0S   |2| p20 l@P P20S+<|40S (  002; ЍMR 0 0ЍM( PP 0S apW W WA\*T[@%x8+D0@000 0`P!"#/$ R$% 4 P0 8     0 BPD0C P;ۆwۆwcScwwwpچwwwwwۆw@:wl:ww|چw8ۆw|w$ZwMbtچw(0@- 0 00 ۆw ۆwۆwۆwM-@ @H~P`  22PQ@%+0!@0P`t! "#/$ R$% ( P , P 0 P  4 P08q 8 $0 Bo 04 8 p<3? 0= 0P05_ PRQ  000CQ 쀈 C D0d0dp0X0`>Ѝ|چw:wچw8ۆw ۆw:w$ZwۆwMbwwۆwۆwۆw|ww@-T0L00S@V'@4 4}P}>00@@Kۆwچw:wۆw|wE@-([APA Ѝp@-@>P0<003/ Bpp@-@ A PP $p0Spp@:w:w@-@PD00<00SHP>0 0 0 0 0 0 0<003/P&p@O@ J);w;w@-Ps>`d>000@ `LTHP@ LNHP:0<00SGq H= 0     ;  0 0 0 0 0  P     ~ Ѝ 0 0 0 0 0 0 3/Pxp 0 0 0 0 0  H$(꺇wwQ;w <00 @-TPp@-`HMP@P P0<000 P$   HЍp zP P p@,ۆw(ۆw;w;w0 0 0 0 /wLۆwHۆwDۆw 0 /w/ @-0/w @-0/w @-0/w @-0/w@-rP  ?w@-T@0S H0H ?00@ ; 000@lwwۆw8ۆwPۆwp@- y@PQ 0S m@0 pP P P 0000o!0@ R \0 d00S <0 P0P 'D0@0 <0< Lwxwwvww >wwww!>w?wwwwww=>wK>wm>ww,w|wwwwww>ww~>w>w>wwwۅw>ww@ww@-\ 000P SDDw@8 404,00S@www>w>w?www,wwE-s0S000?sP 7sP 2.sPR Q*:?0sPb Qt*00E RT!0@0D2DrDB0 0P( "<0R80R4r   G1!0S 1 R 00#  AhQ t! N@P  P1P bH ЍE^p8180W,1p 1 1 A 3E 1 0@00 @0p0@K,0 ЍE(wvww?w?wtww$?www0?wb?w|wwv?w?wwwww?wxw?w=w@w@wwwJ@wwi@wx@w@ww=>w>ww@w@wwwww,w8'wwwwwwwwxww Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-@-Cw0wXw`wPww wwwwlw ww8wAx(@A hwhwiwiwiwiwiw$iw+iw2iw9iwAiwIiwQiwYiwaiwiiwqiwxiwiwiwiwiwiwiwiwiwiwiwiwiwiwrwwwwwwjww*wwR1=C.)Dbwbwcww@w$ww#w6wFwPw\wfwwjwͼwjwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwjwjwjwjwjwjwjwjwjwjwjwjwͼwͼwͼwͼwͼwjwjwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwjwjwjwjwkw kwkwkwkw kw,kw8kwDkwTkwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwͼwdkwtkwkwkwkwkwkwkwkwoۅwׅwxۅwׅwۅw^wѸwnwѸwѸwѸwgw<  *w w  wW w < +w  +~wwwtwww ww\wXGwwDwHHwHwIwFw7w(", *$.)#-!+%/⣅ww>w;w;w{wzwPzwyw![NYd9ir;H݃w܃wރwރwރwdރw8ރw ރw݃w݃w5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +NYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIhw$w,wwpw$wwwHwwwwwwww'hUh=OtUR1hPEw2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b w!wd wwhwww8(Hw`Aw:w\wkwzwwwwwܵww|wbwwwCwJwOwVw]wgwrww}w~wwwwwwwmjwŅw Ņw Ņw Ņw Ņw ŅwwŅw?…w…w…w 5…w N…w h…w …w …w…wsÅwąw ąw ąw ąw ąw Ņw3Ņw…wCŅw[ŅwPÅwhŅwqŅw}ŅwŅwMąw ?Mąw ?Yąwrąw5Åw…w PÅw …w Åw Åw sÅwąwÅw!ąw=ąwÅw5ÅwDÅw PÅw …w ]Åw hÅw sÅwÅwÅwÅwÅwÅw …w …w …w Åw h…w…wÅw…w @ @`00P]`FC=݋#1--'?MRw.wUw,΅wSw.wQw.wtVwPw\Pw$$$0$$͂wȂw ȂwȂwHǂwɂw˂w;vwkw}wHww5ԅwNwOw'Lw&ww]wwfw퉅w5wBwHwwNwXwRw\waw fwkwpw{wwwwwwwwwwwŀwʀw ՅwӀw ڀww 怅wwww wwww%w*w8w@wHwNw܀w wZwVwawhwowuw@w@wywywyywywywywywywywywyw zwywzw@w@w퉅wewpwwzwwwwwwwwww}wwywwww w wwwLw(w@w@w )zw2zw[wDzw|w,wUzw]zwnzwvzw]wwzwzwzw zwzw zwzw&{w{w%%{w0{w퉅wF{wT{wZ{w k{wu{w{w{w{w{w3w{w{w{w#{w|w$|w/|w B|wK|w]|wf|w|w|w|w|w|w|w|w|w|w|w}w}w-}w9}wK}wU}wl}wx}w}w}w}w}w}w}w }w}w!~w~w"J~wU~w$t~w~~w'~w~w(~w~w)~w~w*w w+/w9w,LwRw@w@wwwwwDw #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %1i3!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>"7*@k.66Z66u66666y !1Aa  0@`@@A@!  @a`10  @&KPPPPf|. CGZjv8`{ !"# $$%(&*,'0(48)<@*H+P,X `-h p./ 0123 @4567@89:;<=>?   ^xR|*Btdi%*2) #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O DB     ttttt 6RitttZ_dtotq$)$$PU$$$$$$$$BootCurrentBootNextBootOrderPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL>5(u-boot*EHCI Host Controller  * +,;=[]__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtusb_setup_descriptordevm_kfreei2c_idle_busfec_alloc_descsphy_device_createpmic_alloc_ehci_create_int_queuefs_devreadefi_free_poolefi_runtime_relocatedevres_addfecmxc_recvpmic_dialog_initpmic_initpmic_reg_readefi_free_pagesdevres_freei2c_init_transferpmic_reg_writewait_for_sr_statei2c_imx_stopfdt_find_or_add_subnode(((((AAAAAABBBBBB    (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... CACHE: Misaligned operation at range [%08lx, %08lx] PORCSUIPP USERWDOGJTAG HIGH-ZJTAG SWWDOG3TEMPSENSEWARM BOOTunknown resetCPU: Freescale i.MX%s rev%d.%d at %d MHz Reset cause: %s 51536SL6DL6SX6Q6UL6ULL6SOLO6SLL6DP6QP6D6ULZ7S7D8MQ8MD8MQLite8MMQ8MMQL8MMD8MMDL8MMS8MMSL8MNano Quad8MNano Dual8MNano Solo8MNano QuadLite8MNano DualLite8MNano SoloLite8MNano UltraLite Quad8MNano UltraLite Dual8MNano UltraLite Solo8MP[8]8MP[6]8MP Lite[4]8MP Dual[3]8MP UltraLiteTargeted peripheral clock should bewithin [%d - %d] PLL1 %8d MHz PLL2 %8d MHz PLL3 %8d MHz PLL4 %8d MHz AHB %8d kHz IPG %8d kHz IPG PERCLK %8d kHz DDR %8d kHz Error:Can't find pll parameters: %d Warning:DDR clock should not exceed %d MHz Warning:Unsupported or invalid clock type display clocksDIALOG_PMICimx53-qsb.dtbfdt_fileWriting to BUCKCORE_REG failed: %d Writing to SUPPLY_REG failed: %d Writing to BUCKPRO_REG failed: %d FSL_PMICimx53-qsrb.dtbWriting to REG_SW_0 failed: %d Writing to REG_SW_1 failed: %d Writing to REG_POWER_CTL2 failed: %d Writing to REG_MODE_0 failed: %d Writing to SWBST_CTRL failed: %d CPU: Switch CPU clock to 1GHZ failed CPU: Switch DDR clock to 400MHz failed Board: MX53 LOCO Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) verify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize## Transferring control to RTEMS (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./bootmlocalcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkpxedhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-stdextlinux/extlinux.confbootmeth_extlinuxu-boot,extlinux%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efitftpPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootefi %lxbootefi %lx %lx/dtb/dtb/currentbootmeth_efiu-boot,distro-efi#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2024.01+dfsg-5+b2u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernetethaddreth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: fdt fixup event failed: %d - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order bootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 14.2.0-4) 14.2.0 GNU ld (GNU Binutils for Debian) 2.43.1 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s serial addr width shift clockbdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticuclass-necho args to console[-n] [args..] - echo args to console; -n suppresses newline## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structprotectenable or disable FLASH write protectionon start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writableeraseerase FLASH memorystart end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banksflinfoprint FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # NfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Unknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx crc32The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08lx: %08x %0lx %04x %02x ? Zero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wplisthwpartitionsetdsractiveeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu rootpathdnsipdomainautoloadNET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoltruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageprebootNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort => *?[\%u%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! modelModel: %s NULL device name! mdio_register: non unique device name '%s' %s: %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: %s not found %.*s%*s stdinstdoutstderrNo input devices available!No output devices available!No error devices available!In: Out: Err: pre-reloc realloc() is not supportedalloc space exhausted (unknown)CRC32 for %08lx ... %08lx ==> %08lx bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKRKMTDVirtIOBLKMAPUNKNOWN(%d) device %d -- Partition Type: %s Whole Disk** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS%s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdcompatible/clocks/firmwarerootroot_drivernoplist_empty(&dr->entry)!rcdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Index Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p fixed-linkbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kx%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cellsinputoutputunusedunknownfuncGPIO%d_gpio_mxcfsl,imx35-gpiou-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvclock-frequencyu-boot,i2c-offset-leni2c-chipi2c_generic%s: Arbitration lost sr=%x cr=%x state=%x %s: failed sr=%x cr=%x state=%x %s:trigger stop failed %s: failed to clear bus, sda=%d scl=%d %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx pinctrl-namesscl-gpiossda-gpios%s %s: i2c bus %d at 0x%2lx, fail to request scl/sda gpio udevice *)(NULLi2c_mxcfsl,imx21-i2cfsl,vf610-i2cError enabling VMMC supply : %d Unknown modeStatus Error: 0x%08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)bus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found eMMC%s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed fsl,tuning-stepfsl,tuning-start-tapfsl,strobe-dll-delay-targetfsl,signal-voltage-switch-extra-delay-msfsl,wp-controllercd-gpioswp-gpios%s %s: fail to enable vqmmc-supply Cannot write to locked SD card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! fsl,esdhc%s %s: Unable to get clk for %s MMC/SD: Reset never completed. FSL_SDHC%s %s: fsl_esdhc_init failure fsl_esdhcfsl,imx51-esdhcfsl,imx53-esdhcfsl,imx6ul-usdhcfsl,imx6sx-usdhcfsl,imx6sl-usdhcfsl,imx6q-usdhcfsl,imx7d-usdhcfsl,imx7ulp-usdhcfsl,imx8qm-usdhcfsl,imx8mm-usdhcfsl,imx8mn-usdhcfsl,imx8mp-usdhcfsl,imx8mq-usdhcfsl,imxrt-usdhcWrite MDIO failed... Read MDIO failed... phy-supplyphy-reset-gpiosphy-reset-durationFEC MXC: phy reset duration should be <= 1000ms phy-reset-post-delayFEC MXC: phy reset post delay should be <= 1000ms Payload (%d) too large Can't find FEC0 clk rate: %d WAIT for MII Gasket ready timed out Could not initialize PHY %s %s: error allocating packetp some error: 0x%08lx FECFEC%imdio_alloc failed mdio_register failed %s: error allocating rxbuf %d %s: Error enabling phy supply FEC MXC: Timeout resetting chip Unsupported interface type %d defaulting to MII100 fecmxcfsl,imx28-fecfsl,imx6q-fecfsl,imx6sl-fecfsl,imx6sx-fecfsl,imx6ul-fecfsl,imx53-fecfsl,imx7d-fecfsl,mvf600-fecfsl,imx93-fec(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700ERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseFixed PHYgpio-controllerpinconfigpinctrl-%d%s %s: could not find pctldev fsl,pins%s %s: No fsl,pins property in node %s %s %s: Invalid fsl,pins property in node %s %s %s: Error reading pin data. %s %s: Error mux_reg or conf_reg %s %s: wrong pinctrl info fsl,mux_maskfsl,input-sel%s %s: iomuxc fsl,input-sel property not found imx5-pinctrlfsl,imx53-iomuxcfsl,imx53-iomuxc-gprregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltregulator-nameenable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedstatesenable-gpiosgpio regulatorregulator-gpio = %d is invalid. Should be less than %d %s: No available memory for allocation! PMIC devices: name: %s bus: %s_%d PMIC: %s PMIC: Registers dump failed 0x%02x: PMIC: Register read failed 0x%02x: 0x%08x bat%s is not a battery statechargeBAT: %s charging (ctrl+c to break) I2CSPI|+|-|pmiclist - list available PMICs pmic name dump - dump named PMIC registers pmic name read - read register pmic name write - write register pmic name bat state - write register pmic name bat charge - write register %s: POWER allocation error! %s: Cannot find udev for a bus %d %s: invalid tx_num: %dstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted fsl,dte-modeserial_mxcfsl,imx21-uartfsl,imx53-uartfsl,imx6sx-uartfsl,imx6ul-uartfsl,imx7d-uartfsl,imx6q-uartRx: failed to receive: %d Waiting for Ethernet connection... done. unable to connect. asix_ethRX: failed to receive RX: got too many bytes (%d) setting autoneg failed failed to set multicast hash failed to set configuration mcs7830_ethError: SMSC95xx: No MAC address set - set usbethaddr smsc95xx_ethusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No working controllers found usb_dev_genericu-boot,bootdev-usbEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x dr_modeperipheralvbus-supplyError enabling VBUS supply ehci_mx5fsl,imx53-usbenv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksMMC partition switch failed u-boot,mmc-env-partitionu-boot,mmc-env-offsetInvalid ENV offset in MMC, copy=%d No MMC card foundNo block deviceMMC partition switch failedWriting to %sMMC(%d)... !read failed** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystems%c %s: fatext4unsupported** Can not find directory. ** ** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s error: overflow occurs Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driverInvalid load option for %ls /EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%d;%dH[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory Partition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting kaslr-seed ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx out of memory%s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition Cannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed ERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### Failed to install ECPT Unknownmanufacturer01/01/2024productUnknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassisevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7pxeuuidInvalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address DT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotatenoethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead (7:>.*62/##333333+3 33 bootcmd=mmc dev ${mmcdev}; if mmc rescan; then if run loadbootscript; then run bootscript; else if run loadimage; then run mmcboot; else run netboot; fi; fi; else run netboot; fibootdelay=2baudrate=115200ethprime=FEC0loadaddr=0x72000000mtdids=mtdparts=script=boot.scrimage=zImagefdt_addr=0x71000000boot_fdt=tryip_dyn=yesmmcdev=0mmcpart=1mmcroot=/dev/mmcblk0p2 rw rootwaitmmcargs=setenv bootargs console=ttymxc0,${baudrate} root=${mmcroot}loadbootscript=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${script};bootscript=echo Running bootscript from mmc ...; sourceloadimage=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${image}loadfdt=load mmc ${mmcdev}:${mmcpart} ${fdt_addr} ${fdt_file}mmcboot=echo Booting from mmc ...; run mmcargs; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if run loadfdt; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo WARN: Cannot load the DT; fi; fi; else bootz; fi;netargs=setenv bootargs console=ttymxc0,${baudrate} root=/dev/nfs ip=dhcp nfsroot=${serverip}:${nfsroot},v3,tcpnetboot=echo Booting from net ...; run netargs; if test ${ip_dyn} = yes; then setenv get_cmd dhcp; else setenv get_cmd tftp; fi; ${get_cmd} ${image}; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if ${get_cmd} ${fdt_addr} ${fdt_file}; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo ERROR: Cannot load the DT; exit; fi; fi; else bootz; fi;-///)/+59=LLLLLLLLLAJGGG GGGGGGGG 0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass &:!(6CQ_ky."*&'hUh=OtUR1h+.1  (H_7arocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.  0123456789abcdef+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to  ɶAOHa4py #(-27] - Run script starting at addr$)9aGaKNS DMWDDa  ( w   U-Boot 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000)@Sc@cccr0ww$w~w8ww4w~w|wwǁw@w@wwǁw@w@w{wǁw@w@wHwǁw @w@wwǁw@@w@wwǁw@w@wwǁw@w@wwǁw@w@w̌wǁw@w@wɅwǁwئw@w@wwǁw(w@w@wwǁww@w@wwǁww@w@wwǁww@w@wwǁw趀w@w@wwǁwضw@w@wwwǁw@w@w@wwǁwീw@w@w /@ͅwǁw w@w@w`wǁw$ w@w@wHӅwǁww@w@wGwǁww@w@wwǁww@w@wɅwǁw\w@w@wۅwǁwhw@w@wiwǁww@w@wKӅwǁww@w@wPӅwǁww@w@w\Ӆwǁww@w@wKӅwǁw w@w@wԅwǁw w@w@wHwwǁw*w@w@wwǁw%w@w@wwǁw-w@w@wwǁw/w@w@wwǁwP(w@w@wwǁw'w@w@wHwǁw@w@w@wywǁwT&w@w@w0wǁw.w@w@wwǁw+w@w@w}ww8ww Mwww w ԅw w w XwXwwZwXZwZw4ZwXwZwZw Zw8w4wZwZwwPwZwYwZwZwpwYwnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@|w Hw(삆w\wHw}w܂wDwǁw8wIwewwǁwԨww@wSwǁwXw\wwywǁwpwJw@wDwǁwpwJw@w wǁwTww@wwǁwwww$wħwǁw-wAwwotwǁw\wlwAwMՅwǁwwSՅwԅwAwǁw4wHwgw4wǁww:wuEwCmwǁw.w;mw@w*wǁww.w=wwǁwww@w|wǁwdw`wlwwǁwtwԺw麅wzwǁwwԅwԅwߗwwǁw◅wMwwwǁww'wwfw wǁw케wwww[w1wX;ww4[w!w:w~w~w~w0%wx;w%w&h;w:w`>wDwhwwn w(T?wLwdwp~w?w7wH@wrwxwpw@AwDw2Fwl0wh1w41wXAwHwcAww4Aww80Aw w6FwAw0,Fw3wZAwwwBww(łw,Dw wcwLEww\Ewkwцw wYwc@w(w$@wwc?w(w?wwQwlDFwDww|FwDwm@Aww(4˂w,MwrwRw܂wцw,w~~wRw ~wBRww8w}Ewww w|ew bwRwDw`ww w4wࣁwwwwwAuww1uww-wbwKuw8w=w!w8uwhw=w!wwwwDw ^w wpww wZZ w\w wTw wDw葂wЋw^ wwwЋw/ ww葂wЋw" ww葂wЋw w w葂wЋw w0w葂wЋwD wwwЋwrwwewiw4qw wwwLw&8uwxww(\w ww wWw28)w*w)w-w63w$3wH8w8ww8wHwLwS wYw8wZwMwcdww8wمwlw|wDwmw w}wdтwP܂w@ $ w~~wwxwP܂wD@ $~wBw$9w w$Dwpw Mww>w?w?w?w`BwHCwLCwPCwTCwKwKw KwKwKwKwKw KwQwQwQwQwQwQwQwQwQwQwQwQwQwQw Rw$Rw(RwtRwxRw|RwSwSw Sw$Sw(Sw,Sw0SwTw Tw$Tw(TwTTwXTw`UwUw,Xw4Xw8XwXw8YwYwYwYwYwYwZwZwZwZwZwZwZw [wT[wX[w[w[w[w[w\w\w\w\wL]wP]wT]wX]w\]w]w]w]w]w^w^w^w_w_w_w_w_w_w`w`w`w`wawawawawcwcw|dwdwfwgwgwhwmwmwmwmwmwmwmwmwmwmwmwmwmwmwnwnww>w>wBwBwBwBwBwBwBwtDwDwDwDwFwFwHwHwMwdRwhRwlRwpRwtRwxRw|RwRwRwUwUwUwVwXbw`bwdbw|bwbwbwbwbwbwbwbwbwbwbwbwbwbwbwcwcwtgwxgw|gwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgwgw8iwjwjwjwjwjwjwjwkwkwkwtmwxmwowow ow`rwdrwhrwlrwprwtrwxrw|rwrwrwrwrwwwxwxwzwzwzwzwzwzw0|w|wLwPwTwXw\w`wwhwdwhwwww4w8ww@w@w@w@wBwBwBwBwDwEw8FwxGwTwTwTwTw|UwUwUwUwUw$[w([w `w`w`w|bwbwbwbwbwbwgwgwiw0lw8lww0>w>w>w?w?w@w@wCwCwCwCwCwCwCwCwCwDwDwDw DwDwDwDwDw Dw$Dw(Dw,Dw0Dw4Dw8Dww8>w<>w@>wD>wH>wL>w`>w>w>w>w>w>w>w>w>w>w>w>w>w>w?w?w?w ?w?w?w?w?w ?w$?w(?w,?w0?w4?w8?w"okaydefaultmma8450@1c !fsl,mma8450dialog@48!dlg,da9053-aadlg,da9052Hdu regulatorsbuck1 x(buck2 x(buck3H&%(buck4H&%(ldo1 'w@<(ldo2 'w@(ldo3RH2Z(ldo4RH2Z(ldo5O6(ldo6O6(ldo7)0)0?"ldo8O6(ldo96(ldo10O6(ssi@63fcc000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u0 ipgbaud rxtx! disabledaudmux@63fd0000"!fsl,imx53-audmuxfsl,imx31-audmuxc@okaydefaultnand@63fdb000!fsl,imx53-nandcu< disabledssi@63fe8000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u`2 ipgbaud ./rxtx! disabledethernet@63fec000!fsl,imx53-fecfsl,imx25-fecc@uW*** ipgahbptpokaydefaultNrmii Wtve@63ff0000!fsl,imx53-tvecu\Et tvedi_selokaydefault g!svga"portendpoint#? vpu@63ff4000!fsl,imx53-vpucnm,coda7541c@u @?perahb$okaycrypto@63ff8000!fsl,imx53-saharac@uipgahbsram@f8000000 !mmio-sram?$memory@70000000memoryp disp0!fsl,imx-parallel-displaydefault% disabledport@0endpoint&?port@1endpoint'?+gpio-keys !gpio-keyspower Power Button (tvolume-up Volume Up )svolume-down Volume Down )rleds !gpio-ledsdefault*user Heartbeat  heartbeatpanel !sii,43wvf1gportendpoint+?'regulators !simple-busregulator@0!regulator-fixed3P2V00(?regulator@1!regulator-fixed usb_vbusLK@LK@ ?sound.!fsl,imx53-qsb-sgtl5000fsl,imx-audio-sgtl5000imx53-qsb-sgtl5000,-8#MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUT1> #address-cells#size-cellsmodelcompatiblestdout-pathethernet0gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2device_typeregclocksclock-latencyvoltage-toleranceoperating-pointsportsinterrupt-controller#interrupt-cellsphandle#clock-cellsclock-frequencyinterrupt-parentinterruptsclock-names#phy-cellsstatusrangesresetsremote-endpointreg-namesinterrupt-namesbus-widthpinctrl-namespinctrl-0cd-gpiosdmasdma-names#sound-dai-cellsfsl,fifo-depthwp-gpiosfsl,usbmiscfsl,usbphydr_modevbus-supplyphy_type#index-cellsgpio-controller#gpio-cellsfsl,pinsgpr#pwm-cells#reset-cells#dma-cellsfsl,sdma-ram-script-nameVDDA-supplyVDDIO-supplyregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onphy-modephy-reset-gpiosddc-i2c-busfsl,tve-modefsl,hsync-pinfsl,vsync-pindac-supplyiramlabellinux,codewakeup-sourcelinux,default-triggerregulator-namegpioenable-active-highssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-port