.A  9U@ CHSETTINGS0@1)Oo/Oo   P!:0@" Р0@Khhhh_JR#pG0@0n0@K`pGЂ0@ pG0HKc/CByDJBO|2O2_AKhh`_h"$h`_hh`_hhP4H(`_h-hP*`_h-hP*`_hh `_hh!`hhlh__hhlJ`_hhm`_hh@m`hh!h_:_hHh!`JB ؿ_hJh1`0O2hh!h_*0@0D0@M`D@`KB.أ;B*3BO3J<KBK"_KBHKI K"_KB HKIB FKKKKA0@/A J/P /+`D`D/;/K 0D0D00D0D0DpD!OpKhh0!h_"b_h h0 `hh0!h_Bb_hh01`pG0@OJhhhh8ht!hhDhHh| h hD hH hL hPhThhhh0hhhdhhhlhphL hCs `hh hCs `hh hCs `hh hCs `hh hCs `hh!hCs`# ]0@'J'Khh'Ih`&JB@ :B42B9ТrB H$JB JB*JBKJh`KJhJBKJh`KJhKJh`KJh`KJh` KJh` KJh KJh猔0@p0@r0@ 0DՂ0@`D00D`D0@0@0@ 0@pD0@0@`0@`0@0@p0@@0@@0@ 0@_"K+pGp0JK _ @@ pGp0JpGKj_J2R/OR! DZ"b pG HN_ Kb_+"ZbpG HFOSXC K Ij _+pGj_DFMb HKhhhh_ pG0@-AKhh(KOxOF'S PM H;F*F1F H HAuHp0@|0@0@0@0@NJ0@0@#pBp4#`_1#P3.RpGpGpGpGpGpGCk_+pG_J#JFd_EUSd@1Jw!&$@ -M$O F%F F&F"F#OoKCNaEqQ@8 ?O.Oa#B(FP NXEvXN K7BєB|ӄB| U@FFO F@NPNLFc Khh KB Khh3h_8@pG pGp0@0D0@KS |0@0+ۿ_a 0+ۿ_Ca 0+ۿ_a 0+ۿ_a 0+ۿ_b 0+ۿ_Cb0+ۿ_c0+ۿ_Cc0+ۿ_c0+ۿ_cpGF"#h0F"ch0F}"h0Ft"ci0 FIh#h8DhDpFFF).ГiG#iIhhp@IH#i!hOzp!FpCi² }G)FHq#i+hp@!˻p0@0@0@>0@ pG-EFF'8FU 0F+@7/0 0T m l %uOT j irN;hh3hhj3`4H\$P  ` or;hh3hh03h4Ld$t/  P;hh3hh034X|$  v .;hh3hh03x4Tt$ T! ;hh3hh13p4Pl$qiQ$ *+ *8HU(0FO 3`E1PFX j(0Ri[iB *i0B3hB8H 0#3`0  _+3h$ qiHS3h h0@0@_0@0@pDKDLhhDKhhvF #hh8"h#C`#hhD:K h_;@6H #hhH1K h_;@-H 0CcC_"h!h `#hh!K  HeKB! #hh8"hC`#hhDK h_;@H #hhH Kp h_;@Hp@p0@0@0@@B0@ۃ0@0TFhF#CB;! K(!F@H@B0@FF F)7h_Ch_" h #BJhB)F F^"F!#hFCB; K!F Hc? F+hc&khc_`@B0@8KLhhKD}o#hhm(F#hh h#s`#hh hCs`h#` KhhV#hFh"m8@p0@0@0@-AFFF)>-^\"tR?+hBA`ѽhB#C`P/*8w h#C `6EX) K h_;@Hw h"B `6BW)ѯ K h_;@H/u@B0@ Khh h"B `hh h"B `hh h"B `hh h"B `hh h"B `hh#hC`@0@-A7K8Nhh3hhOCFh_1L["h+hh ""_Or#hhh`3hhx#hFh"\ 3hFhpIChhKFs "hXhp)F'GGgp#h"ho3hhi##h"h_Ae0@0@0@Mbs FF.K/Hh_%e hB l#l_"F2CҲ*޲oF E _#e_O`"d E_#e_"d E_#e_"d ECC_#e_"d0+E_%e_#dpp0@0D-A K!MhFhwCovv}*ho@NhF8"h `E ѿ_#0+hh82`S2qDV!S9G1S9Gp0@0@k_#cCs_ck_pGO@Khhooн@O@߿p0@n_Cc_fpGpG-KhhBo iJi_Bai_ai_Bb j_bhh JB'ѿ_"cj_ j_ k_ k_h hJBBoѿ_O%cCe_O"c_OcJB_O#cKp0@0D0T`D 7F}FO  OE+DoCB<8 KhhCo1h[+,h#C`#iCC#akh_`kk_0)F F`! Fh! Fxh_`k_0#i#C#a FE0p0@J IhhB.IBѿ_OBcpGp0@0D0D7F_#`_`_c`_#`h_`h_`[h_c`h_#`|±h_Kdh_dRh_Zdh_dJhCs`#HLIM`#` h"*#`#`0* *""`1B+#`F*H *H0@0@@NPNOChd}FoCEB ,](6Khhh4Hv3N3hO@1O;hO@oCBJX3hO@C;hO@=,7O@ )FgBF*FHk,)0KhhCo3hO@;h@O@ֽ,ѿ_"Khhh`,ѽ@0@@N0@0@00@p0@B"8C_M+hhP4`Br_Ot+hhP4`+hhP4h_d 3<Ѵ@ @B80@L#h#KJ  CC2I R :KC#_ Jh hX `_hhT$#`#`0@Mb̌0@O0pG-E XFF*<+:-8/-/4'FX_##`_3`#h*FCC#`+hAFC+`#h@FC C#`3h;CC3` K H+hC+`O )(н@B~0@K$L@#@ O( zC(&E($#!zJFB8(ah@#@ O؉i@#@ O ؋hY)(#0z0IC+##0@pGpGjJh$ G0@T_-O_p`_-`O_p` O_p`$0@#??OopGpG@pG@pG8F F@0?"3@SB#@BؿO)F F8@>?DpGpF F#0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pG q` XG 8pG0$h4_@BМB 0 П P-0@0@TРР.440 SPР 8/0@"0@FhO1 "jGF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGpGH : 0@C?@ pG?CS?opG??#S?opG?[ O$OopGm(ccXBXA Khh KD+ؿ_@K hhn|!y p0@0@KJh FhBrB02B K#` JB(KKKp0@0Dho0@pDn0@o0@`p0@KhhKBLKIB F`Kp0@0D`Dn0@n0@n0@L3"#hIhn#h"h I Khh KB #h@"hI0@0@0@p0@`D0@O3"FF-] pGpGpG pGpG@pGOH3aK``#qK`pG0@opGphMFBѽp@F@# F p'V J pG0@OB  BB pG BOA  Bb pGF ` pG  "!PFO4H Br 0[v$"!%OCPF %N$KZ%p/4DF+chB'8F[F!hHchiF#hGiFx A 0+L>GHe 4B5- HZ'L0@0@0@0@=0@ʄ0@0@0@O2 "H 5@߹0@LIF" FH@ F8LC,%%B J؂B H_BӚBٱHBҚB-80@0@R0@k0@iF F i`Ji`h a 3"q#`h! Ji` i@`h @1-MFFFFFFio?"FFQF(F|GH:FAF FF|`iAFFiF8AF@DF0FBFoh GE'hi9^(FHO5灅0@FpGq( pG-E hF+FF;+ZHoXM*h B63h+;+QHo F##O F8FHHO PF(`@FX#F+`@HoQF>H1h(hs(:((8Ho(hF(h!FF0H ",h FOCOrOQ|G &H (hl1FF*h8F,h F#F1F8F\poOS"F1F8F(;y+$q+H F#F1F8Fu(粅0@Յ0@-0@0@ֆ0@R0@t0@0@O@sJ#&]0@8 M+hcF0FIH F8#+`$<0@ 0@-AFFFFFȹ@!o?A@"FF0F:FAF(FKF(Fh0FF,#F2FIH,̿  T0@(0@FFFFFFpFOA HJ I HO0K"F9F+F0FN0@&0@(0@S0@@p8 pG"F!"4@KS CkGHF  B0 pGKS kGpGH  20 pGF  J0KXhkGXpGHp N(4hBB!(FKhBKhB F5`pO0<D@ FI`I `I`!D@<pNh]h%t$o T_ h+DB`B0 h+ IC hS`@ I` phJ-E]`h `0@0@0a(_P,QL"^huhB% D:P,hDh``EZ``DKhB=BKhu`*7P DhB0h``p@h ԰h)DB6MB%"ca#a``AX`YPH !@`h2C``T29``D20`pG""h`` oOQ"Ҋ 82PT0=B#!@bh Cb````*[2T* n2 w2@TPB ~"|2hBBh"Bh0@0@80@-M0FMKJhhC ( 5-N%4ZPhBhBChhh#`D`ZhBZ`0%30iIBpGh'z*GCEE`sa3a``BY`Qk $+ ث 83\"Ph `E#F+[3T++ n3 w3@TRBث |3?#~#Bh"W//hۃh``F*qa1aD{hC{`thOW' R&T#D#CBOOC ERD#[#E=Fj L;:۲T#0 ЋFL"WB{9D3 DI/B@ҲQ" B V[h@ŲT%P%T  ŲT%P%T  |0@CC-AvBF FO/0F8)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FHq0@pMC+B ,\D\DҲBѱBFpFg0@B;?+pGFDB K ,FFx3)pGFFFFF\B4F4"F9F0F#3U(FBFًB F FDBF9DB xO3pFNB%F(5F(FBdp-MF"F FhFIZ0F"IUKnFOOFO*zO- s] F 9Fx*J44-g0@w0@0@S0@ #FFFQ )hZ`ppGF˹-MF FFF%) FhGEFix"-) x550) ##0 +#l)'`i)#q'%)ʀ)иF00 + c)d)u)V;(у #`0# 0##qp_+ \#50@40@40@!60@40@40@40@40@50@+ !`-![B O O JH!qFBٔɲQ )OWO0AD ;I OшV)O OPO"sF Bٔ۲S +OW O0 SD 0 O?[#; !` 0PV!#hpCF3#`F:+O0 O #` 2YF FhG :ܸ?)? FhGʚ;K FFhF ]M40@RK ]pGM40@?RK p]pGC40@ RK p]pGC40@IK[FHDB pGAhB0\0@0@\0@pFz L J Kp@޿0FciGch3r Fp4B$\0@\0@0@pF#FFP0jph{"F1F(FG(opFo\o%F"ܿ8% F `CiK`id`,I`I [PP(F80@0@7F,hFk,H,, KJ;,Fkha3 IE0K J},FJJJJ0@0@0@0@0@0@81FU+-ѐ1+)#FrI  34, " I6 8"IR( O0O0Ç0@LJ0@i?3#?@3 ?$?#F"!oG( F8 @BFO0-MFi?3#?@3 :` OFFx"!@#? ' iHO3{`xh7F[F"AF0FoG(BFqh`H!U)Ѫ*[H100Fx`( rF p)xIL)y)I0SEEѸ @)>;jQF8Os`j+0FCCCD#`ꉫCCc` ;I,<+y9ISBSA*x[*C d SF2%" PA+yu0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`PPIS0FAA;hD00:hSF Fx`1͇0@0@)0@0@N0@F"#F] Ip" F M0#\.#2$*;#$0HpTg0@iF!F@lD?4$?@4 ?$?#F"!(FoG(JU#!Bsty*Z@@(3B 8FO0F`"!hF"iF F8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@Fb{#{!FC#{(FCC{Cb"F @FSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PART-MF HF(|,zІi@1Fjf?6&?@6 ?#? "[F!(FoG(F_o#FQF(FG(FWcx"xayB"xdHBBxBb#yC#yCCyCc]IBBQF Fjin"8F8 "9FPFh#"QFfl Q P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F @ 1F(Щi0FI0H A!J0KAAAaSFZF(FoGEPFQ P0UC#R CCS CcT B"VBBWBbZCQFNY X0C#Z CC[ CcB  IGNOREMEs#F"F F( bi# FV:CXBXAp-EiFF!F[ FTC?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FoO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`kJF ! <I,"I F]00@ @[H@"dPj@F \0@0@0@(FHO0 c0@(  pGFC KbhS"0"4@Bssh@8 p0@FCKbh S" #4@ C41p0@8F FC K`hQ 0us"@`Q  41#418sp0@0O0 h[h[hGFpG7F))$"o: FEa 0&(1[hP1hFO0O0pGh[hhGFFFF:F1F(F<FOzp" F FO`r F#0#FYhkh K@ @BCCC" Fc #0#l0 F#" #`p)FRѢABAAr@,Ld)sL!!CBB@r#(F"wFPOOzrhF[hi;!(FGF&iF(FF8Ro d 0F*BomFp!OtoX!$@$p1# *F #0#h+ )##" ]#-MFFFF@hMF`(FzA(jiB)H &0F Fo(ѣhZhiu2FAF FGFFE]F(UF-4""i o## FFȹ- F@ H9F*FBo /DѲ"爈0@0@#0##Or# ]0Jh}B }0 ?$?!F\Q(ѕ 0BoI 0Bѕ 0Bѕ 0B"(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oFohuJ?C|BF}̀ ?%?)F`F(@ƀ\@Op\(ĀOr)F0+`JR#`K`B@0RBR^#C3BOPpVK($bB0r00pZ*#s0n0 q 7 o [0#00[0#F02x<"<D*Ao02 #CR3#0EAЕ0ѹ#"F FEF#0iso [CSR$#0ԕ0p000&0F }\(#\1o o?0@@@-EFF'_ q0"#!(FC F(? N1F(FF(F FF(ڣh[hh F@G Bh\iiB(!FB8FAbwpG-EEiFF-@#p1# F#web{h[h[i+vO`Gh F[hhGF(@oXcg#h#b F^*F)F F FF(k F'#r0h FhJK@+ #Os#*Fv(0+BK`@8?N7#"0# F_(>)#0#hhhREOCC FF0+۸JOzp FG(ck#xscccsa#Jhl0B2`%(F n) F* F)! F:Fk+ 0Fzd 5#T1omH*o^Fψ0@hFhCSCCcHh[hh+! F @#Hcaoz#U10@-MGiF'%(F`8FU1+e%T1UQ+e#,0#" p1 `#1F FF(@"\#3l0*F`#1F Fs`F(@h"+1Fl0 #3#s`l0 F`iF(@|ihehpiOdP`eEb:*>jlnp FaF(ЇkTQ+ FO(FF! FaF(@Hk+ 0F zWd sOBa#`l0mF1F FzJ`I\IQ#0OSC"igcg1ChX!d@-O C|CCuF 3  #E CXCO O 5Or(D$0&(*,.0gakZ "2"1F F`r`#O3l0"1F F`F(@# Fq0F(@ F)z FUF(@hnI*7#H0l0F!c F1F`pF(@3#3## ``S`1F# F*? ZF(i0bd+ r+rPHOPKFP`H#khDCS#cKKdB-O ? (?#d0#@# # Fl`S`F`0պ 0B#kC#cORO^#kbk0M@#xs"+hB+K5B*H )M#ca((J(J(J(J@sCs0$KKO khV+@ кOк_6к_À"o Fh!agX! +O @0@0@0@0@0@@@@@ O7#1#l FB@"AzF(!# H A FOH@BeF(Ѻ_## F#bhKB]+hh1+@o"9F FggX1kh1l1X1Osg F#CsoF13!;#A19!!9!?a4""a"o@+@"@@ka# 0I0^0#ca;On+h#+5O#0#!KH"@#`# ?*? F`S` (0CE?x +pJR#pKBKAt#r!clI\1Bt jHjN&c0`1gJ FF&cHFckH&c" Fo@O \O]KB)F\HW< 3B`< E7W<, C B@W+<pkohh]C@M%u- ]Cz8OzuF02_02_C_02A m0FBIHa-khh.hh]CF(OxO - F0r_ z I HB32320@0@ى0@!'0@0@K0@/Oa F8Թ02_C _02BF( 02_C_0202_C_02 "_F+O0-EijYjFBh*e*,!vѿ_B _,!*jZbjkjB/i>h,2_#_,2,2_#p##C`#_,2ij)Y?HD"@3B(FF,2_#C#CC_ ,2F,_7AF-Hbhb,2_C_,21,!_" _,!("_B_("_" _,!("_"@8 zIH+c,2_#_,2 ,2_C׸ظҍ0@m0@8F,1_C_,1_ QF0_п_#02_ =F0_,1_#_,18(@zIH8@t@zIH0@0@0@iF4hCh1 y1_C_ 1F_,2_Cs_ ,2F,2_{ch_B80C80_O`c(2@2_Cc_@2,1_c_,1,2_#p##C`#_,2,2_#C#CpSC_ ,2F,_8,2_C_,2(2_Cs_(2+ih_J F4" izoIHom ZzvIHPzIH320@0@Ɋ0@m0@-AFF P!FFtF(>..6J&` J"`I@FI cKFC #EIM F`KbccaOsJ!Fb`Ja`Ja"a@ @BJMO0 H@ H0@0@ u0@Ё0@0 H-10@HKh( 0@0Cs0@iG@iG@jGFCj F@GFj F@GI HdFHh lHI HR@FHlHHHHH (F !H!F@HHDHpG 0@{۲_#C_s˲_p!_qӲ_spGFQX8}F F۲_` +K+_# 0#}۲_Zտ_##q_" _##t_"r_#sk)F F_# 08x۲_yɲ_C!8 F_!q_#t_#)Fr8@}۲_տ_ppG}۲_x_pG}_pGIK[FHDB pGAhB0<0@T0@<0@pFh F0Ci;)F Fp@Go%pFLDx B\B;g0@pFJFh FO0pJoh"F)DGB F)F FCh ++Rбo!F/H +ч FtGCF+hS$+h3$KB# FYCF FiB!h_B*hD(akh+ + +*hDYS[xP\ H OsBد FG(GCGF 0@-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`D(FO0AF(F DdB F*FFFXF(@EѲDBCDF!?2"?F2F ?&?2FXF (F"F1F(FF*KFhFFO4 Fi@ ?1!?F(F! (O4(F@")F Fw㊻ #@!F"3`8Fl3h4 +O!F H$dB#$4 H #$3`"!FH(#:0@C0@L0@-E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H %H?O2!H (OC $Ѩ acbO3a#O?1@ !?0 `(4`cjs``cj`#sa201)F @ b @D#aU0@0@0@i?3#?@3 N ?x"0`$?H"F! (#O53`(FF"IpF(" I6("IR(ċ0@Ç0@LJ0@"0K`jFF FD!Fjh HwO00kii @,@P@iF(FNj0@iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1F~(#hsC;`hci h`{Ch + 1`ÊjKCB##aiDy(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0F_#{!0F#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF~2FiF@F(F%F(?AZFb+#,1<-MF FFx+x.FF5/+\+0F5@o UF;/+\+ci;*0I0F #hZj"[jc`#3#a+x+*'IKj3Kjc`=+x+o FF(<XEF8ZF0F<P<1CEAF0F(iz!hCJh *"Dc`+O 3#3#az0@0@-MTFI@ FF(K(@A"AFS(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?FOFXO32/!FY(FgKgH * *OrObBUBFF!F0XHXFh  j XF1J1U!FD (F ++OsOcBҢFEv+F!Fc2[H2/KQFCE[F!FKб)H(~ ++OsOcBr CFK2 Br2 [DQFh(FQ + +OsOcBE FKo*o )@0@0@#"#] Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-#xGddTb 7 ?ñ2 Гhb 7 ?ñ2 PhX"R 5 C2 PhX dH2 Php0@1JPHpHHHH0@"J"J"J "J"J`"J #J$#J(#J<#JJ8J<J@JDJHJLJPJTJJJJ1JAJAJAJ AJ$AJ(AJ,AJ0AJ4AJHAJLAJPAJ`AJdAJhAJlAJpAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJAJBJ BJ BJ$BJ(BJ,BJ0BJHBJ`BJ CJDJ DJEJ EJ(EJ0EJ8EJ@EJHEJPEJXEJ`EJhEJpEJxEJEJEJJJJJJJJ$J(J,J0J8J@JDJHJLJPJTJhJlJpJJJJJJJJJJāJȁJ́JЁJJJ@JJJ JJJ J(J0JJJJ JJJJ JJ J(J0J8J@JPJXJ`JJJJ J(J0JJJ J(J0J8JJ J(JJ J(JJ J(JJ JJ JJ(J0J8JXJ`JhJxJГJJJ J(J0J8J@JHJPJXJ`JhJpJxJJJJJJJJJJДJؔJJJJJJ J(J0J8J@JHJPJXJ`JhJJJJJJJJJȕJؕJ a0Ja0Jx0J x0J(x0J0x0J8x0J@x0JHx0JPx0JXx0J`x0Jxx0Jx0Jx0J{0J{0J{0J8AJjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-(s*K>;@@@@@@@@@@x}uu@x}e @ @ `ppp00'@BQU0@Y0@[0@T0@T0@ZJL^X@BDFHJLN"$&(*,.0@BDF  # INVALID OMAP REVISION ?OMAPDRA%x-%s ES%x.%xTSTEMUHSGPPMIC_GPIO%s: gpio %d request failed %d Scaling voltage failed for 0x%x Error: efuse 0x%08x bits=%d unknown Error: efuse 0x%08x bits=%d val=0, using %d Clock enable failed for 0x%x idlest 0x%x FREQ UPDATE procedure failed!!Bypassing DPLL failed %x DPLL locking failed for %x SDRAM: identified size not same as expected size identified: %x expected: %x Error: ABB txdone is not set resetting ... U-BootTrying to boot from %s SPL: Unsupported Boot Device! SPL: failed to boot from all boot devices U-Boot SPL 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000) SPL: Image overlaps SPL SPL: Image too large mmc_load_image_raw_sector: mmc block read error spl: unsupported mmc boot device. spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_os: mmc block read error Expected image is not found. Trying to start U-Boot spl: mmc: wrong boot mode u-boot.imgMMC2_2MMC2MMC1%s: fat register err - %d %s: error reading image %s, err - %d argsuImagealloc space exhausted ### ERROR ### Please RESET the board ### %02XWhole Diskhdusbdmmcsdxx%s%c%dFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02xDOS%sEFIERROR : check_gpio: invalid GPIO %d MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d MMC Device %d not found mmc%s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s : DMA timeout: No status update %s: timedout waiting for status! %s: timedout waiting for ics! %s: timedout waiting for cc! %s: timedout waiting for cc2! %s: timedout waiting for softresetall! mmc_cdmmc_wpOMAP SD/MMCCannot find console Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) UPartition %d invalid on device %d ..Invalid FAT entry Error reading cluster do_scale_vcorespl_load_image_fat_osspl_register_fat_devicespl_load_image_fat(((((AAAAAABBBBBB   #(-275"SEr BR  NB~FIH>{H@ptP 7%F#h#`0FF9OBЄB  "F4{1HBHAG2*6$`B`A+)h D 2"`K` I"K`-E"MF+h iFFDB,3B#`##`%h F#FAFX$#hB$##`P(F-h5BO :FAF(FB( ,#`-,-A FFFH)*h(Fd!FB)F8F++  F3K,0hZB2` (F"8F FHHFFaFFVF H(+"\ȱCh;`###hhB"`- 1K,(Fk FHH IM h.hB($3i( ` 1K,hD79D![R3a@-h F*i:ha-M`O1FhDc  Y D)D!D?1z`F "XF*F F ` V P2"D"R*a :{ha H K!hi ?60 ppGHpGHpG&޾F B3 pG0j L;:۲T#0 ЋFL"WB{9D3 DI/B@ҲQ" B V[h@ŲT%P%T  ŲT%P%T  CC%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHX$ xDas U-BootppRUNTSERVdP==u#??OopG@@ּ#???Oo8F F0?"3@SB#@BؿO)F F8@>?DpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGFp \  @8pG0$h4_@BМB 0 /ПM P-u0@xРDРD'KHРP L8B,,0 SJJ 8/40@@N1@ _/_ РP/8 /0Od@P TP  Q:< 80QR:/lYpiF$0 k3dkBd#iFppGs0F[k`H F!H!=("H=qKIt,FH=eO@O`0;  FGp0kR RF:Q0RpGF H!s03 Fk H<H F@迖IR^RpFF(F0Fpo!F(F(FO6F`I2(TH;@tRR0G%@$0C#&@CC'@CcLBLBH )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFH= (oboxRRF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ I1_? ""#@;_`h_@ѿ_0'pG $HH|'$HHۿ'$HK Bӿ_"0'pG_ 0 $H8F FFIH<4$*F I H<% KBؿ_"0'8_pG 4MOR!S $H pG0HYk H HD HH@OBHH< k F;ck UF)*HhDpFF FiG#i[Ih(#i!hOzp!FhCi² }G#i+hp@!pV pG-EFFO@FU 0+@0 0T m l %mOT j ijN;hh3hhj3`4H\$  ` o;hh3hh03h4Ld$t  `;hh3hh034X|$ t >;hh3hh03x4Tt$ R!;hh3hh13p4Pl$zi*$)# ))&FO ;`B4PFV jjRi[iB *i3iB;hB8F 0#;`06  _+;hhrr8;K;Lhh;Khh#hh8"h#C`#h4JhD# h_:C#h,JhH# h_:Cѐ0CcC_"h!h `#hhK 9KB%#hh8"hC`#hJhD# h_:C#h JhH# h_:C8/rr@B0TFh!#CB; K@BFF Fh_Ch_ h #BJhB)F Fױ"F!#hFCB; K|p9f F+hc&khc_`@B8KLhhKD}o#hhm(F#hh h#s`#hh hCs`h#` Khh#hFh"m8@/rr);*XXpR?+hBA`,hB$D,`V_-w,h$D,`BV_-,h_?D$Oq!h!A!`BUO,ѳ!h_>A!Nr@B0{FoBCBA{F!Khh h"B `hh h"B `hh h"B `hh h"B `hh h"B `hh#hC`@r-A0{FoBCBm{F>K?Nhh&3hhOCFh_8L["h+hh ""_Or#hhh`3hh#hFh"\I3hFh%IChh$KFs "hXh>6p)F'GGgp#h"hi3hhi##h"hY_0{FoBCB{FArrrMbs FF*.K/Hh_%e hB l#l_"F2CҲ*޲oF E _#e_O`"d E_#e_"d E_#e_"d ECC_#e_"d0+E_%e_#dp/0D-A K!MhFhwCovv*ho@NhF8"h `E ѿ_#0+hh82`S2qDV!S9G1S9G/rn_Cc_fpGpG-KhhBo iJi_Bai_ai_Bb j_bhh JB'ѿ_"cj_ j_ k_ k_h hJBBoѿ_O%cCe_O"c_OcJB_O#cK/0D0T`D 7F}FO  GE+DoCB<8 KhhCo1h[+,h#C`#iCC#akh_`kk_0)F F`! Fh! Fh_`k_0#i#C#a FE0/J IhhB.IBѿ_OBcpG/0D0D7F _#`_`_c`_#`h_`h_`[h_c`h_#`|±h_Kdh_dRh_Zdh_dJhCs`#HLIM`#` h"*#`#`0* *""`1B+#`F*H *H$r r@NPNOCh0d{FoBCBx{F}FoCEB ,](6Khhh4Hj3N3hO@1O;hO@oCBJX3hO@7;hO@1,]O@ )F?BF*FH;,)0KhhCo3hO@;h@O@,ѿ_"Khhh`,ѽ@r@N$r rV/B"8C_M+hhP4`Br_Ot+hhP4`+hhP4h_d <Ѵ@ @B8rL#h#&KJ  CC2I R :KC#_ Jh hX `_hhT$#`#`(rMbrO0pG-E XFF*<+:-8/-/4'FX_##`_3`#h*FCC#`+hAFC+`#h@FC C#`3h;CC3` K Hc+hC+`O )(н@BWv@80lk- U$ B8 F!W4T_-O_p`_-`O_p` O_p`$0@_"KOzphg<0r_!Kha_"ha_ha_AqhdJx)!Oq_hxeѿ0r,r@! Qc0Jc-A2Kh_@/O;hhn|a_;h hnaF &KECD+-ؿ_;hhnp`_;hhna_;h0 hnaF F FIHD,CDF F_;he hnaE@,KEIHc/r"W+W00D6W Khh KD+ؿ_@K hhn|! /rKJh FhBrB02B K#` JB(KKK/0DpDl tKhhKBLKIB F`K/0D`D$$$KhhKB& j G(JI3_ @C3Cs_31_#C _1 3_ @Cp#Cs_3/0D0JL3"#hIhn#h"h I Khh KB #h@"hIrX>>N/`DNN-EFF6MFF*F#9F0F0v.HM0۱BBB BA!F$H: BBK:F;1F#PFHBB0DBB!FH #9F0F#Jx( H:BҺ@SWxW䩅WWXvF F-MtF0;C0 Or!HH?N\Fi#F)F9#0>+"!:@Q  Bȿ O NFF((izHh7)FyH:>*hxKBwH|OpM0+nsHrOk(FInH(F# kH^(FOiH:hHSi)fH:-Ы+ ++@0h0+ZK!(F?`@")FXF9#K\sdSHhd#)F0F \( d3e ped@F((1AH000000 0@D000000++n0J! J(l0j+HXiml(HOiml$HFiml!H=imlH4liml%(H%@*XX1X'VXcX~XXȩDXYԩYYY:YOYfYkl+hЫi00+ 0 D0|x՚J)D@Ւ0++ #RF (ǮvMo` 0 O0k1F0FZF@F| (3 @F  F&  o@F+mCpJiml(nHnH} lH:lH:-uhH:?1&?!?0  ѳEI BF BCcl+<Д"0+YH RF(NHxLHs"ԔFxoq % FAH:E@HR80F50FF(hx"9-4{<#FObQF?F ?M?KSF /O8A#FRF@ GF(AFH:4#FRF GF(#FRFOpGF(O@ԩYYZ`ZGZ}ZZ [[ZD[pGoFO,@-o8 AH:  A H H:#08 F`[[[-AFFF&B۽U F9O(h96Do ZlB@H!F:ZG  [o FFF#[lH|P!:-F #:F)F@ H!F:2G HdF(0F9 -\6\0oFZl 0 I(F:#h5F!kF"F, po-E FFFD[l "0+%O --&FW(90EED0F #:F)FFG@H!F:3FQFJGjF!PF+HK(FF p\F:p FFFj0H p1F(F0G\-MFKHFFFhFO 0F9Bغ!AH:i#FZF(FMB #D;` FH93-)FH9-o% EO3YF@FDZFQF@F 6C&(obbbbbFIHb9F  "5I6H93I5H9 wF`}FF;F2F)F+H9&I*H9h$"i"I&H9biI$H9*% FIFH9%B)F F*FIH9+% IH95 +!ihH R@9@9{bc#c2cCcYcoc|ccc8FF#h+O0`h()F8D h8 4FIHix9FIHݿH7FIHӿhP:FIHɿb9FIH?d :F29K` 4rHT @!9O@l8HD "!980P<@4 ,DBH4@0 "!9F`llH @ӿ"!9lB8¸pGs N FFF1hX1h+F FF F9DFp4r#iF3]KhB-@ @ 'Vl8 pG-EF#(vF;`3` MhE(FiI7#lcl+Д"0+!haH8r! h%#l #m[LQF(F hXQF(F }F(F8 ($(o-:!(F7s(!08 BKlAI F (Al j :H8 9K*hB8H\o[(F@33H(F \1HJ(F;/H/HA++ kE+Ѹѫ+@FF%H8-@h*:`D3`x## F W( fe eHo qԄl4r6f'l'VcX~X_lzl-EF%H FFF@!8F#3`;`"Fa,OR)FPF7R0`HO0Bc4`*F!FPF;`7 7K*:`1h H8X0hO3*F!FuHllm~Xȼ-MlF l8F(W8Fl+OO CF8F(J.( ###9F(FH(8FX(F 38F(N3 L^ET! F7 /-I F./+H# F*Jr/9F'H3x+1F Fp 1F"H# F!J.^F(")F FH)F F+HzjF)F FHq2*Xn'V|mmmmm ܄mm nm$naBnUndn`@` F@hF7F0F7Byh%)D0F7(,F FF@hFFaFj@7`hSF H8hC"@jCb(F9F FG(ЃFnsFFйh xFh"1Fia3`` `0i0ChD``(Fpo pFJFF!Ch87Fp F1FF  +` F po n-MFjFFFM0FHhF+pfah  +4!XF7J8O ]F [O QF `BhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFipGpFKF*F!J7c k6 c1FF F(F6p#d#bo F:_ FlFB k@#bco-AFFF@F|FAF8F F*hBAAF8F`"#1F F#+`oS NCaa 8EFhg`hd`iB 88`pF.F H4#F3pXxKh7(F7^`0pp`hoKh(F7F F(` F07(`iB08-A0"M"L  1F /K\CBkh+ 7D5TJI<( "AFH6 O3BF)F#(xxءooo pGp FF"!#k#k J#Fop1FJ(ksF FF!"Fh7OB"`F*FpLK` o𵻰 F Nعci i#fiF0F0Fu/F:h1F F"KX`W?+;*F/Fo"O1 Ft("lk6"!l6{ #")F6( I6F+ H6(6Ld(o o8aFK-A FFF"!0F#<j1F J(Ft\F oAF(F(]msF FF!"Fh7OB"`F*FAp-E$FKFF  BFIPF76"!F(h XhF :hB;` oopp(H Fh(F"!7#F F8+d/!6{`4"FbjUJjJ!+FJ76(c o 0F7#b0F(9F2cO6poF:_K` pF F{0KFK` OF FM( F]H)F4KHS!pP;FOq0FJ7] HFHFHKJ(F-F;FOq0FJ7; L#FoR_:pZ_*@pqԄF:Ip-Miư F+b4I0F6)0F650F6p(U-I(F6(F,I6*`i[F3F" FF(9#Fb#HFFO 5p  AF0Fr;F2F!FF2xBmCeo0F6d(o ge#e(FFooYpcpkpG_!-ACKܰ"F  ( #$!;J7:H F !8HFع6Hر!F73F!3H "!0F yF@O1.H(o F\)Kh(d%H(6+l(cF#H3F#I"H(!F7IFF@F7T!F8F(8F6d"!F /@!FHne(e#bmCeo pppppE^p\4rpF:G_p8mFCie F(( F8@K!F(F8@˾-E?H F!vF i((bei(F4F)F FY(O#l1F2"# kX(A ic@F-;khi !%J7!k" 6'/! 6:#p@FB($@Fk"km3gmm[3F2!J 7! (o=l H! HF3F2!J 7kE^pp G_pFFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-E F!FFF -F!F0F-O)FSF:F%FEE(x,h?`h?AQpD532-M$ FFFCFF&F;O ZF!(FdF ]Dȿ6$ȿElEL &FRK$FFFF-(`L#9F0FJ,,h#`#q-MFFF,{ !F(F S+ +"9F(F,DIFDH7O0F1FW!F(F,S F ;FR (F {+ +"!F !F(F $,F ,#F#FRK$!"FG F DO4O E4BF1F??F DOq-MFFF,ۺ ;F2F!F(F M,ÿSF2F!F(F,(F FFFF,}CF*F9F0F-"F, F,*FFIH6 FP,q7F+,FH6HF$ F060#F!(FJ,w,FH8qFqNq\q-MBFFF$ F!=J(F,OFFEAF(F,w#[EBAF(F,O8:FCF(F, ,kF'H6wTFAF(F-d(?O !F(FJ,8F,JFH6VH F^:H:Hd+8H 7H@@F+4H,'i?BGE /H!F64`ch+`hBB'HAF8F5O18F  F}({fcffH6ch BHwLwuv4rtvucXv!v~X6vJv_vvxvvnw pGFF FF(5H6O54H6] Fj(0H F(.Hle(F5#D+F F(J)I@ F9h0B#6c" F FH6S/bh!F8F4;! F0۱0ñc`!F8F4} F y F(%(F*Fw!xwww\wFF+^p$%F"DB * e9FH6O0%FPK$ 4`Gx-AO`#!FFF5FPCEAF8F6`0` 4,`-AO`:!FFF5FPCEAF8F6D0` 4,`FJ+ `@ @Bdx8 FIF+*F F8@+8mFJ+0/ò #p#O0眄FJ+0%ò #p#O0pFJ+0ò #p#O0cFJ+( p O0cFJ+ `o( ` 5dFJFJpx7FFJ+o(` "`0FO0vx#FJ+\ h #`o{x#FJ+J h #`ox#FJ+8 h #`oxFjFFFFhjF9F F`h0 D9F FxD4`+`+F2F9F F@oFJ+ `@ @Bx7FFJ+(` "`0FO0盺-EFF FF1F,HF6~)F FF((HE6q%H6mCF)F$J F+CFF)F F!J+FQFH6XH6RH6O#)F FJ+F :F1FH6B)F FF:F1FH66<HH]6.4BHxx'x_x愀xxyyĪ-AF" FF+FH5C IF8F5!8 K2F)F FAjH52IF8F5Ky#y(y2y#-AFFF0F)FmH5.kH59F FR`0F])FFeH59F  FV)FF^H59F FF)FZH5bTH5)FVH5]OH5.\Os@"9F  F)FFIH5x+.x9F  F)FF@H5d?K@G9F F'F)F;H5V50H5P>.9F FF)F2H5C.7'H5>.H59p-H54.#9F F*(F+H5.9F F()FH5 H5+*F1F F1F K@Ք7yyJy`yvyyyy. yyp]yy-A!FFIH5H5I F++FIHA5H5& F*u(F+! FxI+vJ#)F F+FkIsH5&9F F*V(F++")F F+2FF]IeH5ww)F FYJ>F)F+s")F F+z2FFQI[H5`)F FwFLIVH5U.^KH5P)F# FRJ+FDIPH5E.SCH5@MJ#)F F+F;IJH54IJ#)F F+|F5IFH5(O#)F FCFBJ+FF@J)F F+dF)I=H5O#)F FCF9J+FH)F F*(F+->F)FcH51FH5I (H51FH5$H I "H51F H5H+1F FJ1F{ zymzp]XzahzFzz7yaz6fzjztvBh{2mzz{ChDpGF FFF( 2F Fh)FhG Zh`O0-EFFF*f(F o9N"!F(F*jF6H44IF0F4q!F(F/N!F"(F*T"F9F(F*N"FF1F)H54 ' %HQF5*!F(F#J+rx+ hSH5H]!F(F*'!F(Fo W&?RF3F@F.vNBN0F4( N N 0{y{{'{{{j{{{L{0F F"*)F F`")F F* IF H5 0h )F F@|*|sIF+ +IFH5 p&)FH5!F(F*U(F+ +"!F(F*1FF H5x!F(F6(H5nmzH|y|愀F 0XBXA F 0XBXA F 0XBXA 8F F*عclh(F$!F+OFFF J(F*ix(F I+(o F8ooo)dxm FIF* ]9F0FJ*AF8F#!(F4FpD`F)F"%FT9F*F0F*PF F#o Xza0F+F0 F -MFFFF#M+O \Eo[FRFAF0FFF0FI(B  F,F F8 FlFF{ #*F F(o8o-MtFF| _ h h k+JR#H:FYF5MO18FF`FYFH5A F kF8F#F,.YFH5*8F #ڣH eo!F8F*,FH5-!FdZF#8FQ"FF8F*ZFH50!F8FJ  H 2!F8F(H *o H $!F8FVL0_BF!F8F0}(b"!F8Fv(["!F8FoF(S-@8"!F8FdF"!F8FN(@#"!F8FF(@"!F8F>(@"!F8F6(@ "!F8F.(@"!F8F&-#!F8FLFp F@F!FF*FPH5mo(-&-(!F8F}YFFH*h-!F8FH$YF>H5Do+Qzh-:D ГBҹBYF2H5+o2FYF/H5##8F!F ??0(dѝ?0 +_Ы+\-#BDF  FF 2F+F9F xYFH5ox|||/}|}W}{s}Un~X}}}}~,~FVF-0F*H B1FBF8F[>F-ѝ?0H `! ` +?S +F `H.&B-~D~l FF I:FF(####9FF F +g-MF# F *rhr@,r F4(#!4pF(^F"+FFB#Z##)F Ҁ(FjJF (F*( ,€@E4kh+DE/aH5'o`  ``08F 7 40FO2TFO' CE(CFDJ (F"F(F*##Z##)F =(#5H5,#! F4F#;#!F(F'JF (F*k#DF FZh ro F F (H5ro sFF+H 5e FfYFDXF+H 9FXF( XF+0'JFHo `tv~~~8F+#h h"hH4J( FQFF #hKh"hH46 F QHpG-Mh F "l+hB h(omm-II`h^(F(F FjFF0FF!F\(9I@FF(>4(o*FF1H40+:46F@F+Ix(F o "(F&I3F(5)FZ7 3X@F0GF( F7/+F!J4BM*I(fI(F H4XV\Uy`8=eHpGHpGHpGopG(opFPF "!}"FIlIl"IlIlpIl 8IlFo0Fp Il Il3oa(&0?LYd儀K`#C` -E}FF  FRF!i4 WCF$?miR*o }23)FF(Z@FiCihDo-#F"0Fi(oOr!F8F3@FihhD+-#F"0Fi(bx *O0@@* :a+#xBch 1oooŰF9FFjF`- C)F ;F0FJ4 FEop8FF F3Fر FI/ F! I9" I H3! K I(F F8@o 8RlYlŀ-AİhFmFNh,h FD#h"Hh3F(90FI@3(h( BF8FI*F+h:FYhF+h8hl1F((hF(8hF((F[犀\؀FFFG*pFFT!4FF H4u "Fq(FFH$4g FpO4ހ-E8FFFF 3Xh4xa:)*#)( "I`h `hJ+  B H42O0@!1F(F8 #KBF@sSFr@ FH?!F@<=FF"H4 FK(($HH 3"hKBH ,  FH FH  FHH  H O1 FH F F( HEf'V}cX~Xς悄*FF Kh@&$!W$44BF0F4rsF FQ&`KHhV4tkF"1F Fp4rsF#M FLId2FaCHpxm۶*̿XhH3F:"iF 24;H }H z 3]y-MFF FFFQFU;ܸvgI`h30F(@Fh4YFFh4YFF i49F2hFCFZH4(F1h~(ISF"FAF%SJTKFBFFRH4` "NIBF`h3F(?Ѡh4[FF(F4`FH4"DI`h30(F "4='-AF>+ FFO0" Iph(ChbB-hKB)FF3A`G s0F#*3 OCH40 M`h)h()h`hF(`h4A4r F"FH4t}F#H"4j]p@JHk%F&+lk1FFH#kDH#*lCH6.!h?Hah>Hh=H=H44;H8:HL "8I8H4%5F(GF5I4!FjF3H5F5EF0H4,9/H4 .H>F-H4,Hh+Hl~)Hpyh zh 2Y21:F H4KF0i fpI3jFH4ŇЇڇ懄%5/A^_qzwVS*-AFFW I"Xh X@hCF:F1F(FFA`GO0s*8F"XhF4"FFh4FF(Fd*F!FH4e 8O0翈kH4P ]8ML(h&$ h&!#J+``J#``8#sF F3jOp'FH4(F p)~H4 ' Fp iF0F"F pd$A H4)H4&!&=5Kh`Kh `pG-EF 0F*BFFJhDB"!F(F&W8O1(FFFpKP`BF9F0F$r K`<*F F$7 F&K`N-EF}Or!:ON  3lE% ql"JH)D3nF(rl*DQ||C#||CCSc AH`@H@?H4U?L F }!4 ;H4H:LFPF),F7HPF$KF h@s@0F$@TF$ DT"FkF !&v%F8#H4"H4"L$ Dd- EQF,C@F@3F2F!FXH F$,!FH!F(H3XP`Y`d}Ɗ *#-A:KFhF8L!h)8$2F#F Ft##FFF2I"F)F/H3 !-I3F*F h"F ı(H3#*F"I"F(F&d, F0F#7!hFHFO1*Dd! F FO2AF*,!F2F8F&DF00F LF1FFP#] *-AFFO4 F&F0 A4H3%$,Шh3/KFB(-Ihh2+hF )H3 $hh2F"H"I2IF2"F!F8F3AF(O4(F 6!F"@F31F(!F0F $ KhB9F H3$ Khs='Ǎ׋-EF##MT5"FCFFFdKhH !3 2H2#BF!F0F0Q(#0#As"F1FCF8F@4r-M FH O,hB TH<J:FHK@;F38N@H  V+ZE H3(VE$hFF:jaV ~p*FFIXh2"F$%F#  mW% @#5B a %HpG(hBh`hhZ` pG#h`C`HpGCh` pGphhFiBjB^h! " H3BH ihH3Bѽp@H pphhFiB'jB$^h) "H3BH h"hh;Bciyk H3ah H3~Bѽp@H Hp '& (h K ih"X3hHF3O ], hhhh2 -MhFh)>9 I PF(4OUoBOH HV2dIFXF2B"IH"'#F;q F b(FV,yhRVFM%S$D %F" F!F*FH3(F Fб#FH"F#h"rF)F0F*U(F JKBF FLX "@!Kk" !K@kɍCh)j3BC`pGi;BC`pGi23abpGj:;abpG0F F 8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF q  R8(7iroF(ڀF"&F F%Fhph.F(̀!F/9F F"F8F!  D F%*O1k)@FO1k)9A PFHkO1(F)FF)I"%sk 80 $aF(PF"EI%F ^ F [k Xpk Uh R0j O $ $8F$@F$(F2F F2IF(a F/IF(W F*Kk*IK(L*F F'K(IA(B*F F$K%I7(8"K#J#K Fh"KF+ KB?ODF M F!FN'FI1D=HBF (;I1D:H8F0F(00F18(F15(F)F8"@F(F1*(F8!@FBFAF)H18F28F29F9F$H1 / G!H I H1zI1 FI1H 4ȓpnpT^k^p^w^}撄U].]8* "!Xh1 0 $$ $$$$$$$p*FH1& "p#h`h  Fhl8+F2FahH1  k烗$$\$k0D<F MB  4B xH+\0F BbP-AF8H F!1GF!F0FF1H %BܽA-H O7-*H 0F 0F05D0F00D&ѧB"F1FAH1%H1,4lgBHA1}V%JHBBF 1s5BH1l OBH KbB;Fq]F H1]5֜朄㜄蜄8᫄F:҄FFH1<K!F`H@J $-M*FFO4K"IXh0CF(~ѧ FF%x-+!1F/9б-?0F>c+ q+'?+  8%-h0#$ Kh(EIH1 F)F~H0}IF&(5uK1FwH`h !1:JhB/FmHFF'/('FhH1"fIhh0F(;/kFh1`@F?(!Fh1/FChF1F''cFPH1o!F(i1FFBhBJH1_u0F$>N3hEH i"DIhh0qȹ/"h0hh'B'0F)ЧBHrQ4X$Pk,U$4d䝄TW}䱄➄"(F1 *x?* 2`23Q))FH+F)x2 )Ъ[+*0MJx])F )14X$0BS\Dx])?Z1J3 CF{M0(F0@S4BDBED7hhxg+@#/!/њ0s+)i0h '50n+s+H/F!F0h'!FF0h&0Fn+/!hi1FO5{BݓB 5n* ]E !F"0h&F@FQ!F0h&ښ0s+@FiO;>H1!FZF0h&-F(b)`ۚ0v+Q 4I/ "!i1#F-)F F-"h*I1O6. F07D F00>DBܻ!F'.۵T& - YGI1j7B1FHa+F@F s+RF'eFHPF:.߰5Op+#l+@O//hQF0h&L ,D)F"F0h&F`"FQFH1;O l$-(!FH1+(FXH1#")F0h&1EF pxK)FIH 14,݋H!JHZh,F1Q3h;Hh 1K3h9Hh 1E3h7Hi 1?!F5H1;3h4Hi 15,3h1Hi 1- 3h.Hj 1$,3h+HYj 10h&F'H1&I"04F(H/㫨h13hab1t愀S0tiq<фßݟ!4Kbp̠㠄"qIhh0Fȹ/"Fh1"FFh!F1BF;F0hmt˻"aIhh0F(]ѫhxp+'0h&F[H1ZH1E/AF0h&g&pFSHܻAFPH21ra+"Fh1F"F F(iAF1?:F#F0h'(&EF?Hd+'Fh1F0h'(&1F6H̻"5Ihh0\Fع// Fh1!FFh1<0h "F9F0hhF%I"hh09Fȹ/3h+?$h1(?0h(?I"hh0F(ɪ/Шh1oF0h3./FM]3砄ꠄ7Vpt$M$f$}$H$=O!1'*-A\h* FOBI O0P#xs+c+i+O4 Ft+&@F3IFFh )F/H1k&&&瞹(F@(FFAF*F&H1W_!F$H1P$..(F_Fذd !F(F5$$H15(F_FH1*7$BH(FD7(F>.$7ռvlҨ*-AFFW I "Xh @hCF:F1F(FFA`GO04t*  F H0$  Xh!1YFFH0 FF(FH0̩⩄*pM"Xh!1;JKkCBFFH0O00F1FjH0H06B pJK&lC!FjH0H0.p *愀p Dii F *p!"!Xh1F&H 4F-ۥB !F H0H64, @ pO5:P* FH0-$  !Xh0JKJSCBFF H0O0 H0 FF(FH0Vp .*i|#\.*D@x08pG3+ pG-M*FFO4 F>KhPFF8FF F/-G @ 8 (Կ  (̿  C1FPF}1FF8Fx-! #XBXA  B  BBB  4\E)FH0o 1@*FFh (F(3 H (hahho#O0W"K`KhK`pG𯅀KhK`KhK`KhK`pG쯅诅KhK`KhK`KhK`pG诅쯅@0O0MFA`)F FF(`*FOa /hϱx I (F (h FH0O6$DDsJ3FFH I8F (F |?0F!?!F"F H0!FH0F Ma񫄀F:\Kh#JhY`ppG#I/*D?pGD 8 K Mh,L (8(x<(% -M'mh F.>FO44@#F;xw _PF kgܺxкux QhIF B8F ?(B@l'''''' ' ' ' '#3p##'spY#pp7qK 0x0qsqqB!Kh!Khd')Ozp/?&"KH`1F F2F1FH/1FHc!FH/K`$Я ,(%篅$ԯ쯅诅𯅀4rh\*-MFF:|pKhKh!F 2;F)F"F(F-d K5D`Kp`!h 1F/ KhD1F/FO0 u@<0*L!Xh/ `!hH/O 0"* 3: FF!H ]O0&F+F;!h/!Fhh//F!h/H/H/#F&%DB$B1FH/ #F/h@F/D #F/`U4O09ﾭb*pFC!h t@!ph/\!Fh/W( -#h-#h-##x-#FF*S:-#FF*S:- D#FB+#FF*3:O0p -E*FFUh $Sۣ+)JOphR#p&O/!0h/0!h/&*F B $,h hBUED7#F9FH/R$:F1FH/L F,, x "D6O4$<0FF-Kh-Kh!F-H/-!!h+H/*H}(C((O!;x-+.kBD!h 0`h9F/KhD-!hH-!H!xH"H/B K` K`- `.,D-- p .+F84󪄀ްt0䰄간ê*F O0pG*F {O0pG-AF+F-!8h /*!xh/K"h!Dh/iF !h/#F8  -`+D-- pO0 0*-EFF&h !`h/M!Fh/!Fh-h/( H  x O00𰄀8 FBFB H/*cAh)@8@H/ H/ -M*FFkݧKx[x4 50KxKKKKh60KBhhx40.-(!FkhYx.53Шh/còx-+;0!/X_. h/P_x-++0!/E_. !(i/=.6!hi/5"|I .hzH/O4 FF40r+i+m++"mI .F(@ԁ ػ @ȁfH/w$w+$.&$VF_OB$\ 3!F 2(*!F20 305!FFOK!F(;F gLJLI ,(F!F GH/.4Os2F60)F 6(02F)F=H/$6^ESEE8H/ 5UE*#K4 p5 Zp!K` K6 KKK`K`KSEE2F)F$H/6#H/FF$2F)FS(2F)FH/$6^E605UEFF\TPLHXDraeT_ $ٴ愀!'#2F80)FwH/)FvH/1FuH/$6^E5UE?oFF80#6  @C2F)F80(eH$3F8*F_H/Q#$ 65ZE kZH/D3۲SE?4EFTO;;xCE[EC3\h*FLH/$# ;BEH/GK7B # ~hDHfs@/r*Q@)@08J9N_2F! "5H/-H/ 32J*))F0Fs.IE-KF,H/籈E @)т)F0F + #I$J+F))F0FI# l"I .(.38h4Tozٴ愀h%ߵ% ,(k4/KaL9ra FF,F3!ph/Ozs.!ph.F@d"#N BD(FpB 09_ 3#0d .O0 -MFFFF "IV<F ChB!/тhKBH0+4( #0h3F"F9F@FFM`GHB O0 uv *p&!Xh/iNF0hF01hH/$ Fp K I HF/,`(FR$O4v4#년N'}F FO`F"IF.(9 ?&?1F(F00 C 5D  SC SC"h"b`"FU?ihS [ CSaha`2B }h)ch[c`9F0F/``qԄ  -EFh}hH/TWH/Ocham+O! H/DmHӲ#TC/6iH/2 FH/*jHjHaoH/MahH#5!(FBH)F/!yH/ H/K!iJH)FF.H?&}J,K IH*F Fi.~H+sJH ,bhyKDyJB򘀔fPwH .Fg` O dJH ,nH(eKlJ(?.F,yh0@fH~eH6TJ,hbH8PJ,`_H*^KKN -F2F,QZH,2F,I&6-\Дgp7A2C1FPH.r?KFJ/F,/h03ACAH.  FAF kFP!F@H.Q+0+0ЋBH ,$IpY-4tIpY-'4m IpY-('4cH{H.HL,+P:F*d&-E2K!h F&F2F!FH L,K,J1FF+H.&K`i0+9!F&H.8F!hh.!F!hh.!Fh.(F!H.j'! FF!hh.!Fh.(F!h.! F(Fx!Fz H.EO7v년Y L! hpH !h 0{+  Ha v*F5Xh!.!Fh.OF!8haFh#F2F9hH.(Fr(H. (F"F1F %F K JFBF H.` O0v„년?„*-AF?Xh!.G!Fh.B!Fh.=hF!Fp#F2FH.(F(H. (F;F"F1F F K JFBF H.` O0vU„„년„pFK!hFF(Ch+H.h$ Fp.!hh.F F 2F(H.U $v„„*-AF5Xh!.!Fh.!Fh.XF!1F*F#FH.&0FQ)F;F"F SF K JFBF H.` O0 v„년„ L h(( `!P0 H/ v -AFFF" FWIbChB -сh KB h;F)F0FFA`GO0 vp/F( HMh,<,3B pl H/KlB+FbhH.j,  RF(D,="Or!0F%|:F)Fs2xI+F*YF FI.i0F-{5-1F F  H.wO0 }ODF ʄ8F:ʄʄ-EF!} FF!Or +CjF[( !} "AFh. xFBFù!F"(//0JOq -. hl h 0#FJH. O0pʄp]-A*FFO4MIXh- Fȹ3+hhV(v.(i. F"@H-?Ihh,8"A:Ihh,F8"A]4Ihh,"1Ihh,"/Ihh,F-H-K.J%FO+OB(H(H- :!,!X$H-5#Ihh,F(.ݮhh0F9F-i(:F1FH-k$(FF۲r#)FH-]|τp]~Ȅτʄ h ʄ愀ʄ+˄.˄0FK~F2" IkF! hP(F +hca0"opτ*-AFFW I"Xh@hCF:F1F(FFA`GO0w0*FHF0$ F 0*/\h! F-f(!FH-H #J)FFH-F,Ob I H/O4pτp='F:I-EF1HFFF#.J WF(N*H)F!E((&K&Ih-X&O *F <( >N*F /(H8`0 ]*F (*F (V) Go Fo pτM0Tw*"Hб!-(#y FX H- FH- $HO4pЄ='Є-E*FFFPFE:IXh,F&=4--5H~F8 -/HF.Ih,-Ih,F+Ih,Xh)H-gi"H9F%ch!h@F-2(AFH%##QFJ `H-9F V(H- 2F F  фppф ф#dфτ =''фFF F"!hF-:hFhxh `"#1F(F##` pG pG*-M@O O7FTFV#Ա3+  BU ,2kJ( hE$@  *%*/5>M\l|hh,8d d @ ! 1 !H -1@F,l(0F,g(!FH-ӄӄӄ愀Ԅ6Ԅӄ-EFF F,E)FFSH-, F, B(,  9(W,9i }([, FCH- ",!h>H- "/U|"sT#6U!chF;+4J5JR# 13H[-@F,( HSFBF)F+H-)F*H-,   @( ' H-PF,(0F,(Cl F ( (  ()F FT#;p oԄsԄ(gԄwԄԄy8F "!hFiF F0FiF} ClhF % p(Cl RGаq ?$?Os"F(!FH- PԄ-MFSH-1QI@QJ F 1NIOCMHNK F-1SJH- FGH-%FOEO1CEAHM-ʹ?H- !=H- 0h,<,3Bclj F hB F -(cl - hBIk Q( K`hwHp*FFO0p"IXh,HKx#H- "I`h,(H-"}I`h,P-zIzH-qKxvH-{F"uI`h,(sHqI"`h,F-nH(h-FFjH-Y FQFgH-Q FEcI"`h,iF(@-ݠh-F4F()FZH-3 !h- 9FBFTH!i xS+&E+QHF; +R####w######f;ڲ *=H,$)F;H,3hnA!AA]##"d  E%%"0Fq0.HS.H,$,H,$+H,$)H,$(H,+F"%H`"%I`h+ p@}"!F(FKp@tՄ-ՄՄՄՄՄG{ք񅄀*ք@քv]քxքׄքvׄׄքքքׄׄׄ؄hw-M*FFFF*.!Xh,-F)ѹh%XFYF RF3H3F,;#F*F jB 2FQF-H,. $OD! Fw((0%H F>#H[O Fh-@5H(D/B F1 3B FL(O1XF@HH0ehF- FiC K@F`9hZO0dۄۄۄۄ ܄ۄ4r-MFyKFFxHh}/!ph,</F!h,5/Fh!,,F F((VgHXO ]F&"F)FdH,"hcKBbH,  F^H+ZH,y0+/UH[TH,i FRHRH,` FBOH)F F/[ݝ)K)fHHFHYF"FDH,=O1 FAHYF FYF. (Ff+O?+#F9:FIT*(EO5yi8 *-AFFW I "Xh@hCF:F1F(FFA`GO0w#0 FFJ ),H,F F 0 ! H*H,w,F߄߄*FF[hx-*[xa+!<5,'&B76'-M'FF:FFO =-Fph4x-)SVH,! h,-FWQI`h+)(Q`h!,Fl-տ#F;ȿ 6 ''SF"F@H*'(j>K>HhOd)!b)c)O0%r)t)*^"O *X"O )&F*M"F!'(H   RE[xC  YFH, "F!FH,(FH,"AF <F"F , B?zH0 C0h HCqԄ#ᄀjeᄀ6ᄀp!F"<,S_.x-.iF Fs!o.a.f.нp@M"),FH! pᄀ*[h J# )@ ]O0-EFF.FQ_+x-+ =!(F+1Fx)F7H, >?+f+_H1J.h`0kBF(F,I) 0 'Z'+70BD FF!FH ;F &P+:F)PE&pџBKW# )8F+ K)FhH,O0ᄀyᄀ#℀0*FM/0 M0hhFȱOa FJ,1"!FH{(kh x JiF#8" C p#" O0';℀B℀-MFhmch*OF3hC;T#)F,Fx?/ @Fbh+I,o5.5 D@6%O $O Ub+(h+=  WEDco@3B ##0#DDcp3,F@6@FABȿ" KȿUxJ " m O0I℀t*FF"O0pGKhpGy K0#0Or x3iF ]iF  B℀-MFh#FFF 'F^F ;-`h x-)4!,*F!>4/OP" !V:H):7K8Hh,[ s)b) c)O0t)+R '+NF#)dF+DO PFM?!,4FI,Ho ;LP"!H)w۸9]* 8`1 H;F"FH#]℀℀\℀@ pGOrF!8t@ I HyO_H+fRlEp儀pG pGOzsXC+@ LFgx0?J@I`x ?HQ`x >I`x =I`x 愀hxpG8F 8x$+ "Cx I?+ p K Ih H+H Kh-!F(h*hh-ie&pFN4hp)F h*$ih+)Fp@ H+ּ h5h&`h#+F-iB*i(Fap@C愀-E9JxF\ *A=!F*80FO4 FF#;Dx40F0F@l F0F*(`p(F1F h*$iAF`h*0/-ݣh[`$h31FH+pO4/ܣh+#``h@F*``@F*,ah```SFa$PC愀-M$FF%F!8F*mF๸ɀ8F*qiD F{9FF(D* % ! F*U(@ FBЦ  AF F`RFF9F(D*EF6!0F*8Op:!0F*0F(ZO F0F)F(m0FF(gñ0F*$F@F* PD0F@ J*PIZ*)F Z* Z0 D  DOZp(F*9+FFSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F*<=!F*Op0F0!XY\F!0[YB0F50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%ޫF!&F!0S'0B00F;07 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F*h #+T(DBp!(F(Fo7Kh{o4J`FEF *H;h C (FDNF(I*;h(F&I*(F * 7h(F I*(F*% 0BF.6pF;!*0( HX+K8 ;F43+6_愀8 $l愀-MFF"!O8O %'  HKpBFF9F HOr"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH+$=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhG愀愀愀愀愀),愀&P! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H*#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?oj"K`#|/?K E?'?Ϯ!?~EѪ昴愀 K! K##Kh]),%(8M,h\ iK(``KaC`#`` 8愀愀8H ! "*FHFHw!FH A HJ! H~ A H@K F`8!焀=焀焀焀焀-AF "Kh8FA"O1Gk-)FH*F(0H:$4 ],н F FFH&!F H%F*4FBp)k@Fzl焀脀$脀 pG pGIK [@0pGN80 o 80pG KF @8 R8 8 o 8 k dpGH0 }C~#H0pG pG 0c@ d 0IFX80Or\CL0PKF [hl jlhh0Zhl h H ,脀HH 4脀*O2 !HLF` <脀 ! pG pG pG pG pG pG pG pG pG pG pG pG pG pG pGyH \:"H H \"U h h Rh2"p pH R"H H pl pGH0 s#H0H0P0pGpGpGpG#HFFFh l3F+"F.F!kGJ(t<0F BH;!R  !;C '@IAq[ @ A #1C _9F-Kе@; [   G '@f@@pF\  @@& @ _8FBсB H*7 F)F J( i  #F,д F:gfffE脀V4 *4 pG pGOB80 0PD4P@LF`c4 8 8@H0;#H0KFhu"H !(V" pG pG pG0 CsC0pG H+ R脀! HFx_ LhH!"hHR ` Z脀4rY`nH k脀hF H*~'F H*xH*u0H*n ]s脀脀愀脀 T X TS8I}@~P  I K J[`L D e!8b  l!  pG pG pG pG pG pG pG pG0H#3#s00#30!&(~y#hFJHFH*@+脀脀pF( H*$ FpN4hB)F)($h鄀"K`[`K`pGFK` !FH* +鄀8 MF(h0!F0)(h8 F( Kh0pGFFF ;FO21FjG(( FFF@3FO2)FkG 8 M H,hB H Kha8@ H1*ZH*U$h8?鄀愀S鄀M鄀-AFF" FF O0Os@B"AF8F (ѽ0DA 3`+pp7" F F|8H* H* !0")F FiH")F F _ H40 @`d 0_i鄀鄀s鄀鄀7" F F<8HH* 0")F F)H")F F  H0 @, 0鄀鄀鄀鄀 pG#0"D*A,-Q+!A!ODg0"D BDoBg@ 𵣰,FF0= G$?bp 'pb 〢OB)* (9%{ #+5Ozp)oO00hn#D$d%#"(PDA"C0} G%?F+F"!FBF(F H* F }F1FH*o")Fp$ꄀ-ꄀBhF*@## 1fg0Y* "@! FOzp)\1 +g0 + + I H*o@+## f##vOeꄀ-EFFF%N@z#hn"A!d# F#1C (=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F(o"xcx˱"(\\\3ZB+ Fڲ"pB #Ie"P+8FOEY ( %9=+ )` o8Ozp)o3 TopG Fh7n&A!Os;C"#AAF(o#Bo@"Bgn"f0Fp & G$?ʲ#F!F(F(H)o"p1FH)`ꄀꄀFFʲ!p#pp#&QwBH)o$ED&1+ 3nhC$Os## "DApꄀ-A} ?FFFF$?+o }*)#p(z#FF((#x+%O38c9#FBF0F(8B ?4B#+pBcx0##x;4?#o"-MFFF(Ozp))F F0?@ !?Fб;FF)F FGڴ !H)0F5=F(F.Foo Pqx)ЎH);2x *FHO;1FpoFQ]F1B 9xzx*R0*z*> ){H)8BxH0x[E2ДQ-tH0F%Oz1By&ok1# p F D9F#" %!"&!;xDj#C&!2&!) )VHADBTHkSH hC#%ݓNHn %!"p D9F D)FHBDHhк?AH hC Fp2F)F Fy60B5#hn FA!d##!AA "FH)+H)o f gBp(y( ")F@F<H ")F8F5)F "0F0! #BF Fj! #:F Fb)?ۮ #2F FXꄀ?넀_넀넀넀넀넀 섀/섀R섀x섀섀섀섀#-Ah`FFF hF0 H) F1F(FF(Ѹ(F \d#ih/`#"(FAA H)_Bp(.(FAC!(FmF(턀H턀 pG pGFFF,Y(FmCh+h;p$9 i(H))#;p3p(FViF턀d#0hn#D$##"DA0d#pA, *%)%hn#D$-DA"#Apd#0hn#D$##"DAm0pGix8 pFnhC&d#"#FA#AFJ, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>1 (BF1F(F(۸@+7/O O4oг $$Bp("F1F, |"1F(FA1F H) $"1F(F2co$턀-MF:}, 6 F&?(`"1F(F(7x1F / '(F:F(׀:F1F 3yx!#rq "9"! 3yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/q/kѕ1+@##d`/h+hn"A!d##AA(F#A)(y(F x(&q, F(FO3c&gz 9Be۔H 0"F)B8F d/d0&`azp a 9BQ&O 9BQ0K#0KhB\#0 ,@4S@s@h#,9i8Fac1+.݀+hnA!d## "(F #AA( :}i66"1F@F61F F/! ([H)o `D`{h `z``a6`T 9 ; g#? LJ BД {iB11F(F ( ;iB"#ihS``#  C F:iB"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F+AF(F+AF(F["1F(F|"1F(Ft"1F(F7i2*a1FH)Jo4턀$z턀m@'9i "a pGFhhnA!Os#"zAA"!#(#h9%H( hazhA!nCA@AA H( hzhA!nCA@AH( O0IpF "!(F7@C h0hn&A!Os ##z2FAA!#ZH(Q hazhA!n MC)C hzhA!nC)C0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA\+hI0F zD4 CD@D0+ !F(hF8O CECFFOs !FSF(h F(h 9!F *h9 E&(h9;Ѵ E 3ЛF  D2l#sa# F%0$0F j hyOzuisBp(r=ѣi3H)ao #{+ 3x++ 8 @Bp#++O0 >-EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0F#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x)O0H(F:FFi(ۓ]pLF "! F``##p0)F[cp#0#q@060 F+ # #0+kG`p-MFFFF*c F|F =! /-Lz0#`4P]E(!i%HjC "` *""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ ! 8F  DD-MFFFF*c FF ! -Lz0#`4P]E(!i%HjC "`(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ ! g n8F  DDOshn#D$"#DAt-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)FsssDOs2F# h[( FZO0FchA0( hfzhF&#n&C0F@F FUA1CA@AOr& %( h9ո?azZ(Ox #:F1F h ( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz2lĵUSBCUSBS7} Q%0 H( 0FAhH( FO5E"K`pG(H(LH!h( h(̿  @B 7-AFFFL&!1+Eі"1;+@8"AF F'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fczzc{ z{!{)0K+02H(n1J1K1H(g +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!bK$9(F ( ?O# I#X RTRSQ-MFF'L (?hSrz0 "! FK##p01F[cp$#0#q60 F+ # #03kGFP?oH(O:0FB0+єL0:+єM0L BdH(k{+/sPF@`H'B .p\K@Ԙ0"+#ks B"I; OO "^0(Yb "!AH0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO ! "+H%##p01F[cp#060$H+ # #03kGx "H(-shO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@ -EF S, !FF(F8$ D F)0h'hn _A!Os#$?3zAA#"AMBؿFOȿ;F !$J(n#Os0I, }#rF(#FCrr1F(FF+030F( IFX(FF(7Eډ "h `pGopG-AFFFW OBoT >DF1F'K(< ,`o-MFFm(}){Ѓj+{h+VOFh T z#i FG'FW ?hBѣi+Cbh0H(+%jB,H(biJS + Q+F-hS GU ]F'(=kh 0H(o m#h[h 3`iGF(%j+hBU FhYF'(=ooP_愀-EFFF(7FT oB F88F' ` Fo V ?VF9F'(.F kjjb```j3b o-AF, FFFSF#`Ba aG`aab](F'`8 F$ F` #bcbFرFU ?hBѠhp Fm S d8Fa3F6ho8*(K\ pGN F! F@H(F F@Bp'zom"!=FFy|ZhhBQ`Dy`t` nh*" ` ) )h*xQ)" -LQ[(O(jQD`q1)  TXHDPLYy[)QD`qhQ`Dy"t0(~(љy19)T!cAcccAcAcccy2)0)ص~("`!F`" `" `" `|" `x" `t" `p"`(l"q f-AFhFFF{<8 +(#hBNE @F;h;;`H[#h;#`+x h + 0DN#h#3#`50 `(xkH>#h;#`)l/_-AFFi)Z )FR chT)K+BZKdPj+@m!h)fhHv2F)D `(D' "h1FH*D(  3F>+B #h;#`#h+"chTo #o+phBhB\#h3h+ #h;#`B>6 A2F)D(D'O"h1FtH*D(_  >ch;c`hAhBkJkH(J ch"h;Bc`خhAhB_H(7ch{sh)N] +'s\ *$bhR@Fc`2)D'&`&B@FV&B#'Bu q7>F h6 c6 ^#h;#`#h+ah)?U6J7H' Mch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` ,+'KS!`.#h3ahY1F(F&(F&!h``BjAj+I hBH3h`BĿ#`BJR#` N #h;#`JH' ch"h;Bc`mF:r,zlp{hBhB"T@i&chjFD#h)F`i(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D'#h1FT"h H*D'-#h3#`>? #h!T"hH*D'm-AFF FF&Q"F! Fj#%a#s`~F.D#hah+B yB eEѽYa`T"h!H*D'#h3#`m-A0F FFI hO0FJ`J`J`JH`J3+@+pB# `8FOb)F# F-0.0! /4'F(+x qOñ!+:hrK)FS"&e;h3+̿3FF;`gKhBiJ`h3` F:hdK`,FF6fF,(BAox&F8F ,F{Ʋ .# .ZS&ijjOjjjjjjjAjjjAjF..*.2E##7H#pP`#+pO02HF;!F(FF+x +ѧ!F(FF@3B I .#8F#pI ,DKD #3k3t3#` 0pl,zhv/_t)l"KFpt-MmFF F&#FF(-#oR&T#D#CBOOC ERD#[#E=F<pGpGFF08(o pG pGHpG F OWHOB1F@H%L(F$h 8F0P! ?F,F F8P"!F FhKHldH3dd `  `o !K HddpG P"!hFK I%# KhF K K K K ]Մ !!aKpF FHFx% %&! FNF F(Fp!F*FQ#4FsU&*-AF'AF4 8H& )F(7BO0'FH `!H8 =A H&\$ UR H&O"!hGFH&DL'yλ-E FFF'8F.!%]x@F%fF#'FO FBѺ*F@F!h%48 h%MB'F  4'FKJKIZCÿxm۶Fih H&!hH&`i H% ! G񄀦񄀱-M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``%(  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`e(ѸCF !2hH&v5"F1FX%88{ 5;kBX%H&` %7F FF , (O KOs H 0(OKhhOsF:-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F%8@F% F$5? U,F$ F5BU % PERF@FU%(ѧBJF$ Fo1-MhFIh %F `0F%%1FȿH̿F%m(FKxF , ,t5A+FK< , ,@- #B%0-VwJxK #vLvH*FaC)(s([и s=S%% @F%"F@1DBSDB{$t0 02U"pDc ``5S%x$+и #JK! Os (((G, , @XF%.SFFSYF"-?A K < 1E2BF۠ Աи  =S%$$, "vPFU7| H$FH$N%F ,X HH% 0F$'{M+ HHX =DH彩 xm۶8{愀8F F$( D<.+ 8IaF F!*F0] F08² *٣a*أWpGA*أ7pGO0pGFxBF`xC FF-M FFFxF0S+тF G `o XF0 Dz   6=QbhlrO F8 `@FC *DA #+`%D@FELCCBo 8O O `#O 8 `@F+`}B*8DDzO 8# `+`@FjAFD #O F#`O 88#O `8O O `B?spU8DDz5O iO;f8F F((Fo p 8 (]UL*4+ "#*4&7F (LH$;$P6--Ы+#-$473/$4o %434;Ho 43 4. o1H(-/MOc#T=/F&44B(Hw(Д(44 $S@+o b(Н06?HW(ѱ(4$˱ I 4[Bo 1DBܔ $۲BF ()$*+-EiL%#`#T(4*TCh(FF4TT T$T8T4T+T,YH  ")F%OzsXC(40+  C 64+@𐀄+4 4 IH7Bh! EWq?/ؿ#@Hؿ(4$8(4+  C 43404;,04BQ> '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O }򄀐_ 8-MFFFO pL)44+.+@O +404,%04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8Fp4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C 434F #)4-Д+4?|POo(4+  C 434 pG FL4;+        M#)4G(ڽ@H$ 0&KS HpGIK[FHDB pGAhB0 h pFz L J Kp@޿0FciGch3r Fp4B$ hpFJ K LB 0F!h$`hp4 h F$ F!(-E{F+SHEνh;)O)LJVLHE%z')K5) ) k)ܡH*CK@BHI^ 0})Ѕ) ;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,#6+y9ISBSA*x[*C d SF$ %" P#+yu0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`#PPIS0FAA;hD00:hSF Fx`1 9zj^F"#F]-MFi?#?@F FF FH$7F W$?#F"(*F=H$ Fa(!8H1bxsDF{` y(IE+$#y+I{h4Bј0*+Ѹ 0PFAAjYD-ZF F3FEѩ(a" BB+LL*D!x(Ѐ)IKj1FHcF$C-6( F*+Ѯ)IK 9F:nthFH$"#F FDFi F:i-MFiFo FFгrN"3F! F(3x+'*FahkH$O:"iIp#@/+FbheHq$O 0[0E 3F"YF F(3xk"XIYH#F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,#H)F  Fp@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#Os)mAzjV+#jF!]p#!F0ahH$ p H$% )F#H5$#)F F0# Ip" F M0#\.#2$*;#$0HpPi!FF@'2D?4$?@4 ?$?#F"!(F(JU#!Bsty*Z@@(3B 8FO0F`"!hF"iF F#M8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@Fwb{#{!FC#{(FCC{Cb"F @FSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PART-MF HF(|,zІi@1F'0f?6&?@6 ? +? "[F!(F(F_#FQF(F(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF Fjin"8F8 "9FPF#?h#"QFflQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F' @ F(Щi0F'I0HFA!J0KAAAaSF2F(FBPF3Q P0UC#R CCS CcT B"VBBWBbZCQFcY X0C#Z CC[ CcB  IGNOREMEs#F"F F( bi# FV:CXBXAp-EiFF!F[ F'C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`mJF ! #I,""I F#00@ @[H@"dP#H@FO 'zj6-Mi!FF[ &%D?4$?@4 O *? QF0F `6(FH#FH#EH#EH#P0hB7F FZ5(Д!0 $`H("0 FHH#0Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- K+. KK/ KkkBF)F{hH#n100 5B"203BB40BbC#6HCC7Cc#O!F H#K H#F~ ,=YlypF F$(h(,o FpQhB(hF((FpF>FP#z(F6F(F(*$!F0F !khJ#"IF(Fx"@K )4, *p#JR3@BHh3+Hd7FF$N(FV4"@KS4`s%(F4,}.OB&(h,<,3B FChFB Ѡi7B FG(jh7d7#-EFF `FFh,=,3B, oo(FhFBChCE(FȿDj,=$F%F)F0F P;z;4 8F5, F({+w FosF$!F(F P3{+!FH#0Fe4p7 FuF0)FH#P F07F FH# F)F[FЃ H#o F0((F++{+ohkhGo%pGFpGo8F F )F F8@h8Fhh F!F(F8@Y-AFF FFh,<,3Bo FhBChB@(FjF h@(]z ]F0!F@-EFFFF_#hF<0#i:F3FG0F FCF2F9FGBF i:FFt Fo%-AFF FF(#h<0k;F2F)F FFA`Go%-AF FF #hkhS2F)F FhAGo%oooݿsF FPoh,<,3B0Fp FhBChBFj,<(0 -M ?FFFFF,/RFAF,FX4F% h,<,3B FhFB BhE8Ft`\Fjڣ Fv193!;#A19!!9!?a4%%a`CargD``-AFJFF!ChT#"FرF F1F ;FiF0(FK F o n8FF(F+ F8 MdFB ЦhB#hB ѦiB&iBvDvEӤE A``!!`)hL`,`< J Sh3S`$h!iPiQ Jh3`~~-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0Foap FM dF(2F #aeaJhL``h2`~~-MFFO PP@&hDEѽkУhBhB#S``ij Fg0;04F6h~~p LFh FB#iB!O0#`%a#`c`p~"I#J`S`~8?0 ?!F@ F8!"F2(F)G(F8F8@ -M0FFFF#0xhF(@P! F(׀O24Ccc,bc `Ca <dcdabd[hZlCh[ldh) +h H (;ks cl Ccd9kz(`[hkIcl Ccdk(x a3hk3j[hlIcl CcdY(c`k4cc#d` FFh.:[hh+DѸGclC@cd(F FGF( FUF&#lkS``clc&dhZ`cl iS##aclՠhK#` FF3hj+ FGF(лi+ FG FGF(@o o o oo 4#$FhFFFFl_ O3(F#oO08F(MCl/Ԁi0%hj(,#j[hXk0bj"YlH`bikhPkj[hk0j#)lȱb#hiclCScdFpcl%(F8i+)lp(o  F al* FGF(osF(ZCl$ Fp" FF((F.hFPikl(FCkdFkl(F#kdF(kli3i(FFH" F(!(Fh[j+(FGF((FGF(ohpGhpGipGipG@jpGjpGpF&U4O<<<B0Fp FkD<1k) (, `#acaf```d hK`!aba`j FGF3k# h##`ci"iS``##aca F(F<`%o 8`o"o_o -AFFFVO,<,BohlB@(Fj}([hh] hpGFF$ FtF04,O4 F2F9Fh!B((h!ZB# F `N0R?B,;#`#h`jj2B,;` pG7 F F,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh!FPhh!BP FjopFFF F!3FF!F(Fp@ChFZlh hjhc#FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`op(T?,;,BlB3`j8F#FF#`FlO2"F(F8@Ҿo88FF!F%`F8#F`j"FF@#F`"FF@׿#F`"FF@ȿF##`"FF@ F!F@hF]۾# ` F0#h#@F F #h+oFh@sTJFH d0h;TnBi0;j,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGthR?,;,B]j0 p FFF)JFR?B! .رKF``a 3`B`` phBhBhooo 0)LFT?BohBhB i`0ho8F)JFRhBohB hB $#S```D` F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Flcl F! Fdcl F! FV FFi+#lkS``c dcl`h FGF((F8o-EFFO U4OT<BPF#hB FF8ahH"4Fk4F<$hFj;Sw! F#j[h[kC FIj! Fi{hRkj[hkC F:X! Fcl#Scds FF(VClI" y(@F"F(FN7.ho2l*;#aR3+4(Fsi۹i3l _KF0(F"kl #kd =#(FG(phj+(FGoopo-EFFF'ozT4PF(x"! F۲F(е + JR#SBSA! FB4O5Qo^N!Ac pGKh"iFH `F!FH 04h,8,3B, $ F}F HYhj pGFPh- F@^hkhGo%pGhkiGo%pGhk[iGo%pGhkiGo%pGhkiGFpGhkhGFpGhk[hGFpG8"F FljI#(F( (- hcH>o8chCCc`chCSc`ch\ICSc`lYIl(@VIlchC c`SIlchC c`OIlchC@c`LIlchCc`HIlchCsc`EIlchCsc`AIlchCc`>IlwchCc`:IlnchCcc`7IlechCcc`3Il\chCcc`0IlSchCcc`,IlJchCSc`)IlAchCCc`%Il8 `#J#IXchCc`r!Il)chC3c`Il (chCCch#Sc`'^p}"FMX0<ClxhF-A@ F#h FkF;j+2F)F FAGhXip@ F FF#hkh+2F)F Fp@Go%ppFFF(F7zFBДi0+ F1FF Fp$o{FFH ^0!FH OH 0 p!)]7H H %h,<,3B0 Fa00Q j,<FH $ HFFD1FH .Hh4jhLK4"(F+h(Fh9FBh Hv!F Hq$愀 8h3jmthFk FFC#OslJIH#*oIF'```O3cc#css;~3r #P1o%nzL#` -MFF@F@FF(O5(F AFH z(P0F)F"R8FF)F"NXДx0+ds;DjB+D@)F0H;:@O %Bch+) 2E(F!i:Do JC+ !#!O!#$#  F"F0H F 0xF(&# 0# FjF(Ozq FED(UF}O -MFFFFPFF8QFH z"( FoعFO #h F[iSE(SFDFBiB F1FBi#HL-:'8F-3-""!i oSC # F FH&- #0#  F HOzq FQ(o Ѿ1] pG pGpF F,2_ C_,2,_@ F,2_B z"Fp@ I HԺF,_ @(pP"F&h,q_G3_,1K 14om_,q$2_SB4 ' gfff-AFF(F/F(FhpL!Fa(F ($#i K#achAFCc`K8F`KJ`OscacjCcbAF8F JxcjCcb 2xcjCcbu0OF8F_OqF N bF"F(F8@νWh,!_"_,!("_"_("k@cF/F0F7F0F0K#`i`cj,0jc%j`=`hF(FCh1 S1_C_ 1F_,2_Cs_ ,2F,2_ch_B,0C,0h@2_,@Cc_@2 &&h(2_<"_. #`c""C`cC cB"_(2_<",1_c_,1,2_#p##C`#_,2,2_#C#CpSC_ ,2mF,_C,2_C_,2(2_Cs_(2Yh_J 4" CzCIHom 4zJ IHK#c#sCsCc]zIH\32Oh-MFFF F; + hF$2_@_O30202_KOa FOq F;3+LP0D{h Й O6O@6ZHF&HF-;++@Os`hF&Cs_2khFHF,0Zy;+v+thhSCwCJ3 8#CcOF@ #c+h:@OxC8CDgAkk C`##"10k?1!?D(h(2_C_(2,1_C_,1k_X2hhFYC?1!?Du&h/a:}K*}H*F_42h_ 2w;Ff_ bF0b_@Fz:kIlHom zcIdHOa FOq FO6h Bkk4WH 0A2xCGNK.0@տ_#02{h2п_a2_{a2_;a2_`,0[@խ;+>+<p+ohh]C@M%u- ]Cz8OzudF02_02_C_02 d0FJBIHX-khwh.hh]CF(OxO - /F0r_ ' z I HB3232P!P@/Oa F9Ժ02_C _02BF( 02_C_0202_C_02 "_F+vh/hh]CF(OxO -?g F0b_ zI.Oa Fz0?H02_C_02;FBF( 02_C _02՘S_ O0@P-MFmF Flhrhi7hB_ih*j*,!{ѿ_B _,!iC`hiBDhF,2_#_,2,2_#p##C`#_,2i)ZiHD!@3B(FF,2_#C#CC_ ,2F,_8QFWH!ta,2_C_,21,!_" _,!("_B_("_" _,!("_"@: z8I9H#}+?,2_#_,2j1BGh,"_"_,"{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppGF0 hkh]$`6F F!FGpo%-M0yF:hF8j,B+єh,<,BR;hCh,<,BTiF F`+H;+Kx+o Fqh'H.0FF#Hi5j,> H1F} JFHA#Cq"K5pHcl F-Cy FUjcl F Cy FHj q z pFF(FiFi(F,Y 0 i F#`p@Ob Fj a,Yp#` Kx 1 pG`pGhn_#C_fpGCh[h_Bh1 pGO3 `pGLP0-AFFFF4h_ c<@DE=O0 -!$ Fhh_# _h `hKOA0CFHD  Fh,##-1ѽ@˿ -AhF FNh hJ[SCHi@F@0o'n6@@ Cf+h!hXh?X``(m!?D(m竪FF#00Ch F;+  0 ~SChC` F?!DF!? FF1"F N#F@OT4@BAa 2+D*)FHO0 5 h_#_"@;OAK0Hom 砆^ h_C_OB@;FK0HcomOzp 砆 pChF^h_hh_(%0_hO@A`h"K0 Hp@{B%1_ORhF`hOS0(phZh_B_h0 DZ`砆 I@1-MF, FF1FF@FBڐIH$ F +ѵO F(`#VSC@ F`(f``;D aF@ `a(T!h!`i on2@"HB?FiC?1!?FDh?1!?D`iD$1+=F#i `hCE? i(Fqh(`ih Fs`!QC8B O   `@ciL!0@F1F 3) O@T9 L .@ 0.KpaA@@CF0S9)FYF@F&!pP Y`)AqpCA`I P@a P@Xa @P@a @@ aP2D;O hC(?Rj$13$1O @FFF-EFFhFx$1;$1zpO4 h'BAF3i@FhA; $1+ ݨhFE HO4pih0F FF+ -A FFF"!F(F`F@ ~,A3Ozs1F(F%F$mB HFomE 1F, ( FO0oX FF, l-MF , #? FF+H+!! H0;#CF@ F8HO0 `"!PFL!(FGo n9F3@C0 0XF+$$d {KO8"CO(CphCCc,!CC CCB *WPBBBAC30OC$0QFXFHD+D2@#@H H[  {s 0 BoBFF!PKA @FC CAqAHaDH "CK"(FH,`l``0?HB(FGF+P F C@ 4D@+H{"jP)IZ`'J F4`0J3d3Fz FPF s(F+DFlh[h_?_hS`hh_&C _h`OBhF K0W0 H|    +A8Ozxd< =PF 9(F5h @EӀ' @3dhh_C@_h` "hBsF0?F4Hth[h_տ_ "hZ`#c+ ?D!?#HQ0F( #&@+2 + +/K@"# #P+# !@n"@ Cf9D (Fq OO0 @## FF,F$սO0pG-MF , F+(h#B@Ɓ#0, sx7xFG'B3z"BУ/ F<1 1GF0O0JoW%HBE@#BYB3Bطoo#9#9@#3B)h_!*xxB"*ڀ**@B!~q!  B@CS_o+`oEУ/RР/#'0 xxC# *"*)*ѡL OzpyyE%]E]FB=F4-*F!F Y L' 4D|۲+؍JR#@JVx)+~L'xxxC#`'Id>H>JQ;+ h_C3C_`2B B_ "+K1F,#:F(FFOf@Fzo.u%IB"B"p"BBh[h*B@2+C@#IB"B"|BBh*B@2Zhh*B@"+C@ H @JO JL J@ JpPpP-MFFFF): x+7FqYFF x F ?)F"x3**F0F?FK]=+a5)DdbBE(BF8FDEGD2FAFH FO4FFF F@=F FI F0pF$F0 F!FHXB@IF#J @h  "|1( F |7 FF(B(F0 F!F #xbxCxCxC#yCcyC8  0 FFPI*FI F0o(8FF)FHT F8,8 FF(*F8@! F8wXx1( Y(РTXBXAO0 HCXBXANF | #H( |XB FF cH #DdA "IH8PKHh@6 B  BB XXB#ᄀ#BbBIA "H]XBpFF"f1F JYBH!o)p$#F1FJHF80 FC0 K HhH)Fvo#$OF"F!F HB K Hha :F1F F(` F#g℀$H6𮸆-MDFFFx$+jCx{+-6%E#+F,FP)F0F.KFPhZ;B"!FPF%K|-6#J$0 F+76DCE4C{8FI78Fh I8D3F J K4F`$չ1)  pGF8IK[HDB AhB08P8p&O51F F0%uo,P#ah( @B!h H|hGF0Hu,` Fp*4ѵ?5F6~X ,F@hHXh2HSo F#`h(@ BHGF FH?H; (~X'o&9F uFXOJF "$ FkiGF8kh( C(0kh( C(0$07+ooXB-M}FFF+ # *F-IhF iF(FF*(D23FXF  YFF{h(FN`hFPF0``QFh0F0F`H1F FwF`he`o FoHo6;-MFFF(NO ,!(FF`(Fȳ0vF o (F)FF:! FF F FFر)FBFXFGF F IF(ZF)F$ $ Fu.5F%0Fʱ# IFX{(Fhe F0ooy,p@ x0,LxX,1 N D F%x1u]@DЋBF`pPF `pG FHI>"IHS" FIN .Q/V8FXM!x(F@8!xH \8F( Max(F@8axH \8F(FKS C8 #0J Fc,"` 0 F( F`7F%#!F QBТB"x0*bxX*-x:*O0*5- 0-A%XF0hOPP+H\P8`8h@1FH@1F(N(p`V-MF FFZK/h,F.h3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FHf h9FHZ8F7 KYF(FFH"FO!FXFd(?|hw9FHF:\A^{F `pG J KF &LB8FT636ء8ء FHIj"IH" FIz 2y2#J F,"`  F( F(BhOhFOr!hF;hN+H#0`;`#0h`8jF)FH8AjF)Fz(hF(hFp(Ch`HpG L#h I KF#`X#hx:+K#`"hxDp h#-E=F4%?F@FFй#9F0FU F`;FRF1FH9$ F =5O2#=#AF"#H50SF2FIH #-A=}F~2Fw F!I'?O)F Fc V FhA`+F2F!FH!FoO29F HG(3F"F I HObAF8F =20O0pGO0pG pGO0pGpGo pGFHhBDlDBFFO0pGO0pGO0pG-MFnFiFpFGF0Bx ڤ`Z ТE{TFh P"F9FNBHZo(FfVO0pGO0pGO0pGKhpG#-AFJK'L<#h B#z[h IG8 K"h` K`?DO0XTFJFhO=`Mh I8hGXF K*h` K` FI4,DO4XTL h/CjG##`KFh"i FGF FKFhCi FGF F8KFh F)Fi FGF F8-EF KFh FF ggRFCF)Fi FGF F-MFKFh F!F SF(FG #BBE)FHZO4z F7KFh$j(FGFc- FKmB`0Kh`KhC`#XTF Khtk FGF9, KdB`#FpKhUCk FG@FXKh@B!FQ;+H6(FF((F2F9F H F + H7#H&7F#KFhk FGF FKFhk FGF Fp KFhF1Fl(FG2F)FHO4 Fp*7FhXh-F$ F0iFh(HuO4\-MF+FO4 F*!hhhF ]H<$/h  hFBx+//ѠFF"F!OHWh!FFLHOF(EJHVOF!Fhi/FF!FiF ?KhOi1F#PF`Fp 1FPFGF+ QF+HOFBF/hh8/h8*i 3F #!HH AF  L Ozs JbHH1FH H>I FJ np.J_y7؄V愀T݄\F:8F+F* !h`h`- hH8 8O0 SFF F@} -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF 1*F1FF@F#tFPF".F#HͱH8)FOzs J H! H%FO4|y7؄V愀pF+F"hhhwF Kh .Ahh FpHO4$p]*F hXhQHh8 O0 *FhXh;8h hHt O0*F hXh!P!ih8 O0 pH&$ M> H H p+hC, :!,!jhH84D5ʄ愀ʄFFF1FFر#F F"#vF((Fc F#BBѨU=`o oHpG`JhrBЈBBpG7%L#!hqn( H !hq 0)F+F*F!hq iFh@ ]` F`h PO0 KFh(h0" O0 "!Fh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRFM(#` Z`l 9F/9F*F  ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9F[FRF(?@ FF#D3 [FRF(?("!BFO4`0F Hhh HhP EE0O0-E FFFF(QF H0O0X2F F+FphFFF+ChBуhB F)F@ F `@*F!0FI Fo pf`` 炊jpGFhXpG`X1pGF@*@pGF@)OhjFpGF@)O@hSjFpGF@)OhjFpG8F F\DCB08-MFFFFF@li ?#?@3  ( & CC'K@h Fб+F;`cCvE>hAHt#HoHl7F < ?&?"!F3FZFQF3F"!Fhl"SF!F"!F3FwZFQF0F!5KFL($hi 4@ ,  @\IJB#CT C#:D xB C p@BXCBDZ#@۲O0FL($hi 4@ , @\B#TC#:D xBC p@BXCBDZ#@۲KhjF(O ;D# x CO0 ppGD#@BXBB:@۲KhjF(O;D# xBC ppGD#@BXBB:@۲sFAjFKnЃj"h1OpU" ")FF * : FFp-MKh VhF)F@ *F!Fh@ )F*F!.+𱀣+ƀ#k3#cQF kFoEiB𚀣j!Fw8F1(@𪀻o 5%c3E?O3#c  iByңj!FU(F((FFjhS'hjR'  * $jS'QF#O xF*мo3@O B phzC#c3@*ѪC!;@* `jhX!;A5*D`X! i3Fh(AF0F({0FO0y!F)?n  DQFFe{8FFjZFS%h # jYX*F k F%k-0B i3Fhz(AF0F(P@*C;@* #`jhX:C5)D`X0FZW k-MKhjhF)F@ *F!FGh@ )F*F!F=/.cj[n@0++k0cljFU!F(FFУh2F + k1FhS(UkBFS(kF(0CE i;F h(̀8Fih(@ŀ@*C;ꁡ@) bji;a8F0Fk(2BCO3ciE𓀢j@* UC+!F(Fn Уh+  2Fyk1FhS*kS*!>K"[FFЃhFBx^FO @ Z 3c@03@0@*C;끢@* k@*jC;@* kbji!;a i;FhCh08F3(?S8F0F O0PO    FO FH-M F$  B@F,𑀆h@ 1FVF2F!-<ѵHzF{F,?FwѮHj&0FhF,F3@HVhSD`AќHMDE0FFZFQCSDD@#F(Шi p 0 9FF(AF FojF0FFQFQFD0F FOCxi 0"9F c8 K FFho@B-ML#hFiF 3FBli*j^Ն^ #h$O i(5 3@+FO 23 B.O2mF2B XE*! 1Ih"F@F@PFuhBhEF!D@F$ H@FoE ڭh@F (D2  U+$@F,OkN ZE]ۺ)!F@ FF"F!`HgO0O2]K`]K`pm0@B0SF"F!0VHL0BPFO1#NJ@ `!F3`0 #F"FFFH@m@03h K S+w 1YE ̀%!F@ F"FQFf1HO2+K`+K`m0@B."F!3h6 'H0BPF4O1#J@ `!F3`0#F"FF.@m@0LP-D!F@ F"F!P͹ HDCpO2K`K`AFF[ @0B0+F"F! H 0B(FO1#J@ `!F003#F"FFP-@3hS(0@00S"H3%!F@ F"FQFтHO2K`K`(n0@B."F!3h` zHܱ0BPF^O1#rJ@ `!F3`0#F"FFX@+n@0fM-!F@ F"FQF=]HlO2SK`SK`3hOV(x0F F-?ɮ(F%FEo S-MOBK h iRh 3"E"AFO78FhF)F@ F*F!T,S8i#F!hCh4HO7 F8{%.FF+٢YByFB!عY/H F0(Ѻк0D0 Fm(hDBٲHo L hH#J#``O2K`L hH#J#``O2 K` L hH# J#``O2 K`8 M L(h8!h)qS#+` h##`8@-M{`0FF`+@h(x +rЭ   (FCF (+ی!@ F"AFa +h#`i {+H+FZHNh+D%(h"D F2 G#0pHOCи OrШCH7H70Ki(h"(#0&и-H"-H O +FOh+{h+1FXF {hh` 7F.HZFhH FлDhSETO"##(FRFCF@E@+>1F H]6.O,%{3-M FF``# #0F4uB1F(F(FF;/+лO /!(FUF0FF 3/*6+ !F0Fh` UF)F0F 7F;i+@@Jh3+`!F@F0+A @ 2Fz`F!zh7-=%!F@F-+x/+0F!F*Khv1F(FqF(F !F0FК0+{ih`;ih`( ;* (F,x0+"#@F(2C(F7F#% K` 0(,(  ,(#N F1h O;`q#03 h0<` h"(1h Fq/O0p!OaF@ FOb!ql FkNNSs"Bl#` #X0`#nմ0!#r F|Ax!L4`p F8#3` p FFKEd"h`Kh`chECli  @% CC@EpFF FFgI+F"F h@lpFElO`iObi#Fp@BؿcOcBjF!O`'i=B&i5B(Ӡh#jiCCj;#J`J`)F FhF(F!F0FwhjR% a)F FP!FphkR% q#"p3hiMUKB@F(F)F b@ F*F!ybֱ!j%ihiJChC3F!WFj-\bO0p0(Ho <phF1F@ F2F!G5KjFh!B"hFFF i+F!hpC#ah*F(F%`j bjO`n!#fbjOc`jjebk{j#b@0c#c pP%jC%`5ijB#b.FP%kC%`5ikB#c%.F-EqNw3hFi# 2@Bl`iOa@a@ 5FOb!eb-Ā(Fȱ_F3hZiXhjhao##a0VH;CO5;i@ 9FF:F)Fb..FiB,'iB>ض1F@ F2F!vc/&iBB&iBU&7FiBf`j#BB:F`j(F@ AF,FBF!JJ&pjS&0+69F F!Fj&i!pCS'0h(7@ AF8FBF!J&pkS&0+?|61F F!Fk'i!xCS&0h(?f61F F!F6Do U-M@M} +hF #?FOrF! ++ @@ !F<F"F/L!'`//P+HZO3 }$0[nX$H" 0FF3 !h%(@#hjS H, F3% +'rF  X$0hSEH+hjjhF1F@ 2F L+2F(hD(h(F2 C X0 X pC O<- # `&GћKh hFF@ F1F/@׀HKhjhF1F@ p2F!+@HKhjhF1F@ X2F!+@zHzyO B@FFF Fq!FFF:PFF)F)FDPFhh@ FF!- i+F!xCh(V9F(FF(Oh 9F(F(DѣkBFS(s@*OC3󁢊@* bji3ahd!F0F.'i!xChC!F0F!Fap^VnF(.H(F0-O4XBAFPF&hFoFj2FS&PF1F(F@*dC3@* jjh3`0B)FF(i;F!h0AF8F`8F-+𸀯h@ 9FI:F!+?ٮO-(i!pCh hP@FoFF1F(FZFj2F@FS&E 0@*, C3 0@* ,0jjh3`0B)FPFIF(i!xChh09F`fc{(`oFF1F(FFj2FS&Z @*C3@* jjh3`}KhB8F)FF(i!xCh(9F=(qK``..0h@ 1F2F!+?3.(i!pCh#E.8FoFFj2FS&8F1F(F@*<C3@* jjh3`0B})FF(i!xCh(o9F(i`f0+QF@ "FRF!.X/i3F!xChO hW0FX8FhFoFj2FS&8F!1F(F*@*C3@* jjh3`KhBw)F)F!h`(i!xChC(9Fe(]&A0F>;k崀V*0+F0o BjFQ"(F@*C3@* jjh3`KhB)FF(i!xCh(9F (ѨK`  TK`3"=UhFoEj*FS%0Fq)F Fz@*C3@* bjh3`;hB!FzF i!pCh1Fȹ=`3(F#4000@0<0,? %,F%Lo <+F ' AF @ AFFBF!o,c` +@΀J#/@ O#*FQF Fc T*h0@ SC[ ap9FF:FAF?-JO0F;h>jzFXFYFFj0F F h 0F 0pCAF+F (F(O!F  R(F\(ACli;hi 3 CE(CF h XD& FO3 B?3  @C' A  3@ HYa F L h(F##`($9H#3 " F&  5J Z(EјF D DhD3CF  @C' A DJCDGF3  @C' A 'O89KhjrFXFYFF8@FjF ^ D@F B >! (F!+FpC 1F(F (= ?1F(FI(/& F4`0`@`<`(F`RFJh;`"pCV HQO0p#*F8HF"##V7]p FFv)FF# Fp@-$F OWkqhK ЫhO|2h 4dd,M$.FV;Zh2N$7FW;Zh2$V N4U Id,# J` J`" K`h4:d,h43d,h!#""-MF&FlO "j3B ;hhX#0F@ F! 6;hX#0hh)FhOhD;hZ:`X#0Z`o h!#-MF FFFIHoJd#FRIhHСB#;+Mh+hF@ X#7F!+hX#0hXh1F+hZX#0*`\` o OPyh!#-MFF@FEIH6oL`#hX#0sh@ F#FF{#hX#0hXh)F#h ZX#0"`_`o Oy"-EFF'HE!@ F"!G H&&`f`@ QFFRF1F6%`9F (F~ Jh+ K Ih ```T``##8 M,hD(hX" K(``K`8 hdhDh F##p KhO0phhBh"B[hX6B2 #-MvhF1F@ >2F!F@ AF3BF!FE(F0F".%K!h"?'i+F!xChO phB  XF30;h "'i3F!hxC[h2FVը#( HH-MFCjF_ngoцh@ 1FF2F9F@u@ QFFRF9F4>(F$o "hK!h':F9F9F'i+FxChcjnY<ո\HiKO Fkjoi\Cskb;"F!h0F i3FGC!h8Fqhih^ѓB?@F (F0F ?HrOsai3a`jbj!nO`CfbjOc`j"FLh*FD #aE@h2X FSO ѓB32aѺXFO oo ѓBѸ0F 3`B?^wO0, -M#\Jp`\JF`[Jd%`"GFZLh#`ZK`!@ F"!4HO0!@ F"!!"X<`O3XK` `Z+S`_LQF@ tFRF)Fвh#hF@ W#cF)F#hW#0h+CF)Fh(FObqj'#hhW#0AFh#h@FZW#0"`]` m( h8 @B#hQF@ W#$FRF)F#hW#0h(?uObqj#hZ"`"W#0Z`#h!#"#"-MȰ'CjFmXiO!w9h"K;`hF!F@ F"F!`=!(["(F4ih+F!`C7OsgK@ iAFFBF!;D(F+d$^MU+9hRhK2^9h"K;`FhF9F@ F:F!,[PHHO " FZHK S+Rh2Os`"XFK`Ed  :K8S(0"[h `OcK`.h"F(F F";`d0U,ah<ьK!h("(FJ7ih#F!xCOsK@ iAFFBF! Fz "8Fh:Fr Fu8F";9h!%LDx B\B;P0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB F##pF JFh FX Jh1 LJ$h&DB HO0p*F-(###K{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5Hd +ч FGCF+hS$+h3)KB# FYCF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGGCGF>-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(Fk DdB FT*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(F6F*KFhFFO4 Fi@ ?1!?DF(F! (O4(F@")F F ㊻ #@!F"3`8F3h4 +O!F Hl$dB#$4 Ha #$3`"!FHW(##Xaj-E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H%H?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @B b @D#a#s-M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`({hFO0 FDBF*FFF0FPEѸ0DCCDF !?#?F3F ?(?@F"F)F@FBF!0FX(FFF8hhŊTiiCrDh , kCi!Dy Ho8jdB(,FicC)D8iF "!(FL#+pi# F8@ɿ 8`aK>@ p`E PaS`F`Fr#a#b F "IFk(F8(O0+\.+oOT)F0F0FOq F,!F(-AFF%NO., ,!F Hx# Ԥa+@5B(F_$O-EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(Fd"8(DB5`x +.+)S-MChF+FFS + +\н#@FYCTF FiBOh B(F8 D0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDRDCDF焊@FFDCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch +1+@4OsEOs[EYF Fch +OS SC-F:FO KMLN 2B ahr8 )0Op@|)`FE-QF F:chF +!Or@q+ FREٺ@P ++OsOcSE@EFG(F*F3F )KOp@u)(FE  [b2 FFHBA3QF F BF*ch +Or@q+ FZEٻ ++OsOc[E@FEHJK 2B Aƀ  a c B x8 8, cCsЦO;h+ኢi#VOs @B u;e-@Ȁ0F~@ #DYC:F83B`E^DecD5CwM*h㊘BK2F9F(hI*h㊘B>D QhhB ` Q` CBubh *Os@q* FE &5F;O1@ )8`(UMHOO0  cBs FV⊐B:F0D ^⊐BcVDD+O7+K9Fh(Kh<CB eDDEsAOCFK~QF FkbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOu # cuL1%)F F'(5ch ++ ]-:㊦if3DcKhB+aHq QF Fbh *Os@q* FB?QF F)FFQF FEFRK&iFFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@s#+i?3#?@3 N ?x"0`$?HE"F! (#O53`(FF"IpF(" I6v("IRn(##GiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Fd(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@FY#41CFF+#{@F#z.#>F;"0F9#{!0Fn#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF+2FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0FX8o EF;/+\+ci *$I0F!ȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FP<1SEBFQF0F}(iz!F F :2pF Fv F@(F< ix p<1B1F(Fv(-MFO F }Q 2OC[PB_&lF5FO "! F#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "ii= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFF F)o F  " !(F.! F#x .+$A"(F0F +"_#0;I+FRF{!F(f!Fo(ROBF A"@F!F+# ݸ  2$IO EFF 0 +ZDI+F38Fyhm(8FX|+F I Fz L0 ")F0Fj$JTmON-MAhF:F(o0FFziox *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(FfFZFPF1 F(BF(Fjh *JAF(F(F0##aO[;a*Or *@r F(ЅL#h3H$ FhFH#hHYh h F H  "$ & H@+@j#Xk{0IF@ 'FiF*)F" F F F@ 0o@FF@ IFxiF8o(Fy F "9F(FFliF(F("9F(FF"##Xii0o @-MTFI@ FF(K(@A"AF(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?FKFXO3!F(FgKgH^ * *OrObBUBFF!FL0XH?XFh  j XF1J1U!FD(F ++OsOcBҢFEv+F!F2[H2/KQFxCE[F!Fб)H(~ ++OsOcBr CFK2 Br2 [DQFh@(FQ + +OsOcBE FKo*o )@#"#]FF@ IIF!Jw8FqD)F"8F:F8 F4`(Foo pFp FK(6Or!0F1zaىL1dيD1!X@ xDoJhBHpGBh pGp-EFO TPEE #%S` F`%`e`(F.FVhB-hhB #S``8F?h甁KhB`KKh@ pG##Kh8`Kh@ pG#-AMO F"F6hiBbh6hiBXhhp```Y`Fh J#p(`#FjF#F {L FF/sH``KZhX``B``pG!F ` H -M,FFFF *KBL ذ(G&L?s+ sO KB@O и/K@/@!*Fй@"F O2+bO3 #KgZh]`+`j``0 F  `psFFF@#B KB*F F3FFFpJ`sFFF*F# F3FeFFp-A'FNX4hBѽA0#i+ Bw ӣk+ +#c F &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBHsFFF0*F F3FF>FpF FF$/L F!0F)`!`F(FW/B F3$!`h*F  F hB*hQh4-EFFrFF+H"8Fv(KB$! }F"1F0 a#bh|`5%`c``PEEO1FHB 0F ;F ! QP#S`` ``` F H`+j(b#`h4(LR F)h(FD!F" F!,ѠF'FBظ'+hCD+`IS'ȹiF{EF҃EF(h@аFS'007L-MFFFF*@.# `#FF[/ ZEѱ+80HhiBѼІB+H C@hC iE2`! [(<+j(bC``0hz3``.) ,+#iE"i* "hhkF)#$hhBhREiBhi0H -AF FF[F,JkF,,,,(FKBJ ,0,@F(8F(EE:FCF1F<F-MF@FFF(1FF(𦀏 F(F9F'F3S/O '7FO E%/+"rFR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i =1F#*FhF!F F?hJ-MFFFFF0BQFAF(FFp" F#(FN!L FF[hXE"0BAF(FzF(iB%#S```D`/ѪhB(FiQ)* J```D`FhLF4FThBѲhB Mi#0F1~F9F?hM1FH(F0FK%F -MO FF @!FFF@4! F0 FCM(F#aOS#`K`]RFQF(F"YF`(FF*F0FITFX"F0F IMF @>`MH0F F { -MF#F ++(i+-@)F*F|IFF(xF0wL F =F(a@x E BR!(S 8F{i GF\  E BR7( h8FG,  "F(@;F2FAFhFe@r#C @F!BRDKBwDK`{`FFAL*F8F@I `BF8F+KB$@r!FO;K[ZF0F @ BF@PFGF$ ZFJ#8Fh;,,(f LFbL!-?whW#8F` #F FN0hB@q 2[O3B(jCR!T F@!FRBhF\?cE hhBh"Fh1稁8FF#*F FFF8-AF(F&ULԱ" FIU  F7FzIx+L F"CF!F8FF5c,6>FRZhl8hOLQ ]pGQK2 FFCF@pG𵅰 FF8%T !T|T,;#0F49F5=FRZhF"-HFQ ]pGQK FFF@pGFFF"F#(FFF:F1F(FFH"F#!F(F F02KhF F1(+IF0i*k+%I#$IF})abaPbFhKhhK`z KM`#aq)FjGFQgk"Fo#FGFF##0F3(FFD##I(FF !#i++I/F0k{'(FkGF ) F#!I#O>Kh]#-AFFF##F F&IqF%#i++ M F(FKhBѧ#ji`&!1F "j(#j2FAFhiej` + F](F!0H##b# 8OqJ F J KD Jh MBb Jb 2bbc H(F F8T#Ȁxp#"IH.p !0J 02F I >F pF2F(F!FNDoFFQa!!F@i`a" FIFF60 /١A+ء72*# (` EshF F hF KB ;B  hH `+`2F!hpH 0$B 0PB` 04HD"K`a  Kpi#8F44 Z(` 8B  F~, l!h!H Ku  -AFO FF~hc #sC JIhBXBa Hj F8Bh$#S```D`؁F FFF ܱձϱƱ! FKgaZh\`#`b``4`$ FLL؁ p FFF KhB Hp #cC Hh*X3`% #Ch+`  KOBZ`pG JOBAHB HZ`ZhBZ` pG)ZhB#a;(F~(Z%FF& '9, /,0F-(F F%;,DF0<FF&M+x3Kh@3(\(WL?`` r?#++K+؉Jch@CCc` ,Bpa(݀O([(*(Ӏ{Kc`F(O(08\E8(&chCCc`#oOf>h +pB@+x+1+R#ׂI؂s؂ւ{؂؂ււււււււււE؂E؂E؂E؂ւ7؂ւ3؂,H(:0(s1+?nR#;؂;؂;؂;؂;؂A؂A؂A؂A؂ւււււււE؂E؂E؂E؂ւ7؂ւ3؂~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3XsiHG;6h2### ؁8F F% M+x F$" I\K,ph<@' F8LL##@ pF F-@,> MPz)xA F "L FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@L##/@𵅰(51H#+.P%$&,HO-*K1,"!Za(J`h*ZhBhBZi*iBhB"b"aaK`"Z`&F([+ 'F(;+,$R+ 0; +U$ 3E$0,E ! $KMNJIHK#F!OpJF(H FphM`!FJHFH2"#!(h/F( H#ق !#9ق5!^!-MF FF (HFW$sh0FGFBpEн0+ #<%0+F H4 + %+н *+*o 3B 0 H%0+F4G(кH!!!8F$E+h3(F(((Эi4H(i(B(F4i%4i+j[h[hB+H+44F8-MFFFjF1F8F(;:z*O_O.OLO`O+,""p"bp"pBr"#tbt-Bqp r!sassstt!uauuu4 FO"pObpO*q@r #t`t-@rpp !sassstt!uauuu;z+##(0n+ +"(F)*4"(F)0"(Fl")F)0(1FH'!pF F)a h+^FFX FiB.F!.Q(.3##p#cp#p#"pVI #&ucuC6uulH..Ѩi(@(F$9#q##p#"cp#ppcqD(F##p #!cp%#F&pp "0F&"0F)q#%4< FpifB(H((F/##p@h(QCh+##cp#p#pl4<(F##p#cp#p#"pz4<,,<##p#cp#p#F"pI #"+h"u"u#buukh"#vbvBvv4(F ##pF`x* ЂxxB"\D+ pG pGx+Cx++Cx++@x+F( F px$+ЃxxC#D( FF-MFFO FF@\E-? FIH$h9F F(i*FF(FF}BF(=F@FBEFDF+`稁pFF"FF8#F1F(Fp@"p8Fx*Zx*pGxxB"DpF,(FUF4F Fp*F!F4-E F&&F8!HEܿF)F(FF 0D+F"FQF 4D F"I4:F)F F"I0FO""F F)H@xxF&0F@2F!F"I(FwFxx@ 00DF(2F9Fxx!FC"xx"@ 0DI(DO*pF FF F p$ pEppp -AF F AFG5F(FF 0F=F(FAF"x#*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F3"Ixx.C#*0FIDEF0F/I=-BD0FIby#yIC#yCCyCbD#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (F!S+-)++x+++++|++3+++++++"++"yymIC#cy"y(Frayyy"yC#B"eI"dI2cK cz"za{B"zzBB#{&|C#{BbCC{(FCcVICb|.*0 ,QIQI0F3|D* R,KIKI0F$5Wcy"yHIw$0GI+4' './D0F/3I BDє$ >Izyayy"yfzC#$zB"(F7I&yy"y`y!zdzC#A!B"/Im"(F+I.%*J*O#D0Fz(I5-:FDxx$IG'{D(FJ#9D(FI!"a"ĪV"&"7"E"O#LQ"_"["vc"r"L"w"""F:qԄ""'rIsH#y*FqIF!S+ՀU"0"*)0+g+!y`yyy*gA!AAAb(0XI"AFcy"yB"yyBBMIBb(F SA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*Ixx.C#*?0F$IDEF0F/I=-BDxx A!9FHxx!B":p3F@(FJD0F !3jh" #"")#A#a"Ī='!pFmhF/%,&s bB#x+cx+ #phFF F mpkxxC#D!F[F}XF(W%e F F%=FXF[n0F 1FB(Fx.+0F1FB(F.FCEF)/*(F)FB0F  XF l( F "#XF# ~%#XFI#e`###F:8F(lph$d(F F8$8Fl FH8)Fh(-AFFFF"8F/I5(Xh/!8FGQ,H2BOAA2mH0R ۲BL FPO1@F0FAFO29F F FI FE0FF`BBLLLL p FFFHA:m;m& hlAHp+h1F0h#.(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpFT@FOEFH @<RE-=5B  0F^F"h< X-EFFF3+'H\@<SEH"AF FXc|"|B"3B2p Hh8Fe(FXpF%iBp#S```E`pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! qF(׀"!F0ia#`Ocz%z'GE%z'DEEzEe%DB:! JF(AF Cha(_Д,0- .C#+ `(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1F@5=F0+++ji FjB+jiR+ O1F# @   O 2Lhhi (F V*L*L ;P+'L FHO`@```by#y C#Esj ubC B* (F8(F(FLRFYF0%h J`;`x``PhS````#  XpF F )FFF0F 8(];((  p FFF F H;h# HT_BH0Fh(-h -EFFF w0F $HhBظ|HFZ_UE8FhxhB+iB٧9FhiKFaH*ihi?!8D4na@F`F(kiD -h -AFFF F0 HT_B@Fh+iBjiC;R#P-(F3hFB0`HF)F4` -h-E FFF{ F H+h#HF&XE+hB .`uH .6D%i;&=65OC FpqF(mB$O4 Fs<4@A t@87+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFF#(F"F;F1FF#h#`(FFFFF,#"F1F;F(FF FLpF FF2F)F FF Fp FFFF &L F!F3F*F8FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H|F Fp H #D EE2ELE1%-AMFF$FO20F)hX"8Fih ( #h4,  (-AOFFBFFFKB(hFh+FBF9F0F( F#+`$ FDF8M,h4+hiDBch[  3+*"h2D# F8@0 "! F M!FO2(`"+ha!#FE@ JHF@F!J H>F F0UbEfiVa`L#h3 H H#z ! Jch h"(HxX%pq%#-M`O1 F(qFDF'; EJ٫:F 0F["F R1F)JFB0@(FF0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 𵋰"kF :F LH 0v"#)Fv H(#BB(Fl F %%-E2CFF0H /H.I.KBB"i)F :fiB#iDB  O18F4FF+hS "9FPF##QF28F9FH  QF8F@"PF I kh+h3D&%UbEfiVa%5O1 F(H HO2#!F#H"#F(#*s H n F iBBH FQ(=' %%%-MFD0FFF GL F*)л+S**#*"9FPF @F$@ѻиv QF8F]FUsih)3)L&& !- 2K,++hBFQF8FF"[FLLNih1CЍAE .(Fu,z?vxrpFF++(#J##J# FpLLJKFcKScKcKd~x/0@7H \#FFF@Ծ&FKh)K#!"##K!#JHdFH / F##3&  8oo(F F8@]-MFFv! FF(1F(F/zF(nXFRIF(h#F#F`F(]AFPF g@F{h;;lBK#" fg;K"o$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUpEs-AF FF8#x/+6BF/! F f(FF!F8FF88F(DFFBBРF04/+/!@F D(F4F)FBF8FL(F%o8FF F =!FF(F8@-MFFFFۻoF$%F&F{TE;2F=I]/):BۚBȿ"DB!F@FF(Ы[Exh/"6]TTE B"-ȿ5zU!F@Fkao#"Fo -AF FFF=,O8@F!o BoBFB3`B8F3J Fo "(]o pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FB"!FosiFF%B(Fp F1 }0DB5oFKF0 +`$ FDB-O3 F1 WC#DB-o-(`F?-A#)F Fo FF(shB0F('F%F0FAF+C' (o 8(<S SAsAA@AAAAIA-o 5"-AF0Fx++睱= kFAF0F(Fo o  [@*B*F D#Fpo-AFFFF B(F u"F9F*F0FF Fo#F CF FF(  K@BS K(FpGHpGHpGHpGt!'''i'+لhD$Bh"DB jBh XB   8F(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(F CO S#ah2F )D6? 7`fbh*j )D ,`+j#b-M(FFF [@Fh l6!j&DBFF 0FJF&-Jۡh QD!D#" F 3FPV@F H#j;#bFkh%j -)D F!D8F("jD"bpFAF&O@q0-`0?`0_`RF*F-MF FFFع(F.i"F6#(F#FXQ#?O` F-AFFiF(FB 6#F(F)DA"O4 F-AFFFF`BF9F0FjF-CЈ0F#" ($l` 3 `BF#F9F0FF3FF(&2F)F FpsF FF_)F2F F"F9"# F 2p-MF FFFC(;CFRF)F FR(6C1)F F^ FYFW8(٥h-]Df'"1F FtOscQ4F:F FFBFQF FOsXF>Ds`opFFFF "FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FFU/0Fsi +O tj$"FYF0F:F)F0FFOSka?kbo` #0F (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(F 4K?+`OSkaOSo`ai$a 8F_F F3cjB!F Fh"jDc`(F8j8+ h+o F]o JC o E)JC q𵅰FFFF7+hbo :F1F(F$FFopFFJF FC+3F!F(FJC+!F(F(F p2F!F(F(!F(F''-MFFFF (F F(FP!)F F  Fo  F1F Fh HF Z(0"   :D F# 1FF FF( CE)F F")F FH1FF FCF(;F*F FF()F F1-AFF$FFAF8FJ\`+ohZЫkFAF8FJHFXF0F( 3o0F-,`T)[)-AFFFFFF`(F AF(F(F !F(FFA1(9F0Fe(!F(FF"!F(F9FFF0FBF9F0FC(F#F*F0F(!F(Fo -MF F/3(F(,0F F(DF (F(@(FI ]+g2(FIUF`1!(FP(Fր!(FJ!0FJCF!0FJaF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGK(ܠa+ 8pGBpG3Z*pGKpF$B 5`104.pO10@91?"?+pGpF8FpF,F Fp2F!F-AFFFFO1F8FBDEd`O@9FEDF#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4L DB;C@۲40 $A F0M\B0K$5@`@$?F FF @" F  F +h$ FphF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0FW#Z`8F1F F!,a FC0D7)FhF F@¿"hFF"!F FB##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`))hFF"!F F "#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(zjㅄ)KrhFF"!F F##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`))))ㅄ)-AF0HFF44h"!F FU##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF(FII`v(Fvhh3bx3hD3`(F IqFq))))ㅄ))ՄhFF2"F F!##p0#pcp'p``#+a#cq#(FqIAIq(F<##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`)-MO6v R#*Il>F%FF"4$! F.3#0F")F[;GoEF/D$" FI%#"0FIeq!a0F/)F`u F* q=F)5))p KFl$0FFU?dӱ#јG&F熱0FG2FF I"FH FpFI*%**sF p%.F F(.x.+@%#x46.( FsFNM| F#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PFqch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FHFT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3FF*-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N8>DD@k@3DNjsc N>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ-EFia(CiF$3CaCiTsFCa@ TE"FERF 9F(Fs@8"!(FC#i)F#eci Fce1!F"0F Fp@X"!/!7K3)Cc3F# FFhF3hiF F#Eg#`C` K`3`)Cca3CaKapG#Eg-M";3xRxC#xCCxCcRyyC#yCCyCc RzzC#zCCzCcR{{C#{CC{CcR||C#|CC|Cc R}}C#}CC}CcR~~C#~CC~CcRC#CCCc! 0C#" CC# Cc% $0C#& CC' Cc ) (0C#* CC+ Cc,0- C#. CC/ Cc1 00C#2 CC3 Cc 5 40C#6 CC7 Cc9 80C#: CC; Cc= <0C#> CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@NIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3ܿ-EhF?`(ChF(3F(C`@ ERF@<"AF(FLL=Ll;<L,:LL9Ll78L,6LL5Ll34L,2LL1Ll/0 L,.LL-Ll+,L,*LL)Ll'( L,&LL%Ll#$ L,"LL!Ll L,LLLlL,LLLlL,LLLlL,LLLlL,LL Ll  BjL, LL LlL,LLLlL,LLLliO,slKDDjiiDDCih hOs>C^ih H iiDD   KjDDO(ivhD hO~8C h  hX iJ D    JN BD DDO(uhhDbDhOs8  J XD JbD(C DDO,rlDO{<   J h\DDBD<DDDO*rjDK O|>   J ^DL  DDDO(uhDOv8 J XDsD DDDO(shDF Ou8  J XD LDDDO(rhD  E O{<  H\D   D DDO.znDfDKOr> H^D    B  DDDO.snDOv>H^D eDh   D DDO.unDFOs>  /BD7q۵[V9Y?^[1$H ^D    C  DDDO.wnDO{>  H^D  4 D DDO.znDfDKOr> H^D    B  DDDO.unDOv>H^D cDŠD DDO.snD FOu> H ^D DDDO,wlDDE O{<  H\D OLDtL,DON  DO,DzlDDvDKOr< H\D OLwL ,DDON ` DDDO,slDBOv<  H\ D OL FDONsN. DD DO,wlDOu<   H  \DDON(DDOHwH( d  D DDO(whDE O|8  } Ut]rހܛtiGƝ̡ $J XrDD ONL DDOHsH($`    J DD DO(whDOr8XvDD 3F ON B DOHvH(( D   D DO(whDOs8uDJ XD ON  DOHuH( d  D D DO(uhD C O{< H \D OL ONDvN.D 0 K    D H D DO.wnDOu>bD^D OL  DE D ONrN. 4` D   DDO.wnFDgDOz> H^D ;FJOL DDONwN.  8    D DDO.wnDOs>   H ^D OL ONDrN.D  <h C     D DDO.wnDeDO{> H^D o,-tJܩ\ڈvRQ>m1'  OL DD ONuN. @\ D   DDO.wnD  Ow>K^   H D OL D DONwN.  D    DDDO.wnFDgD Oz>G   H^D OL  DONuN.D HX    DDDO.wnD  Ow>J^   H D OL DD ONtN. < DDDO,wl DwD O{   H ^DDOL D8DONxN.D<@D < dD4DDDDO,xlD,D4O|< \C H DDONDDOHvH( D䁆  DD DO(vhD O|8F    J XD ONDDOHzH(DD4@<  DHBIH.DD< H^D OL( DDONxN.D(D<  D( D@DD< H^D 00OL DDD ONuN. <@  DDD@@O.xnD DFOs> H ^D 88OL 0(D,D(ONxN.D0@<0 D  < |DDDDDO.xnDC O{>  H^D OL8 DDONuN.D4D@4 @  D H^D OL D@D ONtN. D8  D tDDD88O.xnDcDBOv> H^D OL D 迢KfpK£Ql$օ5DD ONwN. 8<  DDD< H ^D OL D$DONtN.D<8 @  8 TDDD@@O.xnDC O{>  H^D OL D(DONwN.DD@ H^D OL DDONxN.D8@  @8 4D
 H^D OL DD0DDONxN.D<  <  D@DDO.xnD FOs> H ^D ,,OL 8D4D8ONxN.D     DDDO.xnDC O{>  H^D OL , H^D  OL pjl7LwH'4 9JN DDONxN.D   DDD O.xnDcDBOv> H^D OL ,DD,ONxN.D   L DDDO.xnD FOs> H ^D $$OL DDDONxN.D@ @    DDDO.xnDC O{> H ^bDD ((OL $ D8D ONxN.       DDDO.xnDfDKOr> H^D OL( D<@D@ONxN.D$ $   tDDD O.xnDcDBOv> H^D 00OL DONzND.   D  F DDO.unDOs>H^D D44OL 0$D,D$ONxN.D   \DDDO.{nDbDCOu>H^D OL Oʜ[o.htocxxȄnj4 DDONzN.      pDDDO.xnDfDOr>EH^D OL,D DDBONtN.DD DO.tnDOv> H^DDOLD DOHDzH(DDDO(thDF O~8   hXJ DDhDDi CiiiD j Cj  $ElPxq-EhF?`(ChF(3F(C`@ E(RFV@<"AF(F& !p@@BWxqEtF>Dx242O7@&d@gDGE@  aE0ҀIa!O1U`]`BR2B`@B)s&43a8<@ >eEADqD6ٞFED AEcD'aE< QDADeEqDUDED FQEcDB mDϋBqFF-;F =Ox-_p x3pBB{eEADqDٞFED AEѭKx={pxp??ё=13/>OU 9FcF;G '* <LL31IxYp3</#G#FgF?(?LO&aD IMO5&9DI !z***-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0dC$CMEرiʱ#!aAcOACa`aQaaF`S``bbbcccfedpGopG8F F*<x1*9<+7o8#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo睜FirCjcQk"jGj"cjiG ao-M*FFOD xDOsBE=,DB٤DY!d ЗB#iQFiaD\ 0p0jccK#h+p0BjPhk(@J"ij 0(Ghc(@=##`o/;?@D5!/;?@D5,/;?@D5A"i ,`aC"j*?Ba?"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiaDo##`#i- "BвK#"j*Sb/?[+?@D5%.F"j*@#b"#jc"FFQa4 #/?=;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?ʮ;?@D5%#.F"d#`"l*?xE(FE(F?QFZF  D[D#l #d5/?;?@D5 -D!31"fcfeO6+AK7#f##`m/?n+?@D5-Zf7J=2083$ nB 0JC+cfd#ceXFQh(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDh#h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03`H h8D0 hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4#-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(F#-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNHc #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% r}iD 8?C[E \+ 5_D}h{a5#Fhh"F!0Fj!O= O\;iB # F3p!F hF`(яChh:sцP/Rh:oFFF1F^E\.уCFxkݹ/#-MF;mFO # FF` "K` :PF "K1F"FO#+U;m.#RFymhEl:m`C0s@0(OpAFP(F@F0+<(F (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(Fh+ѻhh:mBTPAFl`!h(KH9h3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HX0Fh9m(?QHk#100h0FF$'khB *hX+40G(FFKJKF(F)F0FJCFGB);F J09DBؿ$p)J0D-0FRlF:_0F F!ǿ"iF iFHA 3]'-M F'<"   $+C C$ C  2K]fF1HM : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H!FH1FHk0000-MFF@+FFFF@ BF$)F <F3XRF0F-IjB('FO Dj  E #D0B2#.&}C!LB."P3kDH,IG-0K*00FI8DD  - 00۲ +0 0;xg\ p32o󪄀P0-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FF8`h5 [;hDD8o 7F , F|F FF u"  Fu-AvBF FO/0FZ)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH0pF?F!?@ FF(3*F! FpFIFx3\pGPF8CH#DBF#Sp Fx;A\P #h:B`\i1`i 3`i\`-AF%ChFT+HFF"3h 4BT ,TзB!eE!F pPB=D5ӬE4  3eEO 7003 ` A0þO00#0FNF F4hhO D4hdDdhB#4hDD@dDE(O2RE  *F!F( #*F90$ F "p@Bdp FFF 2F)FH Fp1#FF F "czh DB hD2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`x(22?2R2f27% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpFPO2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0FT#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80uF,F F8!FGF 0\+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p3d\-AF*K*FFF a F'B<"pB "B0Bp;2B+Bȿ#D#F !!IF(CD? B TB"p7B8p<3EF%KF*FFF0FF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2r2-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p|$L-+G0+gУ0 *M FO F;0 .[ x.+kKxN0 *_1F# F+0 O#s1xz)]g)^L)W62xx*b*j%*X*WE<%#;p3x|+E{pDFsxq++Э +#+*+UDDDD@D30O8"0*+U;FO3#Z)O1HhҲ l)pxl(L!6Fc:*P"⃀Q僀ჀჀჀჀ]僀ჀჀჀჀ3僀僀;ダჀჀダჀa僀ჀჀI僀BF;F !SE8p3:*ܸ3ؿODؿ#DWE8U;8;p !#FGD* ܸ3ؿ#D'F6SE8p3l)U+QF48FCFFl)FQ+qxFU)I)M)RD) и? OD D! i)tm)@a)O hDa#QF8F#B4QFCF8FFFF(FQFCF8FF(F"_JIsx\3FRFD@"@ OF    I* O:2p2*"$@ p4 CFND@x$@4)w; F F <9)E"*T  FO.xl* B*L*""(F s*(FF"4CFQF8FS"Pf"0I o  F+h t)ѫF[+5%Fih[+8F FQF]FFF![+F[[*E1r2 FbB ` F S+S]pGF FoAHR]pGmF F@AFI F mQ ]pG#F M Oku5 F !@#F$01 +.FO0F$" Kt J]Fs] s$fK\D C9(Կ08W8pGOppGPpx0+CxL\D۲x+"0F%&F0xB `(Fp*"* "P"ѿ "ο#`FFFFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`PxF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1AP8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8PpFF)KB J \@Fl;]v `!p@)B!`O0pP"տ!xFF#Fy"?'_xe!F#x F&0F -FpF%@ F0D5BFh F@-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD~ a'O0QL&-EF&O8 jD# uB ci+#kHh#CЩh@F!D #BB!@D=j(??1!?6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? 6i)DN-AyF+ѽA&iDFBܠi*i "ih@F!D/(ijiB!@Dii(??1!?6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? 6+Bۨi!i)D&('KhFBH/ +H ELFy22#J`J`J`J`KJ#?`pGh*p*l*d*U$X*-M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FzKhMҿX* kMp N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`p*MMl*M2kKhP A1JhB  L#h3+#` H#"#`K``p*`*\*2M-M*F FF")FOHMR xJxC#(ыxxC#+"ёOy/ 0 :FQF B ѣyyC#г6@0F[#q#qFBFF4:F!FPFBFF&I:FYF FF51F*F)F8FMO;h+"KhSEN0h"AF#MFFRF FLG"AF(hr!h(h#;`#`3` 3MMp*l*h*<+d*Kh8 pGp*-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H(b"!9H(\^##p#'cp#5Hpp'qF(Z(Ra#cq#qq:F0F4)H)K'F(FF@F<#;FFAF`p8F7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH4;pτp43A3-AFFB!x)ѽ)ex3C)[2))@5,D3+R#񃀣񃀣񃀣)zS!Uaiq񃀣񃀙)"+H1")H"(H- #*F%I&Hp':F$H#"JU/F?-@#*FIH\?':FH#J/F"HxKpi"HK_O*F8FUH2QO5NMMMV3`3*3*|*t*x*II3"sF1F KB#MEq+p+x1Fl+xl,p@pcSct*-MD)F8C+Ѹx+Cx+уx+ F"sKh#JBR[Bk3:F]zKBx*5*Kћx+ F")FE#")FnH>"mKmHhD7lKx l4 F@hKx+Ob!FfHeI xdHQF"cH#3`aKh^IF_H_!F)M 3Zx2DWHM"TIAF( "QF+?yLN7h/?}/?q/ FAFO FA0BI@)F@R Fq=IOb F#D#wcw#0JwFwh!5J R$ "% 4BF#&IF8"IBF BFQF!J9Fhp-D# FC"O1i)D++cScMMMt*IIpM +33M*<+A kMbx* K`K`"K`K`++ ++-M$cOcH<`(!F_K`_K`Hh%1``@@R! FYIOb F\O #VJDwwFheQJ R$ "% ("","0"4#FAF8":IK+F*FQFpf 0FC# (FCC Cc*K-h*1 "@F$Kh;H#P " C" FD#O1sKIh#H;`)DF`PIH"P2`*4*<++ 4 k +MbMI+++AKhKhBH@Ƽ J Ih@oOcFF`@@ +*44+A( ($] 8FuF#h FkiG"!( 88Fj !F`hl0ahH3o8+y+ F8@IZ44FCl hki㱀l1 F6yByCyCyCzCBzC#h FkiG&ah@H(ah@H44FF(F#3`3qFIF"lF(MBI"lF(E+hki+S5sF0!FF( FpP- 50F p"!F0whF+!F@( '#h+pFhuF)F( N0`0!F( ,0`%`$h Fp(+F $`ClK`((+FnhB #FHIFF0FX%O7( x$ F0FB5DiF(F+Fh,<,3B FYj1F`h(B٣lB5} z0s0Cl#`gdlO0!HF H`Io@< FFhoFF0HEo F5FoOkl+h(FkhG (F`#`#$qFPyC+h(FkiG##`##q8FPCl'hXBXAFpFFFXX#h2Fk)F Fp@[hGoposF0F( &+h(FkhG!F+hkh"F(FG>O Fp $oos( ,#H Fp!HF(4F(/$[lH}HZhlw.BHpK[lD+H^ o%p6z5Pӄ55r#` "FF(opFF FF)F jhBi}+}}C#}8A! H[IhGMMMM5P+KOsB @s@ B   pG pGpKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjtM8F"Fh"Icb{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuME"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! Fr rMFFB"w"JFh!4{rd+uu#",v$kuulvvvM-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F 4$K`K`K`K`K`7 F O0o<+ kkp*h*d*\*`*$$) x"+219:*K? "+#ppG;:!H8 I(()) + #@J?O( KhcH Kh#HKh H"IHg(CF(H^ H H M6M)6MH6NM6e66 H" K` (H."K @dHɄM6("[K-M`O"XKXNdYO`F$c F#;`LK`--%5 'GLV( DK`"AKo`>H9":K``1"6K`B"hb-Jh/JhB"h#`G3h+3h++2+0(F((yoLG"hbFH!hHKHh --\$h+o?M8+MMMIH+D+p*6M@+6\4rT݄-AHF FF:!@FlF@Fop8`*Fq F# ,D<(*FIIFCF#IҲ] 7hx0; +!@@pOpFK FK "K`M$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fh%!J!ueu[v#vuu%vev3K6`uK u(F` K`@͸M7 <+p*kMMd*\*`*-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! Fr r%uuuu u FFD9F2F1F(FM$MMM LhFh rhF!h 8K"h` K`dO04rNNOKONh2h:*\fs\\OrREI FCH0D FAIAI@K@Jh42?I F F'0;KD:F Fh9I8KD F:F6I3hD+ 4K+ F:F2IsDe$/K0J0Ihh h/H"-K`ObR+K$h[k%ObRO@s(k%IN$%ObROs(kIA$%ObROc(kI4$%$%F<+NM,7򄀴Mb0I27>7L7NNNMMN]7l77-MJFh BѤO9h)УJhBЊ*- "o𙁲oв@`"o:`J L`BؑKKM IPFFx(F]JJBFH#;`IPFFx(FGKh2ЀH#;`IPFF 1{K`{IPFF &lK5.uN`@ EEnL#E^J3#D\J~璲)2` WIWI!9`RI* `O`I0 `_I `_H1h^H\]HM9)0B?PDrkNI h3 `0C0MK`BO9h)Tи03B( F2"SCEK 9hB53h@I0@K=h?K`-Kh 3h!9L#h ,"" *B&H4/H1"-K# R#K2K !hBP.)F# >NNNMbNN77򄀴7МN8NNNNN778NNyNN8M@!F)g8Hb# +3+24L3h"Bw1J#D#nb.HR!dc[;+?)Hl*f*F0E0B[ M;h00+H8hMJ(hV(`pHt)hOzs!XCJHe0J#h IH7"K`8NNH8`8IN{NF:7؄A8MpMJh3`JhBIH@) H% K Ih Kh+н@Nq888yN-EL0##0|H "!Y yH( "!PvKvHuM "!E(`)hzqHOzs+`oHnN "!10`1h)jH#3`@W"B9FfHt#'0cKdLh"!F@F0F ^IC\H#Ҳ2YI " F7!FWH'sHxFUHBOKTILJTHK2h`=K>I(h`o(", *$.)#-!+%/  k }  } { {}   k }  }S\pp00Ѩǧ![NYd9ir;킀-킀{_C' 킀킀5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +NYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIuI !yA51'hUh=OtUR1h32%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b !G=焀 dH2 Ph"R 5 C2 PhXb 7 ?ñ2 PhXb 7 ?ñ2 Гh8(H5@ @ o&p'@B(('(7(I(Y(l(}(((((((()!)4)y7ӡݡ롄ㅄ +;,,*,@x}uu@x}e MX1JPHpHHHH :{:K://<3< ;5;O<<{<7<;<'Q;<>?<;C;   $ ;qak} H5ɄNO'q&]fvjjjЄjjjjj jjjkkkkk+k1k9kAkIkAkMkRk ҄[k bkhk nkvkkkkkkkkkkkkkdkjkkkkkkkF:F:dEddRddcd dsdddddddF:F:vii jo"j(j/j6j:jCjIjPjVjRh\j'dzjjjjjjjqjF:F:d#d'd.d;dF:F: dd̖djjddddae!e/e NeWe kete&ee%eeveee eeff6f>fLfSf`f#ffff ffffgg'g1g?gLg_ggg{ggggggggghh#hBhGhRhVh zhh!hh"hh$hi'&i,i(>iIi)cini*ii+ii,iiF:F: P 2 @6?WV闀񗀀ᗀM #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %@BDFHJLN"$&(*,.0@BDF  !B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.BootCurrentBootNext1234567PlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      JL^XZ'hUh=OtUR1hu-boot*EHCI Host Controller  *+,;=[]__of_translate_addressfdt_fixup_memory_banksv7_outer_cache_inval_rangedo_bootvx_fdtusb_setup_descriptorwait_for_eventomap_hsmmc_init_setup_ehci_create_int_queueomap_uhh_resetalloc_double_indirect_blockext4fs_put_metadatafs_devreadefi_free_poolefi_runtime_relocatewait_for_bbmmc_write_dataext4fs_log_journalefi_free_pagesomap24_i2c_setspeedmmc_read_datammc_reset_controller_fsmomap_hsmmc_send_cmdfdt_find_or_add_subnodeomap_hsmmc_set_clock(((((AAAAAABBBBBB(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] ERROR: %s - start address is not aligned - 0x%08x ERROR: %s - stop address is not aligned - 0x%08x arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... CACHE: Misaligned operation at range [%08lx, %08lx] INVALID OMAP REVISION usbethaddrCPU : OMAPDRA%x-%s ES%x.%xTSTEMUHSGPPMIC_GPIOSDRAM: identified size not same as expected size identified: %x expected: %x Error: ABB txdone is not set panda-esboard_namepanda-a4Board: OMAP4 Panda Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid verify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkdhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-stdextlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efiPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootefi %lxbootefi %lx %lx/dtb/dtb/currentbootmeth_efiu-boot,distro-efi#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2024.01+dfsg-5+b2u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesetherneteth%daddrlocal-mac-addressranges/__symbols__failed on fdt_overlay_apply(): %s base fdt does not have a /__symbols__ node make sure you've compiled with -@ The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: fdt fixup event failed: %d - must RESET the board to recover. Unsupported %s address size descriptionentrydatadata-offsetdata-positiondata-sizealgo%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSign%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into vbecompatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s aslr-moveaslr-randefi-runtime-randrandom-randarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetVersion: %s Vernum: %x/%xvbe_simplefwupd,vbe-simplecur-versioncur-vernumU-Boot bootloader-versionfwupd## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order bootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 14.2.0-4) 14.2.0 GNU ld (GNU Binutils for Debian) 2.43.1 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quit## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x boorsindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsCurrent bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Bus %d: %sInvalid bus %d Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) readingError %s the chip: %d %04x: %02xwriting-sCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx %08lx ? i2cI2C sub-systemcrc32loopmmmwnmprobeUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %0lx %04xZero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %smiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablesleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperaselisthwpartitionsetdsractiveeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu rootpathdnsipdomainautoloadNET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part type : - set environment variable to partition type part set type - set partition type for a device part types - list supported partition table types-ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-omap4-pandadefault-arm-omap4default-arm-pext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-eSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Argument image is now in RAM: 0x%p fdtargsaddrfdtargslenWARN: FDT size > CMD_SPL_WRITE_SIZE Argument image is now in RAM at: 0x%p Subcommand failed SPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. exportatags%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: setenvPlease enter '%s': ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditimportprintexistssaveenvsave environment variables to persistent storageNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: I2C: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! modelModel: %s NULL device name! %s: %x - %s <--> %s No such device: %s MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: %s not found %.*s%*s stdoutstderrpre-reloc realloc() is not supportedalloc space exhausted (unknown)Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> md5sha1sha256crc16-ccittbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKRKMTDVirtIOBLKMAPUNKNOWN(%d) device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl %s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtd/clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfdbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configERROR : check_gpio: invalid GPIO %d Error, wrong i2c adapter %d max %d possible Timed out in %s: status=%04x Check if pads/pull-ups of bus are properly configured Error : I2C initializing first phase clock Error : I2C initializing clock wrong hwadapnr: %d ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! i2c_probe: pads on bus probably not configured (status=0x%x) I2C read: addr len < 0 I2C read: data len < 0 I2C read: NULL pointer passed I2C read: addr len %d not supported I2C read: address out of range i2c_read (addr phase): pads on bus probably not configured (status=0x%x) i2c_read: error waiting for addr ACK (status=0x%x) i2c_read (data phase): pads on bus probably not configured (status=0x%x) I2C write: addr len < 0 I2C write: data len < 0 I2C write: NULL pointer passed I2C write: addr len %d not supported I2C write: address 0x%x + 0x%x out of range i2c_write: pads on bus probably not configured (status=0x%x) i2c_write: error waiting for addr ACK (status=0x%x) i2c_write: bus not ready for addr Tx (status=0x%x) i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! %s: set i2c speed failed omap24_3omap24_2omap24_1omap24_0Unknown modeStatus Error: 0x%08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)bus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! udevice *)(NULLcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found eMMC%s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed %s: timedout waiting for sysctl %x to clear ti,dual-voltOMAP SD/MMC%s: timedout waiting for cc2! %s: timedout waiting for softresetall! %s: timedout waiting for ics! %s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s : DMA timeout: No status update %s: timedout waiting for status! omap_hsmmcti,omap3-hsmmcti,omap4-hsmmcti,am33xx-hsmmcti,am335-sdhciti,dra7-hsmmc#phy-cellsnop_phynop-phyusb-nop-xceivCannot find console ## Baudrate %d bps not supported ## Baudrate may not be deleted %s %s: failed to release all clocks fck%s %s: failed to get %s clock ti_syscti,sysc-omap2ti,sysc-omap4ti,sysc-omap4-simpleti,sysc-omap3430-srti,sysc-omap3630-srti,sysc-omap4-srti,sysc-omap3-shamti,sysc-omap-aesti,sysc-mcaspti,sysc-usb-host-fsRx: failed to receive: %d Error: SMSC95xx: No MAC address set - set usbethaddr Waiting for Ethernet connection... done. unable to connect. smsc95xx_ethusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No working controllers found usb_dev_genericu-boot,bootdev-usbEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x port%d-modeehci-phyehci-tllehci-hsicFailed to register EHCI %s: RESET timeout Failed to get phys omap-ehciti,ehci-omapti,usbhs-hostenv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacks00:1Unable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... Unable to read "%s" from %s%d:%d... ** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsext4unsupported** Can not find directory. ** ** File not found %s ** part_offset is %lu total_sector is %llu error: overflow occurs no block left to assign No Memory %s: Device read error! no block left assign no block left invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no inode left to assign Badly aligned ext2_dirent Please supply Absolute path Invalid path It is a Directory file found, deleting Failed to iterate over directory %s < ? > %10u %s Error in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported feature metadata_csum found, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** Invalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required File System is consistent update journal finished Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driver/EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed 1234567Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting kaslr-seed ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx out of memory%s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition Cannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol ERROR: Out of memory Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### Failed to install ECPT linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellstargettarget-path/__local_fixups__/__fixups__/__overlay__//__overlay__Unknownmanufacturer01/01/2024productUnknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassisevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d No valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotatenoethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octettsize%c%u%cblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead bootcmd=if test ${boot_fit} -eq 1; then run update_to_fit; fi; run findfdt; run init_console; run envboot; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x82000000arch=armcpu=armv7board=pandaboard_name=pandavendor=tisoc=omap4loadaddr=0x82000000kernel_addr_r=0x82000000fdtaddr=0x88000000dtboaddr=0x89000000fdt_addr_r=0x88000000fdtoverlay_addr_r=0x89000000rdaddr=0x88080000ramdisk_addr_r=0x88080000scriptaddr=0x80000000pxefile_addr_r=0x80100000bootm_size=0x10000000boot_fdt=trymmcdev=0mmcrootfstype=ext4 rootwaitfinduuid=part uuid ${boot} ${bootpart} uuidargs_mmc=run finduuid;setenv bootargs console=${console} ${optargs} root=PARTUUID=${uuid} rw rootfstype=${mmcrootfstype}loadbootscript=load mmc ${mmcdev} ${loadaddr} boot.scrbootscript=echo Running bootscript from mmc${mmcdev} ...; source ${loadaddr}bootenvfile=uEnv.txtimportbootenv=echo Importing environment from mmc${mmcdev} ...; env import -t ${loadaddr} ${filesize}loadbootenv=fatload mmc ${mmcdev} ${loadaddr} ${bootenvfile}loadimage=load ${devtype} ${bootpart} ${loadaddr} ${bootdir}/${bootfile}loadfdt=load ${devtype} ${bootpart} ${fdtaddr} ${bootdir}/${fdtfile}envboot=mmc dev ${mmcdev}; if mmc rescan; then echo SD/MMC found on device ${mmcdev};if run loadbootscript; then run bootscript;else if run loadbootenv; then echo Loaded env from ${bootenvfile};run importbootenv;fi;if test -n $uenvcmd; then echo Running uenvcmd ...;run uenvcmd;fi;fi;fi;mmcloados=if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if run loadfdt; then bootz ${loadaddr} - ${fdtaddr}; else if test ${boot_fdt} = try; then bootz; else echo WARN: Cannot load the DT; fi; fi; else bootz; fi;mmcboot=mmc dev ${mmcdev}; devnum=${mmcdev}; devtype=mmc; if mmc rescan; then echo SD/MMC found on device ${mmcdev};if run loadimage; then run args_mmc; if test ${boot_fit} -eq 1; then run run_fit; else run mmcloados;fi;fi;fi;boot_fit=0addr_fit=0x90000000name_fit=fitImageupdate_to_fit=setenv loadaddr ${addr_fit}; setenv bootfile ${name_fit}get_overlaystring=for overlay in $name_overlays;do;setenv overlaystring ${overlaystring}'#'${overlay};done;get_fit_config=setexpr name_fit_config gsub / _ conf-${fdtfile}run_fit=run get_fit_config; bootm ${addr_fit}#${name_fit_config}${overlaystring}console=ttyO2,115200n8fdtfile=undefinedbootpart=0:2bootdir=/bootbootfile=zImageusbtty=cdc_acmvram=16Mloaduimage=load mmc ${mmcdev} ${loadaddr} uImageuimageboot=echo Booting from mmc${mmcdev} ...; run args_mmc; bootm ${loadaddr}findfdt=if test $board_name = sdp4430; then setenv fdtfile omap4-sdp.dtb; fi; if test $board_name = panda; then setenv fdtfile omap4-panda.dtb; fi;if test $board_name = panda-a4; then setenv fdtfile omap4-panda-a4.dtb; fi;if test $board_name = panda-es; then setenv fdtfile omap4-panda-es.dtb; fi;if test $board_name = duovero; then setenv fdtfile omap4-duovero-parlor.dtb; fi;if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 legacy_mmc0 mmc1 legacy_mmc1 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_legacy_mmc0=setenv mmcdev 0; setenv bootpart 0:2 ; run mmcbootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_legacy_mmc1=setenv mmcdev 1; setenv bootpart 1:2 ; run mmcbootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; done0123456789ABCDEF'hUh=OtUR1harocsdxbimask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to # #(-27][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. ( w U-Boot 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000)U0qf[0qsI0qqU0q[0q-U0qa0q[0q-UPqaPq[Pq'I32 t1I32E t1I32'Pt1hl#|<'Pt1hl#|<|&Pt1hl#|<|&ht1hl#|<|&t1hl#|< 0@0@0@0@Pkl-liknmmmnqi%rF:F:F:F:6fF:F:tv F:F:@F:F:F:F:F:F:F:F:xF:F:/!F:F:ቄчF:F:扄чeF:F:  /TրF:F:&ۀF:F:n׀F:F:,݀F:F:$^؀F:F:1݀F:F:4=ڀF:F:7݀F:F::׀F:F:iـF:F:чڀF:F:-}׀F:F:z鄀րF:F:@#ÄчaF:F:iF:F:uȄчqF:F:чF:F:xȄч5F:F:-!F:F:d؄F:F:nчF:F:~ȄF:F:Ȅч]F:F:ȄчF:F:~ȄчF:F:ɄчF:F:W) F:F:)d}F:F:ЄЄЄa߄F:F:tvF:F:߄F:F:6ftv^@!F:F:aчF:F:儀@чYF:F:儀чe!F:F:߄чA#F:F:儀чF:F:儀@F:F:℀@)F:F:iчF:F:+@ч"F:F:儀ч F:F: h焀8焀焀 q焀焀 焀 EɄ 焀 焀 >>E|@?@?>#@@?Q5m+@@e'@Q?@@9?>> y %Eo57> >$z$z8z8z@z@zHzHzPzPzXzXz`z`zhzhzpzpzxzxzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{{{{ { {({({0{0{8{8{@{@{H{H{P{P{X{X{`{`{h{h{p{p{x{x{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|||||||| | |(|(|0|0|8|8|@|@|H|H|P|P|X|X|`|`|h|h|p|p|x|x|||||||||||||||||||||||||||||||||}}}}}}}} } }(}(}0}0}8}8}@}@}H}H}P}P}X}X}`}`}h}h}p}p}x}x}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~ ~ ~(~(~0~0~%d)vW}G}%}. 1}||5aU||q|&ƃ||U|`㄀y ~~eserial2 [IqMS)  @ @  e0 ф}8񗂀qeieśOA5?>>>As]!? 55;5s444555555 55;5A5BOOTSERVdsW1ٷ=YQA͂˂Eς=ɼu ɂ͂eς΂AqłÂm‚e񼂀̂s͂ղӂ؂ӂMقӂՂԂ؁؁ӂӂyӂmՂ9ӂ҂҂]҂1҂PP2XX``hh1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ Tl(THܝ}:㄀@!A㄀f㄀ⱄ退籄F:;ч)Dh)dISF:MISF:󋄀чG:`@чĀh-@ᇁ6X;݄@u~;ʄʄ#ʄ чAŀ0@ "P@Ȳ1뀀̲۲|F:n퀀 &退rnɄ#ʄ@=Œ儀чe!%儀?儀uчF:@k儀\򓄀eǀF:чǀז|ǀߔчǀ 4ؔǀߔfчǀoǀ,W҄@ ]҄xȀjчǀrǀߔٗuȀ◄MgȀSaΜчǀoчYȀߘtvчʀ3_rՀyJՀRF:x@Yzч!Հ$@Ƅ@˄넄]րfB@!Ix]݄f݄҄ i؄x؄:؄B؄W؄ㅄٝF:S|oD!l8rpnhrpT!nProj-jj0 ,&4 z 遀%%X(~bH/EID,/Bm0" (,6 m 7aH"l< ~.= .B=^8}/U#"E#P m/" (=H" r<脀E2nwV.^1^nV^I7y ^a7 943#U E3 ́ ρρ!сҁ́ ρρ!сҁ́ ρρ!с́ ρρ!сOY}5!Y@񠁀n1n\a ooq&Ns(H LS-XWeBmÁ  } @ $ ~ .QD@ $.B05@p"8%(HptT\`(,  $(,048lptx|PTX |hlpX\`dhlptx|8`  | !!!!!!!!!!!!!""" ""T#X#p#$H%L%P%T%X%\%`%d%%%%&)))** +++,---.///001122222D333H44H5L5@6D6L6P6X666666667(7,707788 888999 9999;;;;;;;;;;;;;;;;;<<< <<>>>>>>>>>>>>>T?X?\??@ @$@x@A A$APABBBBBBBBBBCCCC8E$>(>>>(?,?0?4?L???????@X@@@@@@@@@$A4AAAAAAABBBBC C$C(CDDEEF GGGJJKKK KKKKK K$K(K,KKK$L@NQQQQQpTT@VDVVWXTZXZZZZZZZ@\D\H\L\P\T\X\x^|^^^____(a,a0adbpctcxc|cccccxd|dlgpgtgxg|ggg,hhiiiiijjj jjjjj jkk kkkkk k$k(k,k>>l>>>>dpll_core_m3x2_div_ck@134{ti,composite-divider-clock:4?dpll_core_m3x2_ck{ti,composite-clock>?dpll_core_m7x2_ck@144{ti,divider-clock:Diva_hsd_byp_clk_mux_ck@1ac{ ti,mux-clock@Adpll_iva_ck@1a0{ti,omap4-dpll-clockAB7Bdpll_iva_x2_ck{ti,omap4-dpll-x2-clockBCdpll_iva_m4x2_ck@1b8{ti,divider-clockCD~Ddpll_iva_m5x2_ck@1bc{ti,divider-clockCE] Edpll_mpu_ck@160{ti,omap4-dpll-clockF`dlhdpll_mpu_m2_ck@170{ti,divider-clockpper_hs_clk_div_ck{fixed-factor-clock7Kusb_hs_clk_div_ck{fixed-factor-clock7Ql3_div_ck@100{ti,divider-clockGHl4_div_ck@100{ti,divider-clockHlp_clk_div_ck{fixed-factor-clock6mpu_periphclk{fixed-factor-clockocp_abe_iclk@528{ti,divider-clock I(per_abe_24m_fclk{fixed-factor-clockJdummy_ck{ fixed-clockclockdomainsmpuss_cm@300 ti,omap4-cm+ \clk@20 ti,clkctrl {tesla_cm@400 ti,omap4-cm+ \clk@20 ti,clkctrl {]abe_cm@500 ti,omap4-cm+ \clk@20 ti,clkctrl l{Itarget-module@8000ti,sysc-omap4ti,sysccrev+ \ cm2@0ti,omap4-cm2simple-bus + \ clocks+per_hsd_byp_clk_mux_ck@14c{ ti,mux-clockKLLdpll_per_ck@140{ti,omap4-dpll-clockL@DLHMdpll_per_m2_ck@150{ti,divider-clockMPUdpll_per_x2_ck@150{ti,omap4-dpll-x2-clockMPNdpll_per_m2x2_ck@150{ti,divider-clockNPTdpll_per_m3x2_gate_ck@154{ ti,composite-no-wait-gate-clockNTOdpll_per_m3x2_div_ck@154{ti,composite-divider-clockNTPdpll_per_m3x2_ck{ti,composite-clockOPdpll_per_m4x2_ck@158{ti,divider-clockNXdpll_per_m5x2_ck@15c{ti,divider-clockN\dpll_per_m6x2_ck@160{ti,divider-clockN`Sdpll_per_m7x2_ck@164{ti,divider-clockNddpll_usb_ck@180{ti,omap4-dpll-j-type-clockQRdpll_usb_clkdcoldo_ck@1b4{ti,fixed-factor-clockR(5dpll_usb_m2_ck@190{ti,divider-clockRVducati_clk_mux_ck@100{ ti,mux-clockGSfunc_12m_fclk{fixed-factor-clockTfunc_24m_clk{fixed-factor-clockUfunc_24mc_fclk{fixed-factor-clockTfunc_48m_fclk@108{ti,divider-clockTfunc_48mc_fclk{fixed-factor-clockTfunc_64m_fclk@108{ti,divider-clockfunc_96m_fclk@108{ti,divider-clockTinit_60m_fclk@104{ti,divider-clockVYper_abe_nc_fclk@108{ti,divider-clockJsha2md5_fck@15c8{ti,gate-clockHusb_phy_cm_clk32k@640{ti,gate-clock@bclockdomainsl3_init_clkdmti,clockdomainRl4_ao_cm@600 ti,omap4-cm+ \clk@20 ti,clkctrl {dl3_1_cm@700 ti,omap4-cm+ \clk@20 ti,clkctrl {l3_2_cm@800 ti,omap4-cm+ \clk@20 ti,clkctrl {ducati_cm@900 ti,omap4-cm + \ clk@20 ti,clkctrl {l3_dma_cm@a00 ti,omap4-cm + \ clk@20 ti,clkctrl {Wl3_emif_cm@b00 ti,omap4-cm + \ clk@20 ti,clkctrl {d2d_cm@c00 ti,omap4-cm + \ clk@20 ti,clkctrl {cl4_cfg_cm@d00 ti,omap4-cm + \ clk@20 ti,clkctrl {el3_instr_cm@e00 ti,omap4-cm+ \clk@20 ti,clkctrl ${ivahd_cm@f00 ti,omap4-cm+ \clk@20 ti,clkctrl {iss_cm@1000 ti,omap4-cm+ \clk@20 ti,clkctrl {ll3_dss_cm@1100 ti,omap4-cm+ \clk@20 ti,clkctrl {l3_gfx_cm@1200 ti,omap4-cm+ \clk@20 ti,clkctrl {l3_init_cm@1300 ti,omap4-cm+ \clk@20 ti,clkctrl {Xl4_per_cm@1400 ti,omap4-cm+ \clock@20ti,clkctrl-l4-perti,clkctrl D{mclock@1a0 ti,clkctrl-l4-secureti,clkctrl<{ytarget-module@56000ti,sysc-omap2ti,sysc``,`(crevsyscsyss# C m Wfck+ \`dma-controller@0ti,omap4430-sdmati,omap-sdma0L  Q\ iztarget-module@58000ti,sysc-omap2ti,sysccrevsyscsyss#Cm Xfck+ \Phsi@0 ti,omap4-hsi@Pcsysgdd Xhsi_fck LGvgdd_mpu+ \@hsi-port@2000ti,omap4-hsi-port (ctxrx LChsi-port@3000ti,omap4-hsi-port08ctxrx LDtarget-module@5e000ti,sysc disabled+ \ target-module@62000ti,sysc-omap2ti,sysc usb_tll_hs   crevsyscsyss m XHfck+ \ usbhstll@0 ti,usbhs-tll LNtarget-module@64000 simple-bus usb_host_hs@@@crevsyscsyssCm X8fck+ \@usbhshost@0ti,usbhs-host+ \ YZ[3refclk_60m_intrefclk_60m_ext_p1refclk_60m_ext_p2 ehci-phyohci@800ti,ohci-omap3 LLehci@c00 ti,ehci-omap  LM\+hub@1 usb424,9514+ethernet@1 usb424,ec00target-module@66000ti,sysc-omap2ti,sysc```crevsyscsyss m ]fck^rstctrl+ \`mmu@0ti,omap4-iommu Lsegment@80000 simple-bus+\      @@PP``pp` `p p        target-module@29000ti,sysc disabled+ \target-module@2b000 simple-buscrevsyscsyss Cm X@fck+ \usb_otg_hs@0ti,omap4-musbL\]vmcdma__ usb2-phy `2target-module@2d000ti,sysc-omap2ti,sysccrevsyscsyss m Xfck+ \ocp2scp@0ti,omap-ocp2scp+ \usb2phy@80 ti,omap-usb2Xabwkupclk_target-module@36000ti,sysc-omap2ti,sysc```crevsyscsyssm cfck+ \`target-module@4d000ti,sysc-omap2ti,sysccrevsyscsyssm cfck+ \target-module@59000ti,sysc-omap4-srti,sysc8csyscm dfck+ \smartreflex@0ti,omap4-smartreflex-mpu Ltarget-module@5b000ti,sysc-omap4-srti,sysc8csyscm dfck+ \smartreflex@0ti,omap4-smartreflex-iva Lftarget-module@5d000ti,sysc-omap4-srti,sysc8csyscm dfck+ \smartreflex@0ti,omap4-smartreflex-core L target-module@60000ti,sysc disabled+ \target-module@74000ti,sysc-omap4ti,sysc@@ crevsysc m efck+ \@mailbox@0ti,omap4-mailbox L(4F mbox-ipu X c mbox-dsp X c target-module@76000ti,sysc-omap2ti,sysc```crevsyscsyss m efck+ \`spinlock@0ti,omap4-hwspinlockn segment@100000 simple-bus+`\  00target-module@0ti,sysc-omap4ti,syscctrl_module_pad_core crevsyscm+ \pinmux@40 ti,omap4-padconfpinctrl-single@+O! ^||defaultfghijnpinmux_mcpdm_pins(pinmux_twl6040_pins`tpinmux_mcbsp1_pins pinmux_dss_dpi_pins"$&(*,.0246tvxz|~fpinmux_tfp410_pinsDgpinmux_dss_hdmi_pinsZ\^hpinmux_tpd12s015_pins"HX ipinmux_hsusbb1_pins`           jpinmux_i2c1_pinsppinmux_i2c2_pinsxpinmux_i2c3_pinsopinmux_i2c4_pinspinmux_wl12xx_gpio &,02pinmux_wl12xx_pins@8:  }pinmux_button_pinspinmux_twl6030_pins^Aqomap4_padconf_global@5a0sysconsimple-busp+ \pkpbias_regulator@60ti,pbias-omap4ti,pbias-omap`kpbias_mmc_omap4pbias_mmc_omap4w@-{target-module@2000ti,sysc disabled+ \ target-module@8000ti,sysc disabled+ \target-module@a000ti,sysc-omap4ti,sysc crevsysc C m lfck+ \segment@180000 simple-bus+segment@200000 simple-bus+h\!!  @ @P P` `p p ! 0!0  !!`!`p!p@!@P!P!!""`"`p"p""""!!target-module@4000ti,sysc disabled+ \@target-module@6000ti,sysc disabled+ \`target-module@a000ti,sysc disabled+ \target-module@c000ti,sysc disabled+ \target-module@10000ti,sysc disabled+ \target-module@12000ti,sysc disabled+ \ target-module@14000ti,sysc disabled+ \@target-module@16000ti,sysc disabled+ \`target-module@18000ti,sysc disabled+ \target-module@1c000ti,sysc disabled+ \target-module@1e000ti,sysc disabled+ \target-module@20000ti,sysc disabled+ \target-module@26000ti,sysc disabled+ \`target-module@28000ti,sysc disabled+ \target-module@2a000ti,sysc disabled+ \segment@280000 simple-bus+segment@300000 simple-bus+\042@@2@ `2`p2p2232 2@target-module@0ti,sysc disabled+x\@@@ ``pp @interconnect@48000000ti,omap4-l4-persimple-bus0HHHHHHcaplaia0ia1ia2ia3+\H H segment@0 simple-bus+\  00@@PP``ppPP``pp  00 ` ` p p``pp``pp             @ @ ` ` @     0 0 @ @ P P        P P ` `  0 0 P Ptarget-module@20000 simple-busPTXcrevsyscsyssm m0fck+ \serial@0ti,omap4-uart LJlJntarget-module@32000ti,sysc-omap2-timerti,sysc   crevsyscsyss' m mfck+ \ timer@0ti,omap3430-timer mfck L&target-module@34000ti,sysc-omap4-timerti,sysc@@ crevsyscm m fck+ \@timer@0ti,omap4430-timer m fck L'target-module@36000ti,sysc-omap4-timerti,sysc`` crevsyscm m(fck+ \`timer@0ti,omap4430-timer m(fck L(target-module@3e000ti,sysc-omap4-timerti,sysc crevsyscm m0fck+ \timer@0ti,omap4430-timer m0fck L-target-module@40000ti,sysc disabled+ \target-module@55000ti,sysc-omap2ti,syscPPQcrevsyscsyssmm@m@ fckdbclk+ \Pgpio@0ti,omap4-gpio L$4 !target-module@57000ti,sysc-omap2ti,syscppqcrevsyscsyssmmHmH fckdbclk+ \pgpio@0ti,omap4-gpio L$4 !target-module@59000ti,sysc-omap2ti,sysccrevsyscsyssmmPmP fckdbclk+ \gpio@0ti,omap4-gpio L $4 !utarget-module@5b000ti,sysc-omap2ti,sysccrevsyscsyssmmXmX fckdbclk+ \gpio@0ti,omap4-gpio L!$4 !target-module@5d000ti,sysc-omap2ti,sysccrevsyscsyssmm`m` fckdbclk+ \gpio@0ti,omap4-gpio L"$4 !target-module@60000ti,sysc-omap2ti,sysccrevsyscsyssm mfck+ \i2c@0 ti,omap4-i2c L=+|defaultoeeprom@50 ti,eepromPtarget-module@6a000ti,sysc-omap2ti,syscPTXcrevsyscsyssm m fck+ \serial@0ti,omap4-uart LHltarget-module@6c000ti,sysc-omap2ti,syscPTXcrevsyscsyssm m(fck+ \serial@0ti,omap4-uart LIlIntarget-module@6e000ti,sysc-omap2ti,syscPTXcrevsyscsyssm m8fck+ \serial@0ti,omap4-uart LFlFntarget-module@70000 simple-buscrevsyscsyssm mfck+ \i2c@0 ti,omap4-i2c L8+|defaultptwl@48H L ti,twl6030 !|defaultqrrtcti,twl4030-rtcL regulator-vaux1ti,twl6030-vaux1B@-regulator-vaux2ti,twl6030-vaux2O* regulator-vaux3ti,twl6030-vaux3B@-!regulator-vmmcti,twl6030-vmmcO-|regulator-vppti,twl6030-vppw@&%"regulator-vusimti,twl6030-vusimO,@ #regulator-vdacti,twl6030-vdacregulator-vanati,twl6030-vana$regulator-vcxioti,twl6030-vcxio regulator-vusbti,twl6030-vusbsregulator-v1v8ti,twl6030-v1v8 vregulator-v2v1ti,twl6030-v2v1 wusb-comparatorti,twl6030-usbL  s%pwmti,twl6030-pwm+&pwmledti,twl6030-pwmled+'gpadcti,twl6030-gpadcL6twl@4b ti,twl6040{K|defaultt Lw HuYvdwptarget-module@72000ti,sysc-omap2ti,sysc   crevsyscsyssm mfck+ \ i2c@0 ti,omap4-i2c L9+|defaultx(target-module@76000ti,sysc-omap4ti,sysc`` crevsyscm mfck+ \`target-module@78000ti,sysc-omap2ti,sysccrevsyscsyss m m8fck+ \elm@0ti,am3352-elm  L disabled)target-module@86000ti,sysc-omap2-timerti,sysc```crevsyscsyss' m mfck+ \`timer@0ti,omap3430-timer mfck L.*target-module@88000ti,sysc-omap4-timerti,sysc crevsyscm mfck+ \timer@0ti,omap4430-timer mfck L/+target-module@90000ti,sysc-omap2ti,sysc   crevsyscm y fck+ \ ,rng@0 ti,omap4-rng  L4-target-module@96000ti,sysc-omap2ti,sysc `csysc m mfck+ \ `mcbsp@0ti,omap4-mcbspcmpu Lvcommonzz txrx disabled.target-module@98000ti,sysc-omap4ti,sysc   crevsyscm mfck+ \ spi@0ti,omap4-mcspi LA+@z#z$z%z&z'z(z)z* tx0rx0tx1rx1tx2rx2tx3rx3/target-module@9a000ti,sysc-omap4ti,sysc   crevsyscm mfck+ \ spi@0ti,omap4-mcspi LB+ z+z,z-z.tx0rx0tx1rx10target-module@9c000 simple-bus   crevsyscCm Xfck+ \ mmc@0ti,omap4-hsmmc LSz=z>txrx{|1target-module@9e000ti,sysc disabled+ \ target-module@a2000ti,sysc disabled+ \ target-module@a4000ti,sysc disabled+\ @ Ptarget-module@a5000ti,sysc-omap2ti,sysc P0 P4 P8crevsyscsyssm yfck+ \ P2des@0 ti,omap4-des LRzuzttxrx3target-module@a8000ti,sysc disabled+ \ @target-module@ad000ti,sysc-omap4ti,sysc   crevsyscCm mfck+ \ mmc@0ti,omap4-hsmmc L^zMzNtxrx disabled4target-module@b0000ti,sysc disabled+ \ target-module@b2000ti,sysc-omap2ti,sysc   crevsyscsyss mhfck+ \ 1w@0 ti,omap3-1w L:5target-module@b4000ti,sysc-omap4ti,sysc @ @ crevsyscCm Xfck+ \ @mmc@0ti,omap4-hsmmc LVz/z0txrx disabled6target-module@b8000ti,sysc-omap4ti,sysc   crevsyscm mfck+ \ spi@0ti,omap4-mcspi L[+zztx0rx07target-module@ba000ti,sysc-omap4ti,sysc   crevsyscm mfck+ \ spi@0ti,omap4-mcspi L0+zFzGtx0rx08target-module@d1000ti,sysc-omap4ti,sysc   crevsyscCm mfck+ \ mmc@0ti,omap4-hsmmc L`z9z:txrx disabled9target-module@d5000ti,sysc-omap4ti,sysc P P crevsyscCm m@fck+ \ Pmmc@0ti,omap4-hsmmc L;z;z<txrx|default}~;n +:wlcore@2 ti,wl1271n: virqwakeup+I;segment@200000 simple-bus+\55target-module@150000ti,sysc-omap2ti,sysccrevsyscsyssm mfck+ \i2c@0 ti,omap4-i2c L>+|default<interconnect@40100000ti,omap4-l4-abesimple-bus@@claap+\@II=segment@0 simple-bus+0\  00@@PP``pp  00      IIIII I I0I0I@I@IPIPI`I`IpIpIIIIIIIIIIIIIIIII I I0I0IIIIIIIIIIIIIIIIIIIII I I I I I I I III I target-module@22000ti,sysc-omap2ti,sysc csysc m I(fck+\ I I mcbsp@0ti,omap4-mcbspI cmpudma Lvcommonz!z"txrxokay|default>target-module@24000ti,sysc-omap2ti,sysc@csysc m I0fck+\@I@I@mcbsp@0ti,omap4-mcbspI@cmpudma Lvcommonzztxrx disabled?target-module@26000ti,sysc-omap2ti,sysc`csysc m I8fck+\`I`I`mcbsp@0ti,omap4-mcbspI`cmpudma Lvcommonzztxrx disabled@target-module@28000ti,sysc-mcaspti,sysc crevsyscm I fck+\IItarget-module@2a000ti,sysc disabled+\IItarget-module@2e000ti,sysc-omap4ti,sysc crevsyscm Ifck+\IIdmic@0ti,omap4-dmicIcmpudma LrzCup_link disabledAtarget-module@30000ti,sysc-omap2ti,sysccrevsyscsyss"m Ihfck+\IIwdt@0ti,omap4-wdtti,omap3-wdt LPBtarget-module@32000ti,sysc-omap4ti,sysc   crevsyscm Ifck+\ I I okay|defaultCmcpdm@0ti,omap4-mcpdmI cmpudma LpzAzBup_linkdn_linkpdmclktarget-module@38000ti,sysc-omap4-timerti,sysc crevsyscm IHfck+\IItimer@0ti,omap4430-timerI IHfck L)?Dtarget-module@3a000ti,sysc-omap4-timerti,sysc crevsyscm IPfck+\IItimer@0ti,omap4430-timerI IPfck L*?Etarget-module@3c000ti,sysc-omap4-timerti,sysc crevsyscm IXfck+\IItimer@0ti,omap4430-timerI IXfck L+?Ftarget-module@3e000ti,sysc-omap4-timerti,sysc crevsyscm I`fck+\IItimer@0ti,omap4430-timerI I`fck L,?Gtarget-module@80000ti,sysc disabled+\IItarget-module@a0000ti,sysc disabled+\ I I target-module@c0000ti,sysc disabled+\ I I target-module@f1000ti,sysc-omap4ti,sysc crevsyscC m Ifck+\IIsram@40304000 mmio-sram@0@gpmc@50000000ti,omap4430-gpmcP+ LzrxtxLXgpmcjHfck !$4Htarget-module@52000000ti,sysc-omap4ti,syscissRR crevsyscCm lfck+ \Rtarget-module@55082000ti,sysc-omap2ti,syscU U U crevsyscsyss m fckrstctrl \U +mmu@0ti,omap4-iommu Ld}Itarget-module@4012c000ti,sysc-omap4ti,sysc@@ crevsyscm I@fck+\@IIdmm@4e000000 ti,omap4-dmmN Lqdmmemif@4c000000 ti,emif-4dL Lnemif1jJemif@4d000000 ti,emif-4dM Loemif2jKtarget-module@4b501000ti,sysc-omap2ti,syscKPKPKPcrevsyscsyssm yfck+ \KPLaes@0 ti,omap4-aes LUzozntxrxMtarget-module@4b701000ti,sysc-omap2ti,syscKpKpKpcrevsyscsyssm yfck+ \KpNaes@0 ti,omap4-aes L@zrzqtxrxOtarget-module@4b100000ti,sysc-omap3-shamti,syscKKKcrevsyscsyss m y(fck+ \KPsham@0ti,omap4-sham L3zwrxQregulator-abb-mpu ti,abb-v2abb_mpu+ 2okayJ0{J0`cbase-addressint-addressx,O1Rregulator-abb-iva ti,abb-v2abb_iva+ 2 disabledJ0{J0`cbase-addressint-addressStarget-module@56000000ti,sysc-omap4ti,syscVV crevsyscCm fck+ \VTtarget-module@58000000ti,sysc-omap2ti,syscXX crevsyss0 fckhdmi_clksys_clktv_clk+ \Xdss@0 ti,omap4-dssokay fck+ \Utarget-module@1000ti,sysc-omap2ti,sysccrevsyscsyss m C  fcksys_clk+ \dispc@0ti,omap4-dispc L fcktarget-module@2000ti,sysc-omap2ti,sysc   crevsyscsyss m  fcksys_clk+ \ encoder@0 disabledHfckickVtarget-module@3000ti,sysc-omap2ti,sysc0crev sys_clk+ \0encoder@0ti,omap4-venc disabled fckWtarget-module@4000ti,sysc-omap2ti,sysc@@@crevsyscsyss m+ \@encoder@0 ti,omap4-dsi@ cprotophypll L5 disabled  fcksys_clk+Xtarget-module@5000ti,sysc-omap2ti,syscPPPcrevsyscsyss m+ \Pencoder@0 ti,omap4-dsi@ cprotophypll LTokay  fcksys_clk+8Ytarget-module@6000ti,sysc-omap4ti,sysc`` crevsyscm  fckdss_clk+ \` encoder@0ti,omap4-hdmi cwppllphycore Leokay  fcksys_clkzL audio_txCZportendpointOportendpointO_bandgap@4a002260J"`J#,ti,omap4430-bandgapjthermal-zonescpu_thermalN [trips\cpu_alertpassivecpu_critH critical]cooling-maps^map0 lpddr2#Elpida,ECB240ABACNjedec,lpddr2-s4  $4ANZgtlpddr2-timings@0jedec,lpddr2-timingsׄRFP:'LLL:|P_~@B@p p_lpddr2-timings@1jedec,lpddr2-timings RFP:''LL:|P_~@B@p p`memory@80000000memory@leds gpio-leds|defaultaled-heartbeat pandaboard::status1  #heartbeatled-mmc pandaboard::status2  #mmc0gpio_keys gpio-keys|defaultbbuttonS2 button S2 u 9 Dsoundti,abe-twl6040 RPandaBoard [I h q |Headset StereophoneHSOLHeadset StereophoneHSORExt SpkHFLExt SpkHFRLine OutAUXLLine OutAUXRHSMICHeadset MicHeadset MicHeadset Mic BiasAFMLLine InAFMRLine Inchsusb1_power_regregulator-fixed hsusb1_vbus2Z2Z T pp  hsusb1_phyusb-nop-xceiv  - main_clk$\wl12xx_vmmc|defaultregulator-fixedvwl1271w@w@ T  pp~encoder0 ti,tfp410 dports+port@0endpointOport@1endpointOconnector0dvi-connector dvi  eportendpointOencoder1 ti,tpd12s015$  fports+port@0endpointOport@1endpointOconnector1hdmi-connector hdmiagportendpointO__symbols__ /cpus/cpu@0 /interrupt-controller@48241000 /cache-controller@48242000 /interrupt-controller@48281000 /ocp/interconnect@4a300000B /ocp/interconnect@4a300000/segment@0/target-module@4000/counter@0> /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0E /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocksV #/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/sys_clkin_ck@110d 0/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/abe_dpll_bypass_clk_mux_ck@108` K/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/abe_dpll_refclk_mux_ck@10cS b/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/dbgclk_mux_ck\ p/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/l4_wkup_clk_mux_ck@108X /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/syc_clk_div_ck@100R /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/usim_ck@1858T /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/usim_fclk@1858V /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/trace_clk_div_ckW /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clocks/bandgap_fclk@1888K /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clockdomainsY /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/clockdomains/emu_sys_clkdmN /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/l4_wkup_cm@1800U /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/l4_wkup_cm@1800/clk@20N /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/emu_sys_cm@1a00U /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/emu_sys_cm@1a00/clk@20F /ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/prm@400F !/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/prm@700F */ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/prm@f00G 4/ocp/interconnect@4a300000/segment@0/target-module@6000/prm@0/prm@1b00? ?/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0F D/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks^ P/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk0_src_gate_ck@310] d/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk0_src_mux_ck@310U w/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk0_src_ckU /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk0_ck@310^ /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk1_src_gate_ck@314] /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk1_src_mux_ck@314U /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk1_src_ckU /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk1_ck@314^ /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk2_src_gate_ck@318] /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk2_src_mux_ck@318U /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk2_src_ckU /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk2_ck@318^ /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk3_src_gate_ck@31c] '/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk3_src_mux_ck@31cU :/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk3_src_ckU I/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk3_ck@31c^ T/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk4_src_gate_ck@320] h/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk4_src_mux_ck@320U {/ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk4_src_ckU /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk4_ck@320^ /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk5_src_gate_ck@324] /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk5_src_mux_ck@324U /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk5_src_ckU /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclk5_ck@324X /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq0_ck@210X /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq1_ck@214X /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq2_ck@218X /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq3_ck@21cX /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq4_ck@220X /ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clocks/auxclkreq5_ck@224L */ocp/interconnect@4a300000/segment@0/target-module@a000/scrm@0/clockdomainsA /ocp/interconnect@4a000000/segment@0/target-module@2000/scm@0I /ocp/interconnect@4a000000/segment@0/target-module@2000/scm@0/scm_conf@0N /ocp/interconnect@4a000000/segment@0/target-module@2000/scm@0/control-phy@300N /ocp/interconnect@4a000000/segment@0/target-module@2000/scm@0/control-phy@33c> /ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0E /ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocksU /ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/extalt_clkin_ckU /ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/pad_clks_src_ckU/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/pad_clks_ck@108^%/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/pad_slimbus_core_clks_ck[>/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/secure_32k_clk_src_ckUT/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/slimbus_src_clkUd/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/slimbus_clk@108Pp/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/sys_32k_ckV{/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_12000000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_13000000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_16800000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_19200000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_26000000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_27000000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/virt_38400000_ckV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/tie_low_clock_ckX/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/utmi_phy_clkout_ckT/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/xclk60mhsp1_ckT%/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/xclk60mhsp2_ckS4/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/xclk60motg_ckUB/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_abe_ck@1e0XN/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_abe_x2_ck@1f0Z]/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_abe_m2x2_ck@1f0Rn/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/abe_24m_fclkQ{/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/abe_clk@108Z/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_abe_m3x2_ck@1f4a/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/core_hsd_byp_clk_mux_ck@12cV/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_ck@120U/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_x2_ck[/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m6x2_ck@140Y/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m2_ck@130O/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/ddrphy_ck[/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m5x2_ck@13cU/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/div_core_ck@100X/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/div_iva_hs_clk@1dcX"/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/div_mpu_hs_clk@19c[1/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m4x2_ck@138TC/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dll_clk_div_ckXR/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_abe_m2_ck@1f0`a/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m3x2_gate_ck@134_x/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m3x2_div_ck@134W/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m3x2_ck[/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_core_m7x2_ck@144`/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/iva_hsd_byp_clk_mux_ck@1acU/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_iva_ck@1a0T/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_iva_x2_ckZ/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_iva_m4x2_ck@1b8Z/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_iva_m5x2_ck@1bcU/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_mpu_ck@160X/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dpll_mpu_m2_ck@170W!/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/per_hs_clk_div_ckW3/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/usb_hs_clk_div_ckSE/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/l3_div_ck@100SO/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/l4_div_ck@100SY/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/lp_clk_div_ckSg/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/mpu_periphclkVu/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/ocp_abe_iclk@528V/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/per_abe_24m_fclkN/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clocks/dummy_ckK/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/clockdomainsK/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/mpuss_cm@300R/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/mpuss_cm@300/clk@20K/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/tesla_cm@400R/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/tesla_cm@400/clk@20I/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/abe_cm@500P/ocp/interconnect@4a000000/segment@0/target-module@4000/cm1@0/abe_cm@500/clk@20>/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0E/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks`/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/per_hsd_byp_clk_mux_ck@14cU/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_ck@140X /ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m2_ck@150X//ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_x2_ck@150Z>/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m2x2_ck@150_O/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m3x2_gate_ck@154^e/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m3x2_div_ck@154Vz/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m3x2_ckZ/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m4x2_ck@158Z/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m5x2_ck@15cZ/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m6x2_ck@160Z/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_per_m7x2_ck@164U/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_usb_ck@180_/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_usb_clkdcoldo_ck@1b4X/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/dpll_usb_m2_ck@190[/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/ducati_clk_mux_ck@100S/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/func_12m_fclkR /ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/func_24m_clkT-/ocp/interconnect@4a000000/segment@0/target-module@8000/cm2@0/clocks/func_24mc_fclkW;/ocp/interconnect@48000000/segment@0/target-module@b2000/1w@0?B/ocp/interconnect@48000000/segment@0/target-module@b4000/mmc@0?G/ocp/interconnect@48000000/segment@0/target-module@b8000/spi@0?N/ocp/interconnect@48000000/segment@0/target-module@ba000/spi@0?U/ocp/interconnect@48000000/segment@0/target-module@d1000/mmc@0?Z/ocp/interconnect@48000000/segment@0/target-module@d5000/mmc@0H_/ocp/interconnect@48000000/segment@0/target-module@d5000/mmc@0/wlcore@2Ef/ocp/interconnect@48000000/segment@200000/target-module@150000/i2c@0k/ocp/interconnect@40100000Ar/ocp/interconnect@40100000/segment@0/target-module@22000/mcbsp@0Ay/ocp/interconnect@40100000/segment@0/target-module@24000/mcbsp@0A/ocp/interconnect@40100000/segment@0/target-module@26000/mcbsp@0@/ocp/interconnect@40100000/segment@0/target-module@2e000/dmic@0?/ocp/interconnect@40100000/segment@0/target-module@30000/wdt@09/ocp/interconnect@40100000/segment@0/target-module@32000A k/ocp/interconnect@40100000/segment@0/target-module@32000/mcpdm@0A/ocp/interconnect@40100000/segment@0/target-module@38000/timer@0A/ocp/interconnect@40100000/segment@0/target-module@3a000/timer@0A/ocp/interconnect@40100000/segment@0/target-module@3c000/timer@0A/ocp/interconnect@40100000/segment@0/target-module@3e000/timer@0/ocp/sram@40304000/ocp/gpmc@50000000"/ocp/target-module@55082000/mmu@0/ocp/emif@4c000000/ocp/emif@4d000000/ocp/target-module@4b501000"/ocp/target-module@4b501000/aes@0/ocp/target-module@4b701000"/ocp/target-module@4b701000/aes@0/ocp/target-module@4b100000# /ocp/target-module@4b100000/sham@0/ocp/regulator-abb-mpu/ocp/regulator-abb-iva/ocp/target-module@56000000")/ocp/target-module@58000000/dss@0?-/ocp/target-module@58000000/dss@0/target-module@2000/encoder@0?2/ocp/target-module@58000000/dss@0/target-module@3000/encoder@0?7/ocp/target-module@58000000/dss@0/target-module@4000/encoder@0?