;Q04$Q 6PȻ?ݽjho2DV%ͯ6YDXkGd('ERK32`@p`@p`@p`@p`@p`@p`@pﾭ'1) | Oo/Oo   P!:0@" Р @pqFI ̸p@h]_KJgpGwshh[hCa pGFH!F@H˻{p`~pH((ИK_ JB`_!HH  `~ps<{p Kk_ I_c_O2b_Zb_"cpG6nu HTF6!Fa eFH{p|p  pGpG8F FF0?"3@SB#@BؿO)F F8@>?D J pG6nR pGpGXРiРi 440 SNPР 8/Dq4ppGp _/_ РP/F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡC?@ pGpGpGhG J pG~pOR  (0CC0@ 0Cc0(Fs ` pG-H+M+h#`0ov$"%! N8F KIpW%E&DF ch[EѼ#h Gp H 4yx v 4TE5-HDypﾭp(pp|pO#0OS0#L0IF" FH@ F F传P(8 pG"F!j4@KS CkGtpFKF D R[h *0ս@ ӿ@ؽFKF  R[hpG J0KXhkGpGtpp N(4hBB!(FKhBKhB F5`pO0hppplppNh]h%t$o T_ h+DB`B0 h+ IC hS`@ I` phJ-E]`h `~p~p4p0a(_P,QL"^huhB% D:P,hDh``EZ``DKhB=BKhu`*7P DhB0h``p@h ԰h)DB6MB%"ca#a``AX`YPH !@`h2C``T29``D20`pG""h`` oOQ"Ҋ 82PT0=B#!@bh Cb````*[2T* n2 w2@TPB ~"|2hBBh"Bh~p~pdp~p-M0FM躧KJhhC ( 5-N%4ZPhBhBChhh#`D`ZhBZ`0%30iIBpGh'z*GCEE`sa3a``BY`Qk $+ ث 83\"Ph `E#F+[3T++ n3 w3@TRBث |3?#~#Bh"W//hۃh``F*qa1aD{hC{`thOW' B,0CCC,Cп_0"F1F8FAKC#_0H)F(D8@@@__! H1F,IkZ'@/zp05n6n8?0 ?!F@ DF8!"F(F)c(F8F8@ -M F FFF#;`€hhF(@L! F(4Bcc,bc `BaO2<<@`aH BhRl1H*k +D BrD *k BӞD  BD )kF(l1F RhkaD  BD (V"hk"jRhlaD  BD o(A k48<@ XFCF(1hzĹRhhD B@D @FXFGF(XFzF"hj*XFGF(XFGF(o Foo F#!FhFFFFxl[#(F##oO08F(CCl-Ԁi(%hjP#j[hXk0bj"Yl8`bikhPkj[hk0j#)lb#hiùclCScdhcl i+)lo 8a FG(o8F(7Cl 8hHi`cl FCcd`cl#cd(cli;+is F(h[j+ FG( FG(ohpGipG@jpG@ipGj[hXhpGapGAbpGpFJ K LB$ Fp0F!h8(D4礆p\ppIK[FHDB pGAhBH0(p p(p-M '$.J/K/JSC&BF5FFBܝ@,o 2h[&0 0?hP#O (K0(FC F6 2d ,F 5?%F(F,F, %F\pp\psFFFF_FH*F F#poO3]pFFahlZT4_<=<B cl F(p(F1FkT0#CnhS`Zh`pGTKFɹ \d \ ` F JT3MPT(  op JF K H!XCEPh!FT o \pp pGF p FP F0!F@T|FTJFHd0hTn8B Ch[hBid0FF+K# `(C FF(B! F(>1k) (, `#acaf```d hK`!aba`j FGF3k# h##`ci"iS``##aca F(F<`%o 8`o"o_o #7 F`FhB!F,;,Bo+`0j9,;O2P?,;,BPpGljB F,;sFFlSO,<,Bo"hB F,`pj8FF!F%`F8#F`"FF@FF48UO,<,Bo FB F<`@sjj,h`3bc`iFkj[hiKG0#kjS``#b#cFjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gp F FF#B`C`)F.` pQ,>C,Q,C,,)F.Q<>B ?@@_aOpHC0O\> BB_aJIBCC_b!**6/C@ Mb h"B`k"Bcj"bBDbbk_abjJB" a Cb!*"2Aa*sh CSCs`vh_+ѿ_#kdl_HJsh)FC s`Yh_)F0F1+G#AFF(F @#"AF(F 7BFAFK(F .1BF#AFC(Fw 1BF#AFC (Fh 1(F#BFAFC0Y O #1:hPl " "_D"h "B`@"B@""B"L""BL"""B"L""BL"""B"L"BBL""BB""B"O 1h#pC@#`_pK1_11+"FYF8F~h0##!$!+"FYF8F0@1+__"h8F`c#VM"1 "9hxh_#&`#1D;_`h_BU:*HHvGHs+ƬDK_CJl3i#3asi#Csa#!3"B+!sh#3(O`O|O \1L;;_`2`1;_T2_(K0!#CCC_D2 OsOsC_D2 OcO`S!Oh"`k"Bc;2!a*@apAp9 Z3}p}p@! " 1(F+#CA_#"!(F`kn_+?ox1_Ѻ1+_&.f3F"!(F6"!  # 1h"pB"`D"_Į##1DFCO_Dh@@`@ @ L@@L@@"B" l#2@CC_ 1l_ a#h_+!!_"h8F`#_"`_!`h_B; +zH"h_*۲'1&1 %!+ O  H!#Q -;&ahO CFWcE1)bHN رбo/^HO31A_ !!;CA3&!'Bӿ_l01CCC_l`!C%1@CM 1O;@C!1 ;@C"%&1 C' @#1GC$GCCEh(k p@(cQ_2h1` 0 0yo 0D9D1)D9oD !VE}pyp}pW}pph )F Fk !)F FhG 0phkhGFpG pG FܿpG8 *PD8(Fo%hiDh@XX_pG!F@i`i@!o  F!@i$@ihh#D@_ZP8 F!F@i`i*F! 8o  F  * 0, +J@i!V HzppFF@i!F@!`i`i!`i"!`i%p@!8 FbCiFXi!QF(F 88F F!`iZB"!`i"!`i}`i!ix"`iFsk)F F8@88F'(F'F(F O1`a F 8 ( KZi_տ_ "`KZi_տ_`pGi ! K8/ *\i_տ_`\i_տ_`iKZi_Rտ_!Y`_"a_ `_ `_ `_Y`_`i Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-9ApxGﾭﾭﾭﾭﾭK|pwUp|pAUp9Up9Up=Up !1A"2 0B  dzpc vpupcup)upuptp|p}pzpzp{p{p  rk3288_sysconrockchip,rk3288-nocrockchip,rk3288-grfrockchip,rk3288-sgrfrockchip,rk3288-pmurockchip_rk3288_nocrockchip_rk3288_grfrockchip_rk3288_sgrfrockchip_rk3288_pmuReturning to boot ROM... FATAL: unexpected command to back_to_bootrom() U-Boot TPL 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09) DRAM init failed: %d TPL: failed to boot from all boot devices BOOTROMalloc space exhausted ### ERROR ### Please RESET the board ### fixed_rate_raw_clockfixed_clockfixed-clockfixed_factor_clockfixed-factor-clockrockchip_sysresetrockchip,rk3288-crurockchip_rk3288_crurootroot_drivernopramCol detect error Row detect error could not find correct stride, cap error! DRAM init failed! niu config not found rockchip,rk3288-dmcrockchip_rk3288_dmcns16550_serialrockchip_rk3288_vopaxiahbdclkrockchip_uartrockchip_rk3288_pinctrlrockchip_rk3288_dw_mshcgpio_ledsrockchip_gpio_bank~p~p~p~p~p~p~p~p~p~p~p~ppp p ppppp$p$p,p,p4p4p<p<pDpDpLpLpTpTp\p\pdpdplplptptp|p|ppppppppppppppppppppppppppppppppppp p ppppp$p$p,p,p4p4p?DpGpF FS0o)F FM8"#F6@BؿO)F Fp@6?D J pG6nR pGpGXР3Р3rv440 SPР 8/Xqx _/_ РP/F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡC?@ pGpGpGKhKBKhO0pGdBSYMtpGppGFC3O#aOOp qK`` `]popGphMFBѽp@F@# F p'VhG J pGxOR " vH (0CC00 0Cc0[( v( pG-H,M+h#`0o$a$"%! N8F bKIpW%E&DF ch[EѼ#h Gp H 40@ q 4TE5-Hiﾭ(L(dpO2 '" H@ǹpO#0OS0#L0IF" FH@t Fs F8LC,%%B J؂B HBӚBٱoHBҚB-8 xppiF F i`Ji`h a 3"q#`h! Ji` i@`h @1FpGi( pG-M hF+F;+UHoTN0h;h+(;+O@F}FFLH$$FChB9h0h(#o%?Ho FO@F0`HTF(#F3`6HoAF5H((2Ho0hF0h!FF*H0h~FPFiFo?"FFAF0Fj@"F9F(F(Ftphi9FiFxDF9FFPF:Fh JB.Шhi1\H|pxqwqIqqqqOC#F2]P(8 pG"F!4@hуhhXBXApG pGFuD`A``1F(FF8m F`'aG`0Fh``#iբh!hh`h?1!?D o L@$iFh@h?1!?DB#iբh KS CkG|FKF D R[h *0ս@ ӿ@KS kGpG|  R  B0 pGFKF  R[hpG J0KXhkGpG|0 D; DIB @BH3 2"F r!ݿ FFFؿ8(FF*F! F8<pGhKBo pG )ۊCjB pGhDDpGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o]( o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO1hDDCh`pG7F F!F(F4( (,o  F0(O48hFDD F(` F8"8hFDD F(` F8-AF#FF FT-O4 F-!F8F2FAFFX]+2F@!@F]@+!FjF8F/FF F@F  F@~-MF FF(Fڸ%%BF!F0F^hF0F yB!F0F:FQF(ѻ@(F 0pFFF+F8-h0F R(` 4 FpFFFFF;"FF1F(F7 JF F+ )F FJ +h0 8r2rs FIFFSO3F*F Fp@r-A xF/+ F5/! F7(FF!F8FF88F(DFFBBРF04/+/!@F(F4F)FBF8F(F%o8FF F!FF(F8@8FF F!FF(F8@-AF FFO0 o BBFB3`B@FF8F("]pF F)F Fp@#:pK3pFF"O1(F Fp!F(FB"!F(Fo-EFF8F5%FDEO5 F/0 EذBTF52F9F FP((FoFF0 +`$ FDB-O3 F1C#DB-o-(`F?8+ h+o F]o JC o IrJC XrFj +h$ FF(Ho(drJ#J0Ia@  qrxrp FFPI*FF# Fp@,p3p7F#O00"B o P"0D"02-MFFF(o(F%'DB +T;c B"YFPFoO3BFPFcCB BѻN%O1 O1XF(( 1`FBT;F?5F FF:FT FT Fб(xC#DB )FF&!F8F0`FO3-AFFFFO0AF F(۝00 :F1F F pG Jh "t h(@ho-AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH}rB;?+pGFK;,FDB K ,FɲxFBpG*FpGFFx3)pGFDBFx2,8F80F,F F8!FBFًB F FDBF9DB xO3DɲB FKBFOzrF33,hFFpF% JA*FF LbBOr4 !D @0 p4ׂCpFF0F F$EbEBAppFNB%F(5F(Fdp #FFFdQ (hZ`ppGF¹-MF FFF%) FhGEFix"-) x550) ##0 +#l)'`i)#q'%)ʀ)иF00 + c)d)u)V;(у #`0# 0##qp_+ \# yC + !`-![B O O JH!qFBٔɲQ )OWO0AD ;I OшV)O OPO"sF Bٔ۲S +OW O0 SD 0 O?[#; !` 0PV!#hpCF3#`F:+O0 O #` 2YF FhG :ܸ?)? FhGʚ;K FFhF ]RK ]pG RK p]pGK\D C9(Կ08W8pGOppG?npx0+CxL\D۲x+"0F%&F0xB `(Fp*"* "?n "ѿFP hkiG pG pGhkhGo%pGFpGo-AFF FFh,<,3Bo FhBChB@(Fj-EFFFF#hF<+|"! K9F##jCX*F1F FpGFG F ;F*F1F FF E`Go%osF FPoh,<,3B0Fp F5hBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% hh,<,3B FhFB BhE8Ft`\Fjڣ F193!;#A19!!9!?a4%%a`CargD``𵍰FJ FF!ChkRF F)F;FlF0h F o r8F`#"#h\k+h<<<43B8 FokFF)hk `ShG pG7F Fh Uh#`hkhK)F FG!F0jh*h#Fo0F##`l%JK `!F(F0r0F#JI6##`!F(F0r+slF0h#hkiGFpGo%pGp FFph[hksiKk)F Fsip@GFpo%F0h#hkiGFpGo%pG-EFl F(#DJDI&BAIl(8  2FCF F:Iz6_@FkF2F F3IhosBF(5B_PFBAFPF&(!8FFo F;FIlF F> GEV?SFBF FI+osB %BB_PFpPF1hM(r s2s"s!b  pGjpGh$j8" FFIl!F b(F[#%`ca8KsF F F hF_F!j2cjCCFpF!FF(FFX"Il b"Il`b0Fpssm_JR\@+9 X_Jh_ $Y KXCHO@?o@B6n FE*G*0_2#Y K* FF@B00_?6nB*FFC*0_0_#Y08FhY!F@hziI*@*9o$A+Q#y'y'y'W'W'&W'&' Ҳ/Ңr*(o8ҲF`h8@q@B`h8@F4F`h8@ch_!1H4H6nlsiFz+ FЗ+*h#hFh(hiB і*ѿ_O0  Il( IJ@_Oo<pooss8FF(F`` 8 J I` 6Os`OsFC` ]ss8L_O %`hYh;C#CCC|SCp#_CQSh;CCCSC_c`Sh[;CCCcCp#_ `_O`88WF _(`/0khm_lh-h_OLS! FJ#e! FJ2_sѿ_ Kcf_ K0_ K#e8 skj1s38F F_O@3! Jep2_[ տ_K#f_K0_K#e8 Ei11?-AFh FGhF!8FiFM,1@,,S%,Fo4A +R#+++ + +) +)+)))*<,4%o ҴU,,4o%(Ft,@BCorDbKBl^KB ]KB&\KB%oZKB$P`_O@ "+eTK!(F22_ տ_NK+e%$$ h)FVv?(EH)F(Dn"3%E,G, ђB"BB_ "F1F8FAu"@BCCCC_0CCCC_0h)F0D2B,0CCC,Cп_0"F1F8FAkKC#_0H)F(D8@@@__! H1F,IkZ'@/j05n6n8?0 ?!F@ 3F8!"F(F)Y(F8F8@ &-M0FFFF#0xhF8P! F(o (F4Ccc,bc `Ca <dO3cdad bCh[lod;kk cl Ccd9k(Р`[hkIcl Ccd( a3hk3j[hlIcl Ccd(`k4cc#d` FF(hc[hhclC@cd FG(F3hj+ FG( FG(@os4#KFhFFF0Fl_ O3(F#/oO08F(FCl-Ԁi(%hjP#j[hXk0bj"Yl8`bikhPkj[hk0j#)lb#hiùclCScdhcl i+)lo 8al* FG(o8F(VCl5h(DѠi@clCcdiS F(7ѣikl+! Fr(,+i+. F(i{#j[h[hZ+ FIcl 8#j[h[hZ+ F Ih[j+ FG(cl#cd FG(o+whpGipGipG@jpGP4?B #<; `pGhki42B #<;` pG#`P4?<;<BojdhdhB `kipG@ipGj[hXhpGClCCdpGapGAbpGF#ihlKlt!C !pFJ K LB$ Fp0F!h(D4p}(p}IK[FHDB pGAhBH0LdL-MFO &KL\'=FB  .F 5Ѹ0FXF rC+(FF7(F.F(((sFFFFFH*F F#?poO3]-MH0܀7M8LFF #`0F3I 0FUFd% BDF B 5D B CBD4(=(  0 30FT"lSջ[F!F(/;`p}p}(t)-AFF,h%@tc(F Ff!FhH#!FF8F^FH.F!Fh5F@t-%pFFl9cl F0p( #hl[T4_<=<B ((F1FkT0#CnhS`Zh`pGTKF \d \ ` F JT3EhT dT(  o8yFT  lC`F!TZF K(FpFT 1*FFTC6.pi pGF Fp FP F0!F@TTFTJFHd0hTn8B Ch[hBipd0FF+C# `(; FF(:! Fo p)k) ( `#acae```d hK`!aba`jc FGH+kSci"iS``##aca4` ##`0`o"o_-AFFFVO,<,BohlB@(Fj#7 F`FhB!F,;,Bo+`0j9,;# F `e0R?B,;#`#h`jj2B,;` pG7 F F|,`0O2P?,;,BPpGljB F,;#7`K FFo0(R?,;,BЙlB+`j#s F`op(T?,;,BlB3`j#s F`op(T?,;,BlB3`j8F#FF#`FlO2 "F(F8@o8sFFSO,<,Bo"hB F,`pj8FF!F%`F8#F`"FF@#F`O"FF@׿#F`_"FF@ȿ#F`n"FF@#F`"FF@F##`n"FF@ F!F@ݾhF]о# ` F0#h#@FF F #h+oFF8UO,<,Bo FB F<`@jj,h`3bc`iFkj[hiKG0#kjS``#b#cFjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@GF #`C`-MFF0(FMۧ%(F)I(G9FFȱF(># "h)FFJJ 0o F3EJ,  (FIKp(FIFFP(F I@<`$p$$4FFo tOt]ththB1P1 pGph1@P1>>>+R\Ҳ_p ph((RZ_RZRZRh((RX_RX`RXh(( _RX oF F!]7FChjFF`kh;+   0#`00hBRمh@Ni,%%BG-E ijlnp F^F(Ї#kP+ Fd(F/F! F:F(@H#k+ 0F zXd ]sOB#a#b`d0mF1F FzJb`I\IQ#0OSC"%i#gf1Cc@-O C|CCuF 3  #E CXCO O 5Or(D"0$&(*,.bgackZ "2"1F F`r`n#O3d0"1F F`_F(@# Fi0F(@ Fz FF(@bhoI*7#H0d0Fb F1F`1F(@3#3## ``S`1F# F*? LF(i0c+ r+rQHOPKFPc`HjbhDCSbKK!dB-O ? (?#d0#@# # Fl`S`F`0պ 0BjCbORO^jj0M@#xs"+hB+K5B*H*M#`()J)J)J)J@sCs0$KKO khV+@ кOк_7к_Ā"!o F f +O @EohF-A@ F#h FkF;j+2F)F FAGhXip@ F FF#hkh+2F)F Fp@Go%pp FF7F0FzB Дi0+)F Fp@ po{FFH &0!FH  u!]hFk FF##OslJIH#FO3cc#'``cCs;~r #`0(Fo%uu_Ch`OzsBhh_R;FpG pG8CiFB FA)?l+9ИGB:iKD_#bha_bh`_ch`_JchbBsahj_;)ۿ_Ocha_chbBsbhj_;*eai(8 pFhi Fi+УSBSA_bhach[o_ jC3_bhSgkC Fp@G##3Fp-MFFh-h3C?3# FFchl_z@_O2chZdD0h+_chahhSC_bh! Fb1 _chb-RkhOcOs  * * CCCSՎTC@CHHCsCB B_chbJch[l_Y@"_bhSd񚀘Ё Q[ɁՐch@k_ 0chk_0ch[k_0chk_0- &kh`P ㍪h 3[`hi ziv0Kk+ !!lOzsXCB8Fx`OchD_ @MD0+ˀ.Ȁkh+@(À_chZdchl_DcQLBBF(1F@FO pE@݀BDv?#0Fom0F(7Fh)hZCkh+ ##F(ѻi ? `h! F+? `^F1_O0ah_ahNHhMIh+ZCO\O L L h+ 2`@`F;  ?XF!?Rchh_CsC _bh`ch0_C_bh0h_chahhSC_bhb+F:Ԯ{k_ 0 ;`bhl_;h;J|h`{hBom_chDD(@khfh+OOFF0_8Y(F;zl y砆ch2_@;+chl_DcѻhLBBF(0FBѲB6 ;`Hbhl_;h;ѿ_"chZdX!0_12&&o&&_"ch chh_# _bh`d om.FoopghFk FG_&ch! F^`(E+h Fh_O2chZd_#ahKb_ahJa_bh0_ch`jkchl_ C3D@ZCCCSb_bhd_#bha_bh`D0+_"ch po h` K`a`hC`j* #S#CCCCSCC`OsCa0f8F@k F(+k *ћi+d!F%( F 88FkhFb(Fj`b"IlKd#feeIlm d"Il(f!Il]l(IlVl#IlpPoIl( J 8ou9Yuuuuuv-AFF(FF(F!FF(F($ۣn s[ZCCCSdl00Fd02AFA #e(#m(FP#m;`AԾFtF  F@BlF)` h@tc FI+ FIFB F0F#F(F I( F(!Fhot[vkvhk opGpFl F($ F%I (F1FxZ !Jl^Fo% p%B V%jFY h#FFFX<#hbhh H5 J IjRhRhZ*h!Fk[kGuvvvvv-M} Fh"FIl#h+o }x+#` 1FB# P+A+hEhh[hB-l#\C% CD[i+LgHZp;hj+)F@FG(h0@9O Z0hjBѐB/қ0+ $+#[iXոh$  0E ћ0Bћ0E0XkxhM(x (AF 0+63nQF@F F 3O ": 9hr0yh)@Fm 7 *hhh)W!^^]^^^]]]1^]]]]G^Yhk+?J F)FG(Yh[k+?>)FG(Yhkovl-AhO $ pB ѧBih`iz`*zp|EnxB4pFFKBFXPB(Կ  JBXYB#ɲ!p+`0Fp (OԿ&&>A#ɲA#ɲ-EF F7l"hh#F,,O7^i1,RXWhh  F SF!F0Fjn@D@!F(F e8F( 0@@oK@ S+B*0(opGFpGmK S+B0(opG n-MF!FFbJu F((o8F!Fu YJ0( F FFhDih XhB+0O`hzU`(DF`z3ݨini( 9ۺFFk.9ۺF&F2!!diDD Fhk58(  dF4FD%jB%jB'l20 F`FaF !FqF&Fc hCi6\|B `Pn0CPf5 hC^j6\|B `n0Cf5oFvv-E FFF, O FXk 0VhhsOw5F!cBX\B0d˹9F(Fl"@#D9F(FF0Fp'#@*-E FFFFh|hPh+9OwFF, O T!cBX\B0d˹9F(F"@#D9F(FF0Fd'#@N F)#DFhFXiUhhiF ;|D1F(F#"@@C1F(FShkhGo%pG F 8F %da0a(F8ph )F Fk !)F FhG 0phkhGFpG pG FܿpG8 *PD8(F8 Z@#hk+i+! F+iG(8 R hkh"GpG0hP-G(F-IF(F+IF!Fl   Br 0:!8!F(F FF,#T!FTHl(( H)Fl 5()Fl (l w xx;o%𵉰F-F(FbF(FBo ' `g`:FIl a:FIl`"IljF`9F(FhF_`abi2Il`a(. # a&#*x5x?xKshiDh@XX_pG!F@i`i@!o  F!@i$@ihh#D@_ZP8 F!F@i`i*F! 8o  F  * 0, +J@i!V Hjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHP$ pDas U-BoothhRUNTSERVdP! mu #??OopGpGpGpG@pG@#???OopG8F FA0?"3@SB#@BؿO)F F8@>?DpGpF F$0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF  Jd8pG/ J pG6nR pGpGРBРBUIPРX T@H((0 SHH @ /T <8 _/_ РP/@ /0Od@P TP  Q:< 80QR:/D# kl#iF#7]pGs0F[k`H F1H!G("HG1KIt,FHG%O@'O`#0;  FGp0k  j6 E pGF H103 F HFH F@EE^ s pFF(F0Fpo!F(F(FO6F`IC (^H@  0G%@$0C#&@CC'@CcLBLBHb )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHGk (obox  F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYkg Hb HL] HPX@ORHFs)P L P :P pGOCiF< E`HEHq)HE.г+ ++@0h0+tK!0F.rK@"F1FE4oKCl#kdlHhkHhPF(+њ000000 0 @D0000+0YJ! (0 THwTHu+kl+kЫi00+ 0 D0|}5J)D@Ւ0++ #BFYF (D0o` 0 01F Oc0F0PF (T PF, F& o PFHo HEHE-ƀHE KR'Vp333$I&s?1&?!?0  BJ BG BDcl+=Д"0+ZH RcF(OH0ONH0J#ԔXFo G FBHEmAHUmRD0F0FrF(E{"8-4{P#FObAFXFF ?*?(CFZF O:#FBFYF@ GF(QFHE6#FBFYF GF(BPBPAmFPHE O -?#FBFYFOpGF(ѬO ~7pG-MFJHFF0FhFO 0FDBغ!@HE#FZF(FMF=) Z,f*!@FE\J GF0HE o0)8(F (FFH)F JBv3H0[F`Dr#D+F0FJI(B!IFHEv F  HEj F H4EE<;b CV-AFFF&B۽U FD(hD!6Do FFF!H/P!E,F #:F!F@ H!FEG H/F(0FD EEo-E FFFAѓ"0+(O -0&FW(D0EED0F #:F)FF@H!FE3FQFJG jF!PF+H/K(FF j6EE0oF I(FE#h5RF>!kF"F  0 &*p FFF/0H/( p1F(F0G5o @H!FEjG  >pGpGFFFF+F1F:F FG0+дpO0 KS pG\hx *pG3`hFBhHE+w-AF xF/+ FF}{ñ#0(FDFDD*FHEo# }Or!iD)FD HEBF IE+F FfhG( +h;`&*sFF FF/h!Eh( 3F)F FpooF@h=h: i7`i4i1i. j+`j(j% F@ -E# FFhK`xF )F )#) F+R *#k`44` ) #*0,IF+"\ *ѧ(`X#E(h3#0#(8(F(7 F!F@)F FJ90U(pFFIJFbh2!JC FFFCDF`1F(FF Fpo a(U(L(𵑰FFF F(!I F{ahFF(Fhch2! J3FC(F(;`oT(](-MFFF! D Fo F9F(FBF:F)F8HBn'($ :F)F4HBepo_}( 'B$ F@o'('h,=,3BsЫlBj!(FH1F F;(PF<PF@(IPFJF 2! JC (60Gp$)*a(U(L(FhhkF FF0F;h F!_ P3F*F F@4ok2F)F F@GZF hB -M!K"N"LFF6p!D4 'FFE8FO:`hBPEF8RF(FB`ch(+)F HB~ )F HBy(ZFAF F\8FF4*)p F!FF02F)F Fp@Ͼp#FFF#nbn3fR#Po:F(F#h`)FHCn0(FC()FH 3`f(($IK[J2Bo!QXB`j#I"oq@CHb4-EOFFFJKLUE@F#hB:FQF F(@FF  47" hF F ` j(RohBo0(g!h @P0_#+ +`o-AF#F FF0HC F+h  00Fhf[o  @sF(砱O3(Ff(FaF(3`=`(Fo(80F Fch#c`0)Fh8@ F8@F@h:8" F!FO3cg#%`#b8oٹ-AFF%ilo!%ghl2`-#h`%a/o#on3B#gP#0`1F F(la&#h[)co!fPh"i3B`bhijF F5xh[#c`0gn0iFlCiF FQiBiF F(h$pFFF E5)F F5P F@Ax"ooS"0`0jF1F Fohef`P9F F(l&#h[Ԡa9F F@(pFF!h"F#&a%bbpF@jj kmkll`n@ظiF3#S``#`C`hh FS``#`` F@jF+jO(o oF F jHZhIjC FFFHC F((@h(((`(H H@h((H hk[hGFpGhkhGo%pGhk[iGo%pGhk$iF`Go%pGphFk FhSF!(FF)F Fhp@Go%p-MFXFHiV F(o8F!0FF(>O ]F [O QF >`BhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFi.mpGpFKF*F!JC kBo c.1FF F(F6p#d#bo j6 FlFB k/#bcoFFF!jJC|i FWF!F8F.i!F8FPF/3`+`9-AFFF@F)FAF8Fq F.;*hBAAF8Fa`"#1F F#.7+`o Caa 8Fh`h`iB 880pFF H-D#F3pXxKhC(FC`0pp`h(Kh(F7F |F(` F07(`iB08-A0"M"L  1F /K\CBkh+ 7D5\JI( "AFHB O3BF)F#>(笝H))) pGp FF"!#k#k J#Fop1F(ARsF FF!"FhCOB"`F*FpK` ^)𵻰 F عci i#fiF0FFu/F:h1F F"K(`W?+;*F/Fo"O1 FD("lkA "!lA #")FA( IBF+ HB(Bpd(o .);4GF-A FFF"!0F#<j1F J(FtF oAF(F(SsF FF!"FhC^OB"`F*Fp-E$FKF9F  BFIPFC"!F(hXhF :hB;` oog)&*(H F-x(F"!C#F 6F8+d/!B`4"FbjUJjJ!+FJCJB(c o 0F7#b0F(9F2_cO6l).)j6K` {)F FK0KFK` j F F( F-H)F4KHS!p-P;FOq0FJB H-FH-FH-KJ(F-F;FOq0FJB L#Foc)k!),j6)-Miư F+b4I0FAM0FA50FAp(U-I(FA>(F,IAN`iF3F" FVF(9#Fb#H-FFO 5p  AF0Fr;F2F!FF2xBmCeo0FAd(o ge#e(FFoo)))X!-ACKܰ"F   #$!;JB :H 4F !8H-Fع6H-ر!FBF!3H "!0F F@O1.H-(o F\)Kh(d%H-(A:+l(cF#H3F#I"H-(!FBIFF@FB!F8F(8FAd"!F @!FH-ne(e#bmCeo g)))*V *5U*j6X&*8mFCie F(( F8@K!F(F8@˾-E?H F!-F iio((bei(FF)F F)(O#l1F2"# k.(A ic@EF-;khi !%JB,!k" AK/! A^#p@F3B($@F2k"k0m3gmm[3F2!J B! (o=l H! H-F3F2!J BV**X**KFpG T d#cbpGSK` F8Hi FGhF}+IH йihH-i H-j H XFFk8@`iF8k*s*z**-Ei FF F0F((6OH-rp)FB8FLH-jFHo(FGK"@FxF(}FBH-{F(0co 2FAFrkU#&db fi6i+U0FFFFBF1F F*KBF1F F'KHZ?+FFF!H@FAnb(@"O1 FF!lFkePIA(HAQd( FI84wFuorFp**U5**j6***FFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-E F!FFF ?H!F0F?Q)FSF:F%FEE(x,h?`h?AQpD532-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFF?(`L#9F0FJ>h#`#*-MFFF> !F(F S+ +"9F(F>DIFDHBO0F1F!F(F> F ;FR (F {+ +"!F !F(F $>F ,#F#FRK$!u"FG F DO4O E4BF1F??F D  +-MFFF>ۺ ;F2F!F(F M>߿SF2F!F(F>(F FFFF>cCF*F9F0F?>F, F>*FFIHBR F %+7F>>FHB@H,F$ F0A0#F!(FJ>>FH1+?+G+U+-MBFFF$ F!=J(F>OFFEAF(F>]#[EBAF(F>O8:FCF(F> >F'HBTFAF(F?f(?O !F(FJ>,8F>fFHB66!F(F J>(F>>FHB<+++++H,OEEsF=>FHBt!(FJFAO03F!F(FJ> >FHBV4F Fp HA80!F K(F J>>FH$,<EE,yD,S,s FFP>*FF!FHp@Bp~,-E+FFFF #2F.I.HBO4 F=i>&IF'HB!(F%J#!F(F K!J>M &CF  B \ C# CCF:F(F !FJ(F>+>f IF H>` IF HBTF03$2 ,)+BW, -#iF#]-A5IF>(a%1I F>F F>&FB7)R# F>"F(IA=8%IA-P$IA,0б X0p6FE#&9F FJ!#9F FJ5 F>[6FBCF( IBB0px+0 (-1-:-R-L-B- FFX>&FB 1F F>j#+B1F F> hQ#j1 DDo +c` (F6#"F FS>(KphF$HB p F=2>jFHB 6ai )" HBi+ai"H BHB#+` ^----FHg Fd@H_---MF F=F F=B! F8J>o F=F ( -# )F F=FzFBF9F@U( 'H :FSF$HBF5#)F F!J?Fp)F F> H)FJ F>O (7 OCF:FYFv@( HZF3FvHB )F F=FO../._.-MhFFF+{h0F=X0>HP ;HP,@WFBoBF :F1FXF@.E1HOR9FXF+@PF0+H@ZF(?R?2!F"D&HA:F!F0F>(7"HxC k l dAEtXFB( F9FDOR@(F?R;?21FHs`2DA4F@p HCf.y....%/.-EF H! F9`& FW(6cl+FД"0+B!hIHADjF! h+5CH)FA6(F=(t@HZhA.ݨh(!AF((Q7H  !F4HA F2H F10/Hk  F;+H+H+)H (H@ PFUF=S$H,&i6BVEh BٓBH8QF0F@05F!FHA%F)FHAPkh;`khBHs00f.05/j///////J00 pG-AFF FF>( =HAO5F)HAQp0B#6c" F F HA "7I`h@O0(FL(9F1HA*.I"`h@F(ѠhAFF(FT("F9F&HA%I`h@F(FhAYFFhAYFF iA9F2hFCFHA(F1h(SF"FAFJKFBFFHcG7Pr6F74666V66J[77 B!HWpFFSF8. khx-+HAO4 F@p&aL1F0F#Ozv(F_ HA$)FQ)F">7-AF+ FFO0" Iph(ChbB-hKB)FF3A`G W *!XhAF!FHA2" F@FL7 F"FHA%8F#H"A]58-E@vHk#lk!sH#krH#"lpH!hoHahnHhmHmHAkH@jHT "hIhHABF(VFdI FA)FbHBFBF`HA-H!F^HA]H+F\HA\HpZHtYHx~!F )xp *j!F ShOHj!|NHf|MHba|LH^aiKHZ i FGI@!FEHAn#hCOh ,=#h,3Bkljh ;FCF-MFHO,hB THKJFIH F@@&HHHBF[Z (W& H@6.$h>cj6%>> pG B!HTW*8FF IXh?t@- !4`h 8! F!>&FF7F- 2F9Fr`hx-+ I?MP I`h?HHahH@ '=4&>??M   -AF+ FFO0" Iph(ChbB-hKB)FF3A`G TW *FFIXh?F$%F#  W%#5B  %Y?HpG(hBh`hhZ` pG#h`C`HpGCh` pGphhFiBjB^h! " H@BHihH@Bѽp@HpSA???phhFiB'jB$^h) "H@BHh"hh;Bciyk H@ah H@Bѽp@HoHp???a??{(h K ih"X3hHF@u ]? hhhh?-MhFh)>9 IF(4OUoBOH HV?2IFXF?"IH"7#F;q F(FV,yhRVFM%@ %F" F!F*FH@ (FRFб#FH"F#h3F)F0F9(FwJKBF FL@ "@!KkD@" !K@kx@Ch)j3BC`pGi;BC`pGi23abpGj:;abpG0F F8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF| 8(7iro`(ѱ%a(F9 9F?hLL IA\AF7H!`CaTF K J K Ih Kv K(FFM F0LWI~ X{oA| -M! ZFHOa S`8 FO8F  `#a%}%/0OOb)Fh%`*F I0FH:Oh.h B@,hW FTJKBF$! FOFaaB(F(@𯀅KJK(FhKIFdhJByIS'0mF(@O 0(@vIS'0SF(w 0(mmIS'0?F(c 0(Y ! F@! F(@F< F"S'7)Fp@F_F6kiB6(FX/W#h+/u h hGF/V-@ Oa hF(?VQF0(F0;JCF@T(7G(OS CF$! BF(-Caa/4"##"## hh G/ Of/ZFCiGF//73H(FDOXF@KB?/? AI~ X{|AH3L{A!F(`OD/"# PFG/$ B'"AF0FpKFL F("`q!F(FJ((FF(h` Sc(Ї9F4F(@#,#O1 F(͇pk8 1F I2F08F5 k$! F(CaaKrkI(yM F-@΀<0+ip1j>F(ڀF2FF F5fhph.F(̀2F/9F F23F8F2  D F5JO1k8FO1k8A FHkO1(F)FF8"%sk 80 4F(PF"EI6F Fkpkh0j 5 58F5@F5(F2F F2IF(a F/IF(W F*Kk*IK(L*F F'K(IA(B*F F$K%I7(8"K#J#K Fh"KF+ KB?ODF M F2(FN'F.1F(FGF H$> Fp$$Kh?e$CDU-A*FFiKhiH|hH)sgH> !Xh?1-FaI`h=U( A(9F\H>!?FYH)MF(`WH)GmFF(FhF=0F=XFPH)7F4F*|MI>CDLH)+FKI(>9&IH)!(lFH)8cEI F>(4CH)F (AI>D@H)F (>I>D=H)F (;I> D:H)F0F(=0F=(F=(F)F8"@F (F=(F8!@FBFAF)H>8F?8F?qF9F$H>M G!HI H>zI> FI>HU{DDDg)CDEEU( *EEE&E,E2E;EBENEED E;4oE* "!Xh> 0 $*?$*X$*C$*J$*5$*$*5$* p*FH>T "p#h`hG Fh,p8+F2FahH>; -oII$*$*$*0D<F MB  4B xH+\0F Bb -AF8H F)!>F!F0FF1H %BܽA-H O7-*H 0F 0F=5D0F=0D&ѧB"F1FAH>%H>,4lgBHA>V%JHBBF >5BH> OBH KbB;Fq]F H>5NNNNN;4hcj6O O OFFH>jK!F`H@) O+O-M*FFO4K"IXh=F(~ѧ FF%x-+!>F/9^б-?0F>c+ q+'?+  8%-p0#$ ~Kh:(EzI{H> F)FxH(wIF:c(5oK1FqH`(p !>zJhB/FgHFF;/(:vFbH>"`Ihh=F(;/kFh>RH@F(!Fh>E/FChF1F;:GFJH>!F(i>.FFBhBDH>u0F$8N3h?H Si">Ihh=GX0h(:F7H"7Ihh=5ȹ/h0hh::F/H"F0h;5(:F*H"*Ihh=F(@ڀ/h0h : /#ZFQFK0h;(:FHZFQF0h:Fo*FHx(3O\O+O;OkOOOOO[P_PPPPR95QPH#(ix<+1EK)x>)ЧBܙH7!4X$P"(F>5*x?* 2`23Q))FHF)x2 )[+*0MJx])F )14X$0BS\Dx])?X>rJ3 CFlM=f(F=S4BDBED5hhxg+@#/ /њ0s+)i0h :ﮚ0n+s+H/F!F0h:!FF0h:0Fn+/!hi>FO5{BݓB 5n* ]E !F"0h:F@F!F0h:Zښ0s+@Fi({O;0H>!FZF0h:F(q)oۚ0v+` 'I/ "!i>NF-)F F-"hI>O6. F=7D F=0>DBܦ!F'&.۵T& -QP OQj6fQYGI>t7B1FsHa+F@F(1s+.F:%FHp+#l+@O//hQF0h: ,D)F"F0h:-F`"FQFqH>WO $-(!FkH>G(FFhH>?")F0h:EF pxbK)FaIbH >+4,_H$_J,?cl ")F0h9hF 0h:KkhF(cѠE:I>H >E6I;H > 7H>.I6H >E3H"2I=h0h:U/0h h:'(!:NF(H:(:DF$Hhhxh+@/Aѫhxg+w$N)iV =G4 ,jX$h ?imQQEXQ)DXQQCOQQQQQQwQRH P>H3hHZh,F>@3hHh >:3hHh >43hHi >.!FH>*3hHi >$,3hHi > 3h{Hj >,3hxHYj > 0h:FuH>tI"=FH/h>3hai"lIhh=Fȹ/"Fh>"FFh!F>BF;F0h6t̻"]Ihh=F(]ѫhxp+'0h:EFVH>VH>E0AF0h::UFNHݻAFLH2>a+"Fh>"F F(iAF>:F#F0h:p(:*F;Hd+(Fh>F0h:(:F2Hͻ"1Ihh=3Fع// Fh>!FFh><0h"F9F0h1»F!I"hh=F(/Шh>F0h./F0R?RVRlRRRRRRRSS/]S:SYSsSSe$c pG*O0ȿ pG pG$)$)$)$)$));)-AFF")FFFh5*#h)ЙՆZ <#h##`1F H=#h##`)FP#jF8FF0iFH=H/_{=-M*FFF@*^h4"0FI\CC"F1F,4B=3xs+c+i+O4t+&"(FF"F)F>H=!F8FF F&&&6IF02H=瞹F}F)F,H=_!F)H=$..F_Fذd !Fk$$H=_FH=7$B H-?{(FX7.$7'u9_<_[_q_z___R__Kh+H o` `7F F@+F"!F0@Ho0*$ F"!Xh=F0#EF( F H I= FH  ```*-AFFW I"Xh4@hCF:F1F(FFA`GO0HXFFF. 8FpFH=  Fhh=ZFFH=!F8F0F(FH a,aHaR0H= ]iashFFF>FH.$F"hh=FFH W%.ۮB ")F )F H=u45- @ pO6 aa* 0lH=T$O1Xh!=FF H=F!F6 F@FH=;  K`aaaFBhlH=#clաlH=H= FhhChhRhH=aa b*6 ~h,<,3B  Fj!Xh=vFF6 F(!FH= 0b*sFF(!Xh=UzF0FIH=$. Fh=CFuFH FyH= FpO4``C*sFF,!Xh=iFBF0FIH=}$ .Fh= F F( Fp*F(H=_O4``C#\.*D@x08pG3+O0pG-M*FFO4 FDKBKhAKhAKhF8s$1FF:I;H=$!Fxh=!Fh=Fh(Fܸ!Fh=FF_F/(')F;F!FFF)F$H=GEO!H =DGE b K`K`K`KH= ^*H  H=Z``Hb Nb16 -AF+FO5(F!ph=!Fh=Fh*(F(F5F@{9F;F!h=!0i=!Fc+ #NF0B <1FFIH=G% Tb`-MFS+FFM !ph=!Fh=!Fh=Fh(F@F!0i=F8FF8k)FPF:F I!H='8FSFF!FD E ЫhC`#LF(B <!F Ipi<(ѫhRF#`!FCFiF(оTb`?*-AFO0Xh!=F!Fh=AFhS(F!h=6!F i=1F@FTHk;F"F1F(FIH= )FL(``*-EFO5(FXh!=!Fh=Fh (F(FFs1FFع!h=&bFD!FH=CFF'D;+ܺ 2FIH=5FIH=/%#!F UF  @F" 4FAFH=\b``6-E*FFO60F@K@Kh@Kh@FF@{Y9FF(R8I_h!!Fph=q!Fh=lFh~(F,+Hٲ=*H %DD K K` K`, !H"H !H=@,F'KB#F)F:F(Ѻ%D)FH=#F)FF(FIH=&{,Tbbbb1{b`` S P-A*FFGXh!=!Fh=Fh(F7@FF8k )FF8IH=3 !h=(( .F i!=F+F9FIFIH= FPFF8FF FFO44@#F;x  _PF kgܺxкu QhLP0;~ ( FNI0h;*FF!FpKH<3 F!BF@ BKFH`FH<$EKFJ`FK!`EKFJO6` #DJp#"DK`DKpDKpDK`}AKBJ` ((& F& !ò ;۲B6 w_S ?S+~ eFRh#&OO ;p##{p 3pN#pK 0x8q{q2(eeeUeff%fdff   F F_V[XD?۲ 0Bѡ _! :Ҳ' |/ ?|3D? 3Br (lSN@ڀKJp#`JHp#"KpJhBH3`+@~"+2q!"+rq𩀂xO :Ҳ:` "+qx`@(@yH+pO@qxHrOy+ :pO-2rqJ@y+pO#rrN"+r1 +r} +2s|"#ss #s~#'s3t#3p O spY# pp WK7Dx 0 p DF?ݮDD7 OKhOK`@*hG"IK`A?*@@BJxB"BKhG0S- >IF B8F ?(B@l'''''' ' ' ' '#3p##'spY#pp7qK 0x0qsqqB!Kh!Khd'  Ozp;o?&"KH`1F F52F1FH<&1FH&c!FH<K`$  Uf[d5ee*-MFF:|pKhKh!F ?;F)F"F(F:| K5D`Kp`!h 1FibDiJiNb*F O0pG*F {O0pG-AF+F-!8h *!xh/V'!;GF#r-7/ V'.!@F:4F(;Р ZFAF: h  # |\||u| L! hpH !h0{+  H b H[|*F5Xh!:!Fh:OF!8haFh#F2F9hH:o(F(H:g (F"F1FFF K JFBF H:T` O0H[||6Pr|*-AF?Xh!:!Fh:!Fh:hF!Fp#F2FH:(F(H: (F2;F"F1FF K JFBF H:` O0H[}|6PrC}pFK!hFF(Ch+H:$ Fp.!hh:lF FvF(H:hH[Z}t}*-AF5Xh!:K!Fh:F!Fh:AXF!F*F#FH:0F)F;F"FtF K JFBF H:` O0 H[}6Pr} L h(( `!P0 H 0 H[x-AFEFF:0 H O02BrHeE EId-MFFFȹ !!Hh:#BBE/H SF"F0hXQFph:;0qhH:O0!`BA H C#H#:ʃփ-AFFF" FWI bChB -сh KB h;F)F0FFA`GO0 L[ p;F( &HMh,<,3B pl H<KlB+FbhH:}j,%(FhkZjj jH:-GoFOA@8bF(OA8ZF8F 9FhFkjG!Fh  RF 9(D,="Or!0F8%|:F)F s2xI+F*YF FI:S0F9 5-1F Fb  H:aO0 }ODF = ;4j6)-EF!} FF!Or +CjF ( !} "AFh: xFBFù!F (//0JOq :. h h +0#FJH:O0&*.{-A*FFO4MIXh9Fȹ3+hh (v.(i F"@H:?Ihh9{8"A:Ihh9nF8"A]4Ihh9`"1Ihh9Y"/Ihh9RF-H-K.J%FO X+OB(H M(H J- :!,!X$H:o5#Ihh9*F(.ݮhh0F9F-i (:F1FH:U$(F F۲r#)FH:G .|g{_8h8ot$38TN%]-AFFT I"Xh \XChBhCF"F9F0FFA`GO0[$KK!F"FKH:Z "iF[hhhChH:@G*-EFFv&FEih$H:4F F #9F(FkF(FjhH:  Z#RF9F(FjFFkhH:@F9U(7Bۺ o$Z# !H:O O WFNvċ*7F Kh H:f ! 0IXh9FlhZ U3,!FH:K< H:F HYh:A!Fo (EdЋ9_4_** \hZ !F J(!F H: Kh+H:O0YhH: d%H0FK~F2" IkF! hP(F +hca0"og)A*-AFFW I"Xh @hCF:F1F(FFA`GO0[0*FH$F0$ F 0*/\h! F:B(!FH9H$h#J)FaFH9F,Ob I H;O4l)G *j6)-EF1HFFF$,#.J %F(N*H$F!((&K&Ih9"&O *F ( >N*F (H$8`0 +*F (*F (V) o Fo  *dPhQ\*"H$&б!9(#y FX H9 FH9$HO4l)l*sFFO4 Fp"XhF9-F"hFh9F(F"0F"XF H9$ H F( X H a$  "C ( <(#zF KFB 8S )8! F<8I(F8!?-M*FFO4 F^hI0F88F(@lF90Fx+x+Y:+Cx+"F09Fx+ѸR" 9 0Fx+x-ѸB90Fx+x-9F0FK!#09F0FJC(:F1FqH9$7F&FFF%OFCFRF9F0FbM+hdH0FbI8t(?#X9<0x+?Lx+G*h !##XF(*h! DBAeFCH9r0FAI8.(0F?I8((0F=I8"(@𢁸+h10#(o @#x++4 F ''9FB?x+ݮG+h1#ZD[B.?L#$(h CaEt< F"I80(h`###Gй H9#bh3-1gGJ0WȏI8(@ʀH.h8Կ#K ¿2Osb@  ( SD 8#F  CEm 2 2-r)FH9$A !F8F M\l|hh8d d @!LH931)F@(#!(H9$ ! 1 !H 9@F7(0F7(!FH9縔Ք 3-EFF F7)FFSH8, F, B(, P(W,9i}([, FCH8 ",!h>H8 "/U|"sT#6U!chF;+4J5JR# 13H[8@F7~( HSFBF)F+H8)F*H8, [( 'H8lPF7Q(0F7L(ClF9(4( /()F FT#;pwllƃddp^;4F "!hFiF F0FiF} ClhF(CliGаq ?$?Os"F$(!FH8P-MFSH81QI@QJ F 1NIOCMHNK F81SJH8 FGH8%FOEO1CEAHM8𰾕?H8 !=H8/U55#*4=DN!gh8,_8BI6@(#O0o -MF+F h 7hF xKhH7[O07FFh 9F83FhIH7I I`h68H7?(F HF8I`h6F(5Ѹ2ьH7-!i>ta(F*hBфH7H70(؁HiAF2F;|(F {F@F0F,wI`h6F(Si[ !F:TD?4$?@4 nF G AF(F$?C aH7!F(F FxiI0(WH7O4WHF7zAF(F#F $Fi,@F)LI`h6_(U#iJJ{`JKB HHu O4^F BO:AF(FhGFxh$6:PiO00F Fqh#H72;hhF[F I7 $0F BH7" !F0FK =!FH7(F #!FH7= %H5;hB H4)FhF7#<F_i;4F KFh5H7O0(F 1/F"`hF71F(FBFH7o 7 (F!F!F H7(F3h I[FhF7*F!FhF7 l~pFKh6H7O4 Fp*"`hF7F0F`BFH7uo $"hF7)FF0FF()FH7^ Fl-AFFT I "XhXChBhCF"F9F0FFA`GO0\&O``F8h FF H7' ` (`0;h HYh7 $h+H0F Fϩ" $KKFHK7c  e F IiRhj"F[hH7 ]@E*8 FF!F H7, F0?"FF H8@7*F!FH!F8@H7TY𵑰" oF(R 0Oi ".K .K i[h*K+Ish)K*Hj)K7h"F'H)i"F&Hi"F$Hi"F#H$!J"H):F%JH):F0F"FFFH~&FB FHhhr6 36ªӪzh T!0=IF0!F@FH7*8* 8]hI(FFP)FH7 F o M(h( H7O0 F+hZhFHjH7VtsFSFZBhFZAFp,} Hj7 F%(Fp!FH7,ѱhH6kd "phF7 FhB2iBڌF2i H7FDF(бjHn«"sFSFZBhFZA:Fp-a Hj7`(FA$ Fp)FH7UFFph7FiBiBH7DHF(бjHJryFhF"FFx.8F Hj7(F$ F)F H7FFhh7tF8FF(Hjά "hFh!pF@Hj7 F$ F9"hFF`TF@Hj7 F$ FX-MXI h)G*?"~F(3eQHj7(FNK(!!MJMHF(FR"FFIH(F"FFFH(FlFshh"h:B;њh@H$ F=IXh64(;K;I;K. (Ff+O?+#F9:FIT4(EO5^4!8 *-AFFW I "Xh@hCF:F1F(FFA`GO0]#0 FFJ 4&,H6eF F 0 ! H4&H6M,F4}*FF[hx-*[xa+!<5,'&BK>HhOd)!b)c)O0%r)t)*^"O *X"O )&F*M"F!'(H`   RE[xC  YFH6y "F!FH6r(FH6k"AF ^F"F Z B?zH0 C0h H,4t[ @hٱp!F"<,S_.x-.iF F!!o.a.f.нp@"),FH! p=*[h J# 4@ ]O04-EFF.FQ_+x-+ =!(F5Fx)F7H6 >?+f+_H1J.h`0kBF(F,I4 0 'Z'570BD FF!FH ;F &P+:F)PE&pџBKW# 4-8F+ K)FhH6gO0b^4t[0*FM/0 M0hh!FȱOa FJ6 "!FH7(kh x JiF#8" C p#" O0a޲Y*FF")O0pGKhpG^ K0#0Or x3iF ]iF  Y-MFh#FFF 'F^F ;-`h x-)4!6c*F!q>4/OP" !V:H4:7K8Hh6 s)b) c)O0t)+S '+OF#)dF+EO PFM!64FI6YHo ;GtP"!H4۸9]* U8`1 H ;F"FH4t[5P8 pGOrF!t@o H "O1z"2SH5npG pGOzsXC5: LF70@J@I` ?HQ` >I` =I` J4PIZ4)F Z4 Z0 D  DOZp(F45+FSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F48=!F4Op0F0!XY\F!0[YB0Fn50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%ec F!&F!0S'0B00F;027 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F4d #+T(DBp!(F(F7Kh{o4J`FEF 4D;h C (FDNF(I4;h(F&I4(F 4 7h(F I4(F4! 0BF6pF;!40( HX5K8 V;F43+6] ;43j-MFF"!O8O %'  HKpBFF9F HOrm"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH5x=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhG$M ! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H5S#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?oj"K`~#|/?K E?'?Ϯ!?~EѪ K! K##Kh]$  8M,h\ K(``KaC`#`` 88Hl ! "5XFH SFH_!FH J q H2! H @ q H(K F`8!翷?ɷ׷-AF$Kh=k-9)F!H5ZF(H#$\ ,0#0 F4&FFH&!FH%F524FBp4d@F4zl8FA"O1ۼ" pG pGIK [H0pG<@0 o @0pG KF H@ R@ @ o @ l epGP0 ~C#P0pG pG0IFX@0Or\CT0XKF [ht jtpp0Zht p @0s@ ]Hn *p°)Fw $FN(h0H5 BpsOr @I H,1F5v$(F F;4j6O2 !HLF` 2 pG pG pG pG pG pG pG pG pG pG pG pG pGyP D:"P P D" p p Rh2"x xP R"P P xt pGP0 s#P0P0X0pGpGpGpG !lD@J2D0%FF ;J;` [   >C '@@@pv @ @ &C _8F <!!R  !4C &@IAqd @ A $9C _1FBшB H4~(F!J2 |  j6gfff; pG"88 8PD ` wPU(H ahF C H41F H4H40H4 ]i-qFFH4 F \ ` \ @Oq~@  I K J[`T( D( %y!@   pG pG pG pG pG pG pG0H#3#s00#30..2P_ pG#pFJ0FH4C@pF( H44$ FpN4hB)F3($h"K`[`K`pG JF("!$`d` F8Fhj[kK(F0)F H4O0 KZh\`#`Kb``h 8`!X#S``#J`hC`B` pG-AO ){H48BxH0x[E2ДQ-tH0F%Oz1By&ok1# p F D9F" %!"&!;xDj#C&!2&!) )VHADBTHkSH hC#%ݓNHn %!"p D9F D)FHBDHhк?AH hC Fp2F)F FI60B5#hn FA!d##!AA "cFH)+H4bo f gBp3( ")F@FH ")F8F)F "0F! #BF Fj! #:F Fb)?ۮ #2F FXIӻ6Yȼ1#-Ah`FFFF0 H3 F1F(FnF(Ѹ(Fd#ih/`#"(FAA H3Bp3.(FAC!(F=F(i pGFFF,Y(F Ch+h;p$9 i (H3#;p3p(F iFѽd#0hn#D$##"DAu0d#pA, *%)%hn#D$-DA"#AVpd#0hn#D$##"DA?0pGi #8 pFnhC&d#"#FA#AF, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>1 3BF1F(F(۸@+7/O O4oг $$Bp2"F1F, "1F(FA1F H3$"1F(F2co$-MF:}, F&?(`"1F(F(7x1F / '(F:F(׀:F1F S3yx!#rq ""! yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/q/kѕ1+@##d`/h+hn"A!d##AA(F#A(y(F(&q, F(FO3c&gz 9Be۔H0"F3B8F 2d/d0&`azp a 9BQ&O 9BQ0K#0KhB\#0 ,@4S@s@h#,9i8Fac1+.݀+hnA!d## "(F #AA( :}i66"1F@F61F F/! ([H3ko `D`{h `z``a6`T 9 ; g#? LJ BД 20{iB11F(F ( 2!;iB"#ihS``#  C F2:iB"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F+AF(F+AF(F["1F(F|"1F(Ft"1F(F7i2*a1FH3o4_(/V @'9i "a pGFhhnA!Os#"zAA"!#(#h9%H2 hazhA!nCA@AA H2 hzhA!nCA@AH2 O0IpF "!(F@C h0hn&A!Os ##z2FAA!#,H2i hazhA!n MC)C hzhA!nC)Cw0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA.+hI0F zD4 CD@D0+ !F(hF O CECFFOs !FSF(h F(h 9!F*h9 E&(h9;Ѵ E 3ЛF  DwT#sa# F%0$0F j hKOzuisBp2=ѣi3H3Kao #{+ 3x++ 8 @Bp#++O0 玾-EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0F#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x3O0H2F:FFi(ۓpLF "! F` ##p0)F[cp#0#q@060 F+ # #0+kG`p@-MFFFF*c F#F !-Lz0#`4P]E(!i%HjC "`*""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ !] d8F  DD@-MFFFF*c. F1F ?!1-Lz0#`4P]E(!i%HjC "`P(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ ! 8F  DD@Oshn#D$"#DAF-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)FsssOs2F# h-( FZO0FchA02& hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1FzwT0USBCUSBS7} '%0 H3h 0FAhH3^ FQ5)"K`pG,(H3FLH!h3A h(̿  @B[,-AFFFL&!1+Eі"1;+@8"AF F'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fczzc{ z{!{)0K+02H21J1K1H2 +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!bK$9(F( ?O# I#SmLؿUOM[L-MFF'L (?hSrz0 "! F ##p01F[cp$#0#q60 F+ # #03kGFP?oH2DO:0FB0+єL0:+єM0L BdH2-k{+/sPF@`H2Z .p\K@Ԙ0"+#ks "I OO "^(Yb "!AH0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO n! "+Hi%##p01F[cp#060$H+ # #03kGx "H2shO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@@J :-EF , !FF(F8$  F)0h'hn _A!Os#$?3zAA#"ABؿFOȿ;F !$J2#Os0I, }#F(\#FCrr1F(FF+030F( IFX =(F 7F(7Eډ,\brF BoS @B0-MFF1F$,!14F0F00F+ `F0F,!1woF(=FJ'8F!FPF@FPF0F8F [\F!F8F( @FZ(G$ 4B0FPF,%JKR(`S(B(pC(@UE0F !F8FV% jBF@F5-M'F"F[&B AF0FX@Fo5 I1!F(F1(F1FB7!F1Z&Q'@,4 F1(F F1AD@FzF(@F`o  FB-MF#FF Bjx+xC#BrSCu#`c``)yxOpn D xpaOD+z @rO D @rDyoyO plDypb:Dz0 0 G aa#bd[Dd&e>Dbe abbb048<@Defe'fgffk|##fj|RLCCfj| Osf!F G5x p%sF1BAC H#DB x\ *! FpY FO0|+"I1(ѣ|+|(O0 -M) [FFFFo0FF(#} #~@+F:F!6 |+D|+A%}5#Pp0~ *иݔ *є b:Ҳx*)هp0~0+иݔ0+є(#+܀0+F:F D(њO5x"#@EB# I )(!Dx A!A B3P۲#o%moj-AF<F8HA2P||H2IzzHC!2B#zH@2 bzCR@3@20P 2(c{%{E%{EE{EekИI1yEI1(U?eI1(YEZE)FH2b|!|rH2"}M KIFK+FH(FN.FO/FFAH2#~~I}K~HF2a}}{H2 ~zJ  F)F@ F+F *FtHtJtHtJ2tH2#0 qH2#0_oH2#0lH2#0jH2#0gH2#0YeH2x#0bH2q#0`H2j$0 ]H2c$0_[H2\$0XH2U$0VH2N$0SH2G$0YQH2@$0NH29$0LH22%0 IH2+IH2(%F&GO'0&?B)>Л ;۲+Aj=J2 JC2z<Կ # #5HR 2&5E;4`/D[mquyj6[.#cz6Nf~1YќD<+7<+3<;+ (FBF0H2x5B-H2q(F1F)H(F+F'H+y'H[kx+xxx2UDF1F1(< ,`o-MFFm(}){Ѓj+{h+VOFh  M#i FG'FW ?hBѣi+Cbh0H(+%jB,H2biJS p $+F-hS GU ]F1K(=kh 0H2o m#h[h 3`iGF(%j+hBU FhYF1!(=oo-EFFF(7FT oB wF88F1k ` Fo V ?VF9F0(.F kjjb```j3b o-AF, FFF=F#`Ba aG`aab](F1#`8 Fq$ F` #bcbFرFU ?hBѠhZ FW S N8FK3F6ho8*(K\ pG  F! F@H8F F@Bp1omii+"#aD pG:B3pF FCa p+Ai1 )Aa !Aa!ɲ)L]ɲH"ЎLA Dɲ+(S,рL β."4J4JQ\TҲ*1J!T9,рG,р(F:۲+ؤF۲+!(F=,O!(Fɲ[!(FxA,1!(Fr>,=$ɲ(FiN,?|O3=<@?t~!H, 2!(FVC,4䲤K#DITTTT8<FHWF JIY F!F(lF(FC F8o"FIH1oBO4)0 8p1F+o Fp!1+ѐ"1+ѐ#1+" sB P F?H1zxF)ѓ)2 3P"!@!Fh3K(dY9xn FA1#hA!AAA)`( h`y&`O3`" F=# " FMh Fkh*l)h Bڴ !H1&P"1FI0#KKF(u H IF0(?k F)FBFdLjt)jMk-ADFFFlFF)٨"0c5B "l;F FAxHF -AIF#lx+TєL0#L0&'9F" 9FF" 7H/F"lx+ ٔFB# FxC.) WL #?`*hnA!"1 "Os(FAA!#m"!lD&Af++єL0C)* 9+ s0&ElIiiB + #3aD ph(FKh l h'((FfK0hN+Ozw'Dl0hY0B#h FKh l h( F@ 00`ii b@"!FFy|ZhhBQ`Dy`t` nh*" ` ) )h*xQ)" -LQ[(O(jQD`q1)  TXHDPLYy[)QD`qhQ`Dy"t0(~(љy19)T!lUlllUlUllly2)0)ص~("`!F`" `" `" `|" `x" `t" `p"`(l"q f-AFhFFF{<8 +(#hBNE @F;h;;`H#h;#`+x h + 0D#h#3#`50 `(xH#h;#`nTD-AFFi)Z )F chT)K+BZKdPj+@m!h)fhHv2F)D `(D0- P"h1FH*D1 G D3F>+B <#h;#`#h+"chTo #o+phBhB\$#h3h+ #h;#`B>6 A2F)D(D0"h1FtH*D1{  >ch;c`hAhBkJkH1f ch"h;Bc`خhAhB_H1Sch{sh)N] +'s\ *$bhR@Fc`2)D0&`&B@F&B#'Bu 7>F 6 6 #h;#`#h+ah)?U6J7H1 ch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` c+'KS!`.#h3ahY1F(F0V(F0!h``BjAj+I hBH3h`BĿ#`BJR#` N 1#h;#`JH1 &ch"h;Bc`j6_\{hBhB"T@i0fchjFD#h)F`i@(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D0#h1FT"h H*D1I#h3#`>? #h!T"hH*D17-AFF FF0"F! F#%a#s`~F.D#hah+B yB EѽYa`T"h!H*D1#h3#`-A0F FFI hO0FJ`J`J`JH`J3+@+pB# `8FOb)F# F-0.0! /4'JF(+x qOñ!+:hrK)FS"0);h3+̿3FF;`gKhBiJ`h3` F:hdK`,vFF}6fF(dBAox0QF8F6 ,FƲ .# .ZS&rsscsssssssUsssUsF..*.2E##7H#p`#+pO02H;!F(FF+x +ѧ!F(FF@3B .#8F#pI,DKD#3k3t3#` 0D_\HߟDnT"KFp-MmFF F0#FF(-#o #-MF%O@@;`[&0BZ&0S%@ kK FG(K`5-AFF$( OX%0BW%0S$k 1FG4-AFF$( OX%0BW%0S$Ck 1FG4F$ONW%0BV%0S$kG4$0+ $0Y pc$ppGFIFFF/` FI/0 FI/  0- 59FD8  !FH0 -MFFF$\\Z%0BX%0S$ѽ0YDlSBSA4 "B9FXFG4I /{[ -AF F$, OB4, *FX$W$( m cS+@A0DFK F m@pGF' Խ@ R0Խ@F) *0ս@ Ⱦ@[KF !BZ` pG"$0+BF DB Q0 F@տ *0ս@F F@ȼ0]NF!$ _ȿ$0ȿSwj\B DO3!(sb$@ ] pd$x1K H@ ( B "   R B0 GmpG @0 нppG8FM(h FlG#+`8 @0 HpG F(j# FGpF F(j F@G(۽pG Kh  0+(( K`Kh`FpGKhpG"K`pGFFhB 8F Fz)FFH,'F FF(JB$P, F8HH` I` H` Ha HHa IaO3 zzxQy]z pG" -MQI Q` NIOH` NI` LIa0KJabFJH^FIHZAFF sYFF nQFF iAFF YFF QFD $% 7IRF$ 4ILF.O 0IEF$ & % HF!H F H !K-F K,FK(FFH)FH0)H!FH0"H1FH008FC0 ,Ѹuss5sGsx6{>Fp N(4hBB!(FKhBKhB F5`pO0 FI`I `I`!ipNh]h%t$o T_ h+DB`B0 h+ IC hS`@ I` phJ-E]`h `__0a(_P,QL"^huhB% D:P,hDh``EZ``DKhB=BKhu`*7P DhB0h``p@h ԰h)DB6MB%"ca#a``AX`YPH !@`h2C``T29``D20`pG""h`` oOQ"Ҋ 82PT0=B#!@bh Cb````*[2T* n2 w2@TPB ~"|2hBBh"Bh___-M0FMnKJhhC ( 5-N%4ZPhBhBChhh#`D`ZhBZ`0%30iIBpGh'z*GCEE`sa3a``BY`Qk $+ ث 83\"Ph `E#F+[3T++ n3 w3@TRBث |3?#~#Bh"W//hۃh``F*qa1aD{hC{`thOW' FVHE% " FI.9й,! F.DFF F/?F)F с |%(F!F@H.(lBlH!F@8.(,8F0P! sF,F F8P"!F FhKHldH3dd `  `o,!-MFFoFmF&FZBѻ3(FI.t6. llNS``# Fdd`VHOB  "(F1.%H @ XFE.H%5-$ho 0,K HddpG,0> F,0%P"!F@I.KKKKKP"!F)I.K"K#K&%l= F+0#bhIH/e0wy{  !!KpF FHsFx% .&! F|F F(Fp!F*F#4FsU&*-AF'AF48H/  )F(7BO0ʰFH `!H8 ? H/- R H/"!hGFH/ʰ(-E FFF'8F.!.x@F.F#'FO FBѺ*F@F!h.^8 h.wB'F  4'FKJKIZCÿm۶Fih H/k!hH/g`i H4 0 KU`-M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``.(  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`(ѸCF !2hH/5"F1FX%88{ 5;kBX%H/ %7F FF , (O KOs H0(OKhhOs}!j6-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F.A8@F.JF$5? U,F$ F5BU .3PERF@FU.(ѧBJF$ FoK-MhFIh .F 00F.%1FȿH̿F.(FK xF , ,t5A+FK< , ,- "0C,-WvJwK#uLuH*FaC '(q([ и q0U .@F."F@1DBPDBy$t0 02U"pDo ``2S x$+и #IK!Os(((FpAXF.XFQZF#-?A  < 2E3BF۠ ܱи 0U .($, "xPFU7~H.FH.N%F pX HH/ 0F.'{M+ HHX =DHwb|m۶;4}! 8F F.( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O #G_ ;4-MFFFO pL)44+.+@O +404,-^04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F.4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7 } o$A$- q4+#)4Q(4+  C a434F V#)4-Д+4?|POo(4+  C >434#pG FL4;+ ' $ !     M#)4G(ڽ@H-#0&KS HpGDVIK[FHDB pGAhB08pFz L J Kp@޿0FciGch3r Fp4B$8pFJ K LB 0F!h-`hp48F$ F!(-E{F+SHEϽh;)O)LJVLHE.')K5) ) k)ܡH*CK@BHI^ 0})Ѕ) o(F0FF PF.Fx#RF9FHF1F8FF(#0oYF(@#{+#hH+ F]-M F!F`Fx"FHFH.Fo @FlPF"(F-((FyI-(:!(F-F(F-"FFcT4:FYFc ZFkH.FF̱#x FgI-q F.AFx*C *F_H.o o8hz ,BCiSZFXH.o O4,*;ZFQH.o\ iO 193!;#A19!!9!?4""a1F8hhc%$2F!F8hF lB4,ѽ/H.9N$2F!FF!F*H.-Bb%Fx"1Fx"0F,F,6 "0F!I- 1FH.8hFi193!;#A19!!9!?4""a2=,]X]$-EFFFyFбh۱$ hB2F!F8FhG o FQF@F-u(4O4o%-MFFF Fy BF)F[F8F,*F9FH.&#!(F-kF((F-"sTFFBF8F  6ZF1F1FH.qPF, FX97F,hFk,H,, KJ;,Fkha3 I.-0K J},FJJJJwz$0F$jF!F(F4,$ F0F FFsF8FS( ѳhB ,DB4o! o%o-AFFFFx FF FMAhCF:F(F1DA FFFp FF F4Ah:F(F1D@-AFFFFx FF FAhCF:F(F1DA681FU+-ѐ1+)#FrI  34, " I6,\ 8"IR,S( O0O0io@3 ?%?+F"!FF(FO0F(F(ѣn+1+Цff-MFi?3#?@3 :` OFFx"!@#?  iH--O3{`xh7F[F"AF0F(BFqh`H-!U)Ѫ*[H100Fx`( rF p)xIL)y)I0SEEѸ @)>;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,,R+y9ISBSA*x[*C d SF-%" P,+yu0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`,PPIS0FAA;hD00:hSF Fx`1$(F"#F]-MFi?#?@F FF FH--7F W$?#F"(*F=H- Fa(!8H1bxsDF{` y(IE+$#y+I{h4Bј0*+Ѹ 0PFAAjYD-ZF F3FEѩ(a" BB+LL*D!x(Ѐ)IKj1FHcF--6( F*+Ѯ)IKj68>2FH-"#F FDd8 @BpFFFFF3F"(FS(JIH-g$ Fp(F-O4 Fi F-i-MFiFo FFгrN"3F! F(3x+'*FahkH-%O:"iIp,@/+FbheHq-O 0[0E 3F"YF F(3xk"XIYH,F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,,6)F  FB@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#Os' 'd8$M"#jF!]p#!F0ahH- p H-% )F#H5- #)F F0~# Ip" F M0#\.#2$*;#$0Hp/ i!FF@08D?4$?@4 ?$?#F"!(F(JU#!Bsty*Z@@(3B 8FO0F`"!hFD"iF F, 8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF \")F@Fb{#{!FC#{(FCC{CbM"F @FBSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PARTFC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : aw" Oa"$0Cw% p#`&0+1 '0005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCb?# tctCtt-MF HF(|,zІi@1F0f?6&?@6 ? +? "[F!(F(F_#FQF(F(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF FjiWn"8F8 "9FPF,Ph#"QFflQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F0 @ F(Щi0F0I0HFA!J0KAAAaSF2F(F^BPFQ P0UC#R CCS CcT B"VBBWBbZCQFQY X0C#Z CC[ CcB  IGNOREMEFm Fi8F0+F"iD0F ( ;F"F0Fl O0O08oiF H )FO00h)F0d(8 8i8!F0Z!Fs#F"F F( bi# FV:CXBXAp-EiFF!F[ F00C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@F-O0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`{JF ! -;I,+"I F,00@ @[H@"dP,>@F a$P-Mi!FF[ /%D?4$?@4 O *? QF0F `6(FH-#FH- EH-EH-P0hB7F Fh5(Д!0 $`H("0 FHH#0Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- K+. KK/ KkkBF)F{hH,100 5B"203BB40BbC#6HCC7Cc,!F H, H,~.;GXt-AiF F[ !F/D?4$?@4 $ ?(?:AF0F|`x(F )F8,Nxh F7Fo-Mz`iQ0FP F@ R0F@@S01F@`8/1F@/f?6&?@6 ??*"?F{"!(F;`(F;hH"!p;`JU";h&!"ơ!aji1F:! !(FRF(FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh#Y0Cb{Z0#{XC#{CC{!FCb[0F# tctCRFQFtt#F(F(Fo7FI0HKA!J0BFAAAa{h(FtE F100BFA!20(FAA30Aa1{h[Ec~!~~A!~RFAAAa#F(FJ(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbi/`E W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(Fz"E+FF"0A !H0 8DB0 H" 9F   B Ppx75Q2FD]"qoLoIoFlE# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww sCiF;" 0! B" #0$P%P&P'PCi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/0o"() B* +:F0FLPMPNPOP-P.PP0QPRPSPT0UPVPWP%tetttXPYPZP[P8+@ @B-MiFF[ !FFF/D?@ !?}F"F!iCp!F/D?@ !?hF@(Fo  F"F!CFZF)F0FSF:F)F0FF(:F)F0FF8F(FO4s#F"F F(O0p0h!0 %A!"0jiAA#0:Aa$0C#&CC'Cc+B#(FF8O0-MiF!F[ /N%D?4$?@4 G *?  "U#0F Gri;$?F+F0F:F! $A!" (PAA# ,`Aa% L,& LL' Lc) E%* EE+ Ee- 5F&. FF/ FfFjW\fBBYYE3FPH,-  4x7oW ,*ЃBB FHiF DFBi! F6(BєQ0PPT E%R0IEES0EeU0B"V0BBW0BbH0jCC#JCCKCciqY X0C#Z CC[ CcO0O0-MFFF(@F I0HQ H(J0(FHHK0HhP0C#R CCS CcU T0C#V CCW Cc"3F#(F'8FF#F(F(FXCYF8/I0H fA!J0KAAAa3FBF(FE F'I0HKA!J0BFAAAa3F(FEc~!~~A!~RFAAAa#F(F((FO7FP hkiG pGpF F$(h(,o Fp"hB(hF((F;pFF|#z(FF(F(*$!F0F  !khJ,d+IF(Fx"@K ~Q4, *pD#JR3@BHh3+H`JFF$N(FV4+@KS4`s%(F4,}.OB&(h,<,3B FChFB Ѡi B F(jd`#-EFF `FFh,=,3B, oo(FVhFBChCE(FȿDj,=$F%F)F0F P;z;4 X8F5, F({+ FosF$!F(F P3{+!FH,0F4pc7 FuF0)FH,| F0Q7F FH,z F)F[FЃ H,lo F0((FW+{+obohkhGo%pGFpGo8F F )F F8@h8Fhh F!F(F8@Y-AFF FFh,<,3Bo FohBChB@(FjF h@˻(]K ]F0!F@-EFFFF/#hF<0+Di:F3FF0F +|K"_iKAF##rC( F2F9FGFB i:F#F F FCF2F9FGFo%-EFFFF+hF<0#|"!iKQF##rCMFP@2F9F(FGF{ F @SF2F9F(FF E`Go%-AF FF#hkhS2F)F FhAGo%o?ooݿ F!#`o7 F8(F%`0o@sF rFPoh,<,3B0Fp F0hBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% *h,<,3B FhFB BhE8Ft`\Fjڣ F193!;#A19!!9!?a4%%a`CargD``-AFJFF!ChT+*iFرF F1F ;FhF0(F F !o 8(8FF(Fe F8 MdFB ЦhB#hB ѦiB&iBvDvEӤE A``!!`)hL`,`< J Sh3S`$h!iPi Jh3`dd-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0Fap FM F(2F #aeamJhL``h2`dd-MFFO PP@&hDEѽkУhBhB#S``i F0;04F6hddp LFh FB#iB!O0#`%a#`c`pd"I #J`S`d8F`#"#h\k+h<<<43B8 FZkFF)hk `ShG pG7F Fh h#`hkhK)F FG!F0jh*h#Fo0F##`l%JK `!F(F00F#JI6##`!F(F0l8#F`F F)I8"F(F8@ѿl0h#hkhGpGF0h#hkiGFpGo%pGp FFph[hksiKH)F Fsip@GFpo%F0h#hkiGFpGo%pG-MlF+F0. #HJHIl$BEIl+(ۃ!F]F(9o ("FCF(F8IA4(_@F  SF"F(F1I.osB(6B_PFBAFPF&(ڨFIlFF [E)Z/ZF;F(FIorBF$ &B  B_1k) (, `#acaf```l hK`!aba`j FGF3k# h##`ci"iS``##aca F(F<`%o 8`o"o_o -AFFFVO,<,Bopl&B@(Fj}([hh] hpGFF$ FtF04,O4 F2F9Fh(((h(BpjFhB ,;,BoB `pj0,;#7 F`F3hB!F,;,Bo+`0j9,;# F `0R?B,;#`#h`jj2B,;` pG7 F F;,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh(FPhh((BP FjopFFF F(3FF!F(Fp@ChFZlp hjp&U#FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`opa(T?,;,BlB3`j#s F`opC(T?,;,BlB3`j8F#FF#`FlO2}"F(F8@zo8sFFSO,<,Bo"hB FH,`pj8FF!<F%`F8#F`"FF@#F`"FF@׿#F`@"FF@ȿ#F`P"FF@#F`_"FF@#F`"FF@F##`_"FF@ Fi!F@hFl]r# ` FO0#h#@F F #h+oFHh@\JFH l0h;nBi0;FF18UO,<,Bo FsB F<`@]jj,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGhR?,;,B]j0 p FFF)JFR?B! PرKF``a!3`B`` phBhBhooo 0)LFT?BohBhB i`0ho8F)JFRhBohB hB $#S```D`2 F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Fcl F! Fcl F! F{ FFi+#lkS``c dcl`h FGF((F8o-EFFO U4OT<BPF#hB FF8ahH)$Fk4F<hFj;t! F#j[h[kC Fj! Fi{hRkj[hkC F[z! Fcl#Scds FF(VClI" (@F"F(FN7.ho2l*;#aR3+4(Fsi۹i3l _KF0(F"kl #kd _#(FG(phj+(FGoopo-EFFF'ozT4P>>>+R\Ҳ_p ph((RZ_RZRZRh((RX_RX`RXh(( _RX oF F!]7FChjFF`kh;+   0#`00hBRمh@Ni,%%BG-E iE5 H$]o Fp(FhF(0FF(Fa8@G𵑰FFiFű)F8F'L)F0F'H Fi@"hFiF FuemGo{@]#HAFF!`G#HAFF!`G-EF XF p(FV"FSF8FLG( 0D0DJz-o hBHhpG1BopG8# rF F- 8 JBsH#+r)F( Kp z  Kr ~  LvLj wJ[BJw~ vBvzBrxBp01+ + C۲C## pӲ#KQB&qaFO0O7F"# F *F 30p `H#H  (-MF #I?FF(F#B 0+ hPH$omlq F7G(($1 ` ;F:F0!HQ FGoCpq:K0"BO OFp"# F :F 30 (H#H  B(۝p0*й0ճ hH$0 hH$#P!FHQJI# hHJIJI?b;_ w?[JIc?Sb-MFF$=`^k=9<zʹ63h+ 0hRh!hH$-on80#(.ЌNJI*F1F FG(# 1h1|JB !B $! FG(q!y+Љ+п+Гi F#(1# FFHqrG Fd1+mє 1+@!i{y*xhu4*^ *,*𗀀#!(1Hq#r# 1PJBs# 13y+#гi !HKEZx!EK!xBZx 1! +R++=K[x 1r# 1h#a0 (1)3K3K FG(:**Н*#!F FHqG FG+{&H1k{1h1h1#i11#?!J!!J!!J!H FOCFBF!Hq FG(XTNTLTHTJTLlzj6( pGpjFFI0X_0kacC#C_ +a"@6F F"Bomp(i_ "pFFjcC#0CX_ +a"@6F F"Bom+i_hi_p "FF3 8@t^T- E?8FP43`(Fo -MFF:8?8jBO?@0F?@XSB W 0ED+H#3O0"F@F#;,<!<$)F@Fsh0Fd CCs`OC@G 03+(#8_O3 S`V0( h_# _ `i_#S#_a0@pj F3F F&3HF55!(FFi"!(FFXi"!F(FF0j" Fp-MFF8F%04(XhJ+FhIlHPOAp!$(𽀪F$(QF8FJ(OJ)$XDFȱ&QFTH#h$XD($(@.F(8  3E(88FFIo!FhBH1F?H#90F8F8S8 0808~hF(/H#o -K !b,K-Jc3F0#+K(FkcbF(xh:FO184,x:Fj#s bAj0Fb0h&F(44loH#no 1HGaIsFF FF F(`l|`0"Ily(aIlu( ##3" F I3eH# Ilp@ po;E[k4044S($@8F5 H$4BB@$,($ H 8Jx x0C#xCCxCc yIyB"_d_CdpG8FjF(Fo! 8-M5xFFh;h_C_;`08[j+3h_ CC#C_ 3`"@;F;h_sAF F@1cFOALhbCC@3B`@Ḟa}_ O Op( a@CC@3[EaAF FC]_a_O3;`i_C@_ai_CSC_a0p0Fh&HYh#k PF"NXE"H#bom FH"t3h_ihHYhJizd* CiCS Cc_3` jMKi*+FMJIi(*FH#.#CCC@j6lV008(iKh_C _ `pGopG8FMF FR)F0 F(o8pF8F(F=F(F1F F@ F+hG Fp@p w_O@9F jjj";#CB JC_)jjCCCCSC|_9s008[id+гz +Ot 7D@t_I O@t$oF "_ KH2jj!C3C:"C3oCoC_P2@A008[id+гz +OT D@T_HB O@T$o _K4F jj";#CB JC_)jjCCCCSC|_9s008[id+гz +OT DT_I OT$oF _ K<4jj #B3:"C#CoCoC_@4@008[id+гz + $ XD@_ HO0"O1(FOzp!-A !O1@FFFFhSBrh!h[hkH1"`$ F*FH"pFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA]"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1oFl`( F(F FI+ FIFC FCF#F(F I( F+( F"oxGWhk opGpFl F($ F%I#(F"JFxZ !J"ultFo% p%B V%jFY qh#FFbFX<#hbhh H"~5 J IjRhRhZ*h!Fk[kGaozhkkGo%pG"hk[lGo%pGhkhGo%pG8FhFk[h;G)FF F" 8o%hklF`Go%pG-M} Fh"FIl#h+o }x+#` 1FB# P+A+hEhNh[hB-l#\C% CD[i+LgHZp;hj+)F@FG(h0@9O Z0hjBѐB/қ0+ $+#[iXոh$  0E ћ0Bћ0E0Xkxh(x (AFd 0+63nQF@F lF 3O ": 9h!!0yh)@FI 7 *hhh)W!aaaa`aaaaaa```ya````aYhk+?J F)FG(Yh[k+?>)FG(Yhko-AhO $ pB ѧBih`iz`*zp|EnxB4pFFKBFXPB(Կ  JBXYB#ɲ!p+`0Fp (OԿ&&%A#ɲA#ɲ-EF Fl"hh#F,,O7^i1,RXWhh  F SF!F0Fjn@D@!F(F e8F>( 0@@oK@ S+B*0(opGFpGK S+B0(opG-MF!FFbJu F((o8F!Fu YJ0( Fc FFhDih XhB+0O`hzU`(DF`z3ݨini( 9ۺFFk.9ۺF&F2!!diDD Fhk58(  dF4FD%jB%jB'l20 F`FaF !FqF&Fc hCi6\|B `Pn0CPf5 hC^j6\|B `n0Cf5oF-E FFF, O FXk 0VhhsOw5F!cBX\B0d˹9F(F"@#D9F(F~F0Fp'#@*-E FFFFh|hPh+9OwFF, O T!cBX\B0d˹9F(F"@#D9F(F0F0Fd'#@N F)#DFhFXiUhhiF ;|D1F(F{#"@@C1F(F#` -MFF'F,8F FF F(=#   U Uj(FF(F[F(F!F0GF9jq V,dBH D$ (FFoo%-AFFVF`iS8FFѐ$05j8FFiAF8FGF3j{u 8F(1jKD$ Fo%o  F&  r  FpF Fj#)F Fp@Go%pF(j F@Go%pF F0j#)F Fp@Go%p#sF F `c eFo tHXj0F 0*F!Fop]F FFc Ƚ8F-jFYDԐ2(F&20 $0%0s#h+!(F6jCb(Fakr&(8j(Fhai)(F(j(Fi(o{oq F #`7Fc F(iFc m F0|F$hFjF&DiI" ]i JCii\n( JCii\`(K?3OzsXC  Diz,̿$$F` `p#OzvEi L4+rCB3?+oppGI?"I]piU  F FlIFI(l ''G+F"1F F" Il`" IlF(a Il(a2E]V hF  pG hF FF#zo%(FKi*k3Kaoq+;oKa+1F FF(2Fyh H!6 i ci;h ci3ca%m8 FF*FF F8@FF F@F0iiBooF0ihBoo8FF F#` IlKJ)F(F F8@0o8]fz@h8 pFFpF(FcF h6ch3c`Xpch;c`((i h ,hkhGo%pG FF 8=F %da0a(F88hFk+i+! F+iG(8ph )F Fk !)F FhG 0p8Fhk FkhG  p8hki !G pG@l׿8ElL8(F@l@l׿@l!h8 @BphkF3hF0P"!hFah " S# K)F KhF K K K5  FG(pqrwrrrr FppG8 *PD8(Fa LpGbpGgpG R hkh"GpG0pP-D(F-InF(F+ILF!Fl   Br 0:! 8!F(F F F,#\!FHl((!l c(!l >(l (H #i? *8FF>2 8!0FBа_аOаO аaO а?ЫFH!h  !FH!_LP0 @ILP0 - (H!G(eJA@ahkj GopGpG FCi ```h`Zh`h"thtibt[ica𵋰FkF(F&F1F(F_Bo 2FIl a2FIl`"Il1F`(FUw_`abi2Il`a(/ # a&#juhiDh@XX_pG!F@i`i@!o  F!@i$@ihh#D@_ZP8 F!F@i`i*F! 8o  F  * 0, +J@i!V H pFF@i!F@!`i`i!`i"!`i%p@!8 FCiFXi!Q#F(F 88F F!`iZB"!`i"!`i}`i!ix"`iFsk)F F8@87FK FQiFF FhF> F+ja+a;#+w" IlyIFlbOF(bCFIlй+j$S&`Hb8S(0kcb F#boo FIVcnsFi Fo%-MFiFFF(Fh&Fcj i 3#Oh@H3E(F#F"F9F-AFiFFFjF0FchihdjeC|C10W -E FFFFJFiFF(F?!hhji@+iH1 ;nn#BO$ LCsj2FDi#D#+FNhho FFF(FFi >`shF#fhcfqh @#Neh(#Jekf#Behh# ""HBCh9F(FG(FChh"`//('''y}sx#*h"pBBR`hO #i #C  ZD#a vOD DC C _B 1 C_ DDDA !A _C C_1_p!_t1_O (FVI8FͱF)hjh hRHh"pBBBh"pBBRh"pBBBFGJHI' 3<;ON CC_d9<- D0CD  C_3e8K L_dkCc+BM_$c o?زo>زo""3k#CBCDD4c_3d_#3`( QF#F(H'3SF`!(FR _c""o-F+o/4KC` @FBhidaBhDh hC` F _O"3I FU F@d8 FF*F!F8@8F}F(F K `c` K `#sKc)FdJ86 8xVF( Fg F O0pFFAF0F:lh_O!*OO\_\")F Fp@ĺF!@ S F@FjF!@h(hFIJhF0 F"I F@`-AF KFhFFGK :F0FEAhG4y0yA BРP8(  pG pG{++pG_hTpG_hC"pG-M8FFF"P!@Fa01#:Fr=M{G b+hGGb F+ha{GCF"Ga FOBP! F+hGGb0! F+hG+hG bAF FG۲#8Gb+hQF FGGb+h6! FG @0 FGF@ F+hG0Ga FG _E !d  ("G a F2; 0y4y-AFFFMOr!+hGC! F+hG!C" F+hGC# F+hGC&! F+hG FOOq;h FGF F+hAOrGd 0Fizӽ0y4y{++ pGh\_pGhS!_pG-EF F'O#O@QF F#"O@Q F#@"O@Q F#"O@Q Fch+Ӏh+π#"O@Q F#jNFO@Q F3hD! FG3hD! FG3hD! FG #CF Fy3hC i! FG F# "Cl&O<`hYKhCEbEЪBs" Fh-ch"3Dh F&ch"3Di F"! F F"!&OD8F0tGp0+D!8F0GODR!8F0GC!8F0GC!8F0GODR!!8F0GC!8F0GC!8F0G# ahJYB3+0yL+PB !#^hC"!8FhGAC"8F0AGC"8F0!GC"8F0GAC"8F0AGC"8F0!GC"8F0ᲘGC"!8F0G@!8F0G#@F8F#"@8F #@F8F@!8F0G@#h"@8F#@F8F#@F8F=iziT)ؾK@FS;+ظI!񢁢S;+򫀱H@(FH<,򐁫I@! |%D!8F0Gl%!B+BBBAB*A B ABB+9iBQBB*ABIABFAB!!Or8F0G@"!8F0G@"!8F0G@"!8F0GOr!8F0G@"!8F0G@"!8F0G@"!8F0GD!8F0GhKOQ8FhG$FeNOR)F8F3hGIFH!FEH)F08IBH!FAH?H!F '40;*h;KB ,)ѫ+&7K6K 5K6H *F#F1FX!F#F0F ()J:DHB@ EF1F"H!F!H{!H+F:F@F -BH!FHh 2FyCHݣ %;^ |:&% 'LkF Fc3FF8F2((0B58$D(d$d@)FbH>#"F)FB  HYh11F H!:FaCH%1F :UhkhGo%pGhk$hF`Go%pGhk[hGo%pGFWh}#` #8FIhhhX_hii#< C_hh P8#-EFF+ h 0FX_h[};E@_h 0P`hhi!OyC+3`hhiyCN_"h0B_"h0Ph}h%C[} %@_ "h 0PhFphFlʚ;8FF(F ` 80FjFF!(F(hF``(F,`} 0#`oF Fhe FPhk+`;h;1F(FG@F Fsh+ѳhk`{h+(FGo0F#lJI##`!F(F00F#JI##`!F(F08#F`F F1IlK8*F F8@hhkhGFpGhhkhGFpG8F$khB 8(h(4hhkiGFpG8F$khB 8(h(4p FF&B #h64 F F(p-A%FM`+FJIF-OA 0`2h)F8Feqh0hDF F51Bq`$o lɿFhBhch R#0O2@_h A# FhBhch R#0O@_h A# FhwBhch R#0ho 7Ff!F(FWCУh h"D #`0o𵅰F FF Il JFH F``E` FF F!ۿp IF`$N(FV Fp4, H FF#FFF#v"!"w#!bw !Bc~+@У~+=~۳9F@ g` `"(FMea+!* ѐ*!*a*ڼO +!*ѐ*!v.!w3 0fvv!oo pGChFBF(@il~hD$nCOs FD@A*hAeF0F H1 FpB +Fo ``oojh) D`ۂhB#`pGFh0hhD `hhpGpGFFFTmK O%?CD"(F"F9F(pi~hA!n*FCA3A@A# Tm8 FF**F!F8@0¿FFiF(FFo Oa(F[ 0iF(FF," CA I DDFFoI p"bpp pGh/{hxh( ~((~ !RF(F"yhB x[#P@ pcp;xB78(шIx/c? C)F;#kp2 FF(Hx/?Cx/? C QoҏH_O Jh Kh_h;_CC_h;pG(0,0Kh(_B_h(Jh_hI_O$hI)_BB_h)#d(0,0E@ I$ hLH3X3\Y_F"8(BR_ h[P(00%E L!h0HRX_ԐF"@"BBo  CEBRBB)_X3 h!hH3Y[BPP#h8_+C_"h80XRX_-(0Ch 0```a"FdX2$*b8@]bbbhP3`+`0KI h 8#CA8pG(0@")FOs!Ld "`La#`01T1 Kh__h+__h+{ {(08E0+o^ pGopGpGF_%EBeL#haCli+F_"h`8_C_"h 8#h8_#_"h8_O"#hOzp(_LJ#ha_OB#h+_#h)+F_ hXIBP_H h3I+BPѿ_O#h(_ #"h8_"h8rljPjj+Oc(O`)Oq_"hCESb_"hbm_rlel"DB)ѿ_"#ha#hi_Կ_Ob#ha_Ob#ha#hi_Կ_OB#h+_'"#h`qlj7GG_ h@G`2(08 pjD`Fj(h``bb j Fs3O bD0 iGD`ppF F0!kBp*F F(9F`jSok # bbD0o FhAh KB FT0(9(BёBoBog jDE@KjFMhhD3B(F?!?c0dD->1h0l_Jh alC _h ahi_7l_hcDyE@_hH4 D d Y_l#psCS#CCC_h(FQ (0pF FBcjDchBѣ{" jdp j(B F@"KIH F@g 20!@ F80"!y(bb FI hH3XX_*BBB_ h[PpGX3[X_B_ h(08E Fjܱձx,I 0kBo D 8!FDo8F(L)Jj+GBh'KBCKx+@ѐE xB;Hy yC# B4ӔFPxB-(+kjlhi[#!bD0bc yIyC#I#hLH3X3[X_Bb_ h FP! F 8oo!okD(0-ME`Jj hLhDOBFB(Fdc`fGdX0OHS_k(l?1!?D)l_0rFDD_0DKKC_ B0'(0-MP#KCL|D|REF FDY谪( A+_)MOPHp?!?D~Z#d+ѳyyS#і 0*C03x!`[ [C"C1sx +2  .3xc Fxr3x"7K`#l+ FiG(۔1#13x+sy*HK+#01x2x#***# yyC#+P#   K0" 0d@, Kh_+h)_ J+h)9_CC_*h9#d,000{yyS#P#   J3x L ( #+mx[+fE`0+h9_+CCC_)h9#d=KSKh_+h_O!+h9_CC_)h9#d/EKh_+h_O!+h_AA_+hPF#dRPFo"5KDp4K`yyS# P"3yC2xL3($*xxR"ѓE+h9_+CCC_*h9#H0"D Kh_+h)_O"+h)9_CC_*h9#H0+? F_l+,0$0 0|0hFi,%TBTA ST/) : B0%$15j0 :pF&hj@ B @xxR" [<1ph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)<1F%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h#,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`o<1|{L#hBH##`<1|{FOr!H!F@"H90F  pGpGFh(o(F.M.N(ps F(m(rsh0F'H8 F((t0tt!@ F( FHo t"!K)F+`@#+#vK F`F(#hHj(@' oI 8F3s#ss;h[i+!8FGH{h{90o^pGKxpG80"KppG80"KppG80K`F&F FIH F{  H1{Fh"h!iiGh` j8h2hLiуh[jG#cac`#h28 j8h2hLiуh[jG#a#c`h28$F%FOh2+/D c5B;h+$!!H;h4+ #3 ,;`Fw%Kh H H H#;` hooP1%T1(+.D2BCiDH2#h2pGm!`m "m!`m8FmBhzJy yxD$xB"Mx-- o^8@KIHX x!)ѳT0B !@@ x-ѳTPBъyyiB"*("Ao%h9)pb`m8@o lT m FZhB"`! mhh F@8FK!KpC48"b  O Ozp,p+?+# "!#pbp #pO3#qcq#rcrrr 4`PEܸ[3+p#+pkp$98F#`##`hFi"G#+`#`8-M8#oF0IԐd0 +&ѐePf0-E EEg0Ee-%E8#C"#BA.OE+#^FT +Nzg0fPE%h0EEi0Eee0-lJ8#oC hJhJhJ@J`"`" S` 0{Bs`h(:Ъ  #no0a0SC? SF(O3"RB(F+8#CDJ B@ #@?K@I@H%o0C+ F5(Џ+0a#00jj8#O"C B@ *J[jh"o-FOS"3F@E Y ChAQF0FG(A!q[\2\2EuBFH-8#JC0Zj[hB?d2Cd2$'! lT`1 pFoikhs8"rCBd,"D0J-;#*hI`XQ`\s` "+iZ`*i{#s`hm+)ih a F(p JF#H@KIToUSBS%T l-Md0F+x"ѐe@f0$DDDg0Dd$$D8# S"#BAOJ8#o S g0f@D$h0DDi0Dde0$AJT dLи? F(O:#SE(Fish+=є"o/2J!FFOZ"@aG ^0I FAQ3hFG\2@ p\23iPEX`Os`8# SJ B@ o(F(Њ2i{#s Gw31i\ha@KIH!$`1 lTh!iGFm 0m!hiG-MF F'fh.8ТFO@ 0)mhhG08)0nhhG8 EіV0 mh[hGV0#V0V0 0nh[hGV0#V0#c`d2# d2-l/j#he`i4J5Nm)2Fh`FhGF(ѕV0.NCV0#h(ni+K`*Fh1FhGF(ѕV0CV03yryC#@2m #e`m!ho hG0a(?p(n!hhGa(?g3h`2i`i^a3i^a3i 6V?(O6i^`i`{Cs`h(?+in?ha`2`2iZh*`2+. F0( lT#FFT# 3@ fF0FD{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppGp1F0 hkh]$`6F F!FGpo%-M0yF:hF8j,B+єh,<,BR;hCh,<,BTiF F`+H5+Kx+o Fqh'H(0FF#H5j,> H1F} JFHl#Cq"K5pHcl FXCy FUjcl FKCy FHjp1$BK`xpF3F(F#iFi(F,Y 0 i F#`p@5Ob F a,Yp#` Kx 1 pG$8FF(F 4ThIlp^Ilj] 8opFF(F0!l,Fp& =+hjhhHb0FpJI4(FT"&@4#sCs@4d`L9!ml 8F F#i_+ (Fz \_# #aF#i_ (Fz EH8@?-MF^F(F]#q(FU4LAF(F&Fи G@FjF8!ml8F(F66(FTB/: ` FQF(FyF(𪀁#l_Jo B@}#(F\2:T p_\2+𫀚^2+G'_'@F 0'VG_@F pM 0_]"# #CBs_ 0H0_+z+ &##_0]2+ O@r" 0C 0l(_#>4#4l_տ_Oscb_sb_#1#h#c#`_Oc #aF#i_98Fz3 RPFRPFhF(?Q8d`m=;F)hjh hgH;FfJfIGw['X"# C:C } _# #aF#i_ 8Fz  l_!8LJA51@CCAE5O DOJ5 ;@C@C55_+ z   Eci_ @4_#.CS_@4ű(F7'I(F@`!8l-8&0+hjhh Hf@4LP0#sCs@4"@4#s@4SS/B!ўBci_ Hu H:'YoV TO.?JV@ByF FFFh_8Fo  Do oomh_#i_As1`+p -MFF 3TBFcF8F 1KS"0FOs@ B(F)F26 FS3CCrCCzh*C3_5_#5zh*@$_/ 8F 33 40CCC_5##FEEEh)F@D+5C35+@4_o  3D xHCsCC_5?YB??XJBSD*yFPF__Cs55 #`C#@CKsCCC 5 F(a PF?JB??XSBQDQF5_*D@O4_ +\#BE8CDB5P]#Z+?a5#3YO dBFPF PFF}#b 4_  п_# 5_O2XF%9io -M FhFF3X2!BFO@O Or*k`ѳH9TF F0@+0+^+׀+@$ ,Kܴ<, ;$#BԿi9I#,МH $##T2@$_QHCHCHCHC!HCs/CsIHAHACC;`$#)Cc 04B" ,QvH$F0)C#O а@!аV.3F#BFFFgI8FFEԿi.3F#BF_IFF+ РF.3F#BFWIFF .3F #BFSIFFRK .O'0O(03F #BF8FFF%TF{F$4 O VEԿi/7H>$4H9$Ozp Tr0D$0$C#@#2B&дI@#Bд<ڴд6$vio)дo+@4#.C@4++@4#sCs@4LP0#sCs@4I@4#sX2H$~}}} ) 0##ZF)FPF F(y/9#F 0OZF)FPF9 FDD(VDFC#' 0ZF)FPF F<&IOF%43X2B#o9p4O tT4d-C-A FFF3F*F!FA-EFF F F0p:+A3Ozs /B,9S h H=om J I *F!FSF@F /-M FxFF(t3F*F!F($M0h ih*#FO4Jh@$@"@CC_h hP0N%7FDl1F`h8#wP=5- F"%`)F" FOzp F)F"@ $~8Dl"%h F F(8@"-MFFFF): x+7FYFF x F O)F"x3**F0FSFK]=+a5)DdbBE(BF8FoDEGD2FAFHk FO4FFkF F@QF FI. FD&*F,F0( F!FH>=@IF#J @h  "1( F 47 FF(B(F0 F!F/#xbxCxCxC#yCcyC8  0 FFPI*F F0oM8FF)FH F8Q8 FF(*F8@! F8wXx1( Y(РTXBXAO0 HCXBXAsF  #H( >= FF cHu#DdOLrIHrPKHh@_/ B  BB }>=4t[#BbBIOLrH>]>=4pFF"Gr1F BH!o)p$#FGr1FHF80 FC0KHhH)Fto4t[$GwF"F!F H B K Hh :F1F F(` F4t[,H6𮸫-MDFFFx$+jCx{+-6%E#+F,FP)F0F.KFPhn;B"!FPF%K-6#J$0 F+76DCE4C{8FI78FhJ I8D3F J K4F`$4XK)  pGF8IK[HDB AhB0Ьp&O51F F0%uo4P#ah0 @B!h HhGF0H4` Fp*4ѵ?5F6 4F@hHh2Ho F#`h0@ BHGF FHH-J 'o&9F uFXOJF( ", FkiGF8kh0 C00kh0 C00,07+oo>=-M}FFF? # *F-IhF )iF(FF>(D23FXF YFF{h(Fb`hFPF0]``QFh0F0OF`H1F FwF`he`o FoHoX]-MFFF(NO ,!(FF`(Fȳ0F o (F)FZ:! FF &F F"Fر)FBFXFGF F; F(ZF)F8 $ F%u.5F%0Fʱ# IFX{(F  F0oo0p@ x0,LxX,1 N D F%x1u]@DЋBF`p F `pG FHIx"IHS" FIN 4 33x8FXM!x(F@8!xH# *B8F( Max(F@8axH %B8F(FKS C8$#0J F,"` 0 F( F`47F%#!F QBТB"x0*bxX*-x:*O0*5- 0-A%XF0hOPP+H\P8`8h@1FH@1F(b(p`Dx1Dx-MF FFZK/h,F.h3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FH h9FHZ8F7 KYF(FFH"F!FXFx(?|hw9FHj6*BKAF `pG J KF &LB8FT6G6HH FHI"IH" FIz 4u66#J F,"`  F+( F(Bh4OhFOr!hF;hN+H#0`;`#0h`8jF)FH8AjF)Fz(hF(hFp(Ch`H|1FJ"FFH FH F-AF*HFFF/!F&J jF$Ho("OAFF( "!F2@9F0#{C +`O~Ha??F1F Ho * 8Qg pGFs FKz Fpt(H HH1-MMFVFFH$HJ$ F M G'?8FXFF0FMF@BFIH.0FN|F @ 0QF =UDFQF z;FF2F@FBH$Kx {j6 1-MMGFlF(IF8F(?8FtF @ 0QF 8Ѩi!FF *F1FF@F#tFPF.F#HͱH)F&Ozs JI H H%FO4pF+F"hhhuF Kh.Ahh} FpH|O4$1{*F hXhOHh8 O0 *FhXh98h hHJ O02*F hXhP!ih8 O0 pH&$ M> H H p+hC, :!,!jhH4D5[LTNFFF1FFر#F F"#tF((Fk F#BBѨU=`o oHpG2JhrBЈBJpGp27%L#!hq( H !hq 0)F+F*F!hq p2iF@ ] F`h vO0 KFh(h0"Y O0p2 "! Fh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRFs(#` Z`l 9F9FF  ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9Fe[FRF(?@ FF#D3 [FRF(?("!BFO420F Hhh HhP EE0O0p2l2-E FFFF (QF HO0X2F F+FphFFF+ChBуhB F)F@ F `@*F!0Fo Fo pf`` 牊F@)OhjFpG-MFFFCli@ 9FF:F!PDj 03 F" CliO iYF 7 6(ki>0FFZFQCSDD@#F(Шi p 0 9FF(AF FjF0FlFQFQFD0Fn FOCi 0"9F 8 -ML#hFiF 3FWBli*j^Ն #h$O i(5 3@+FO 23 B.O2mF2B XE*! 1Ih"F@F@PFuhBhEF!D@F~ H@FuoE ڭh@Fg(D2  U+$@F,OkN ZE]ۺ)!F@ F"F!I`HO0O2]K`]K`pm0@B0SF"F!0VHL0BPFO1#NJ@ `!F3`0m#F"FF FH@m@03h K S+w 1YE ̀%!F@ ?F"FQF1HO2+K`+K`m0@B."F!3h 'H0BPFO1#J@ `!F3`0#F"FF@m@0LP-D!F@ F"F!P͹ HDp2h2d2 =j`2O2K`K`AFF[ @0B0+F"F!D H 0B(F$O1#J@ `!F00#F"FF5P-@3hS(0@00S"H3%!F@ iF"FQF тHO2K`K`(n0@B."F!3h zHܱ0BPFO1#rJ@ `!F3`02#F"FF@+n@0fM-!F@ F"FQF]HlO2SK`SK`3h1F H 6.O1* #8-M FF``# #0F4B1F(Fp(FF;/+лO /!(FF0FF 3/*6+ !F0Fh` UF)F0F 7F;i+@@Jh3+`!F@F0+A @ 2Fz`F!zh1-=%!F@F-+x/+0F!F*Khv1F(FqF(F!F0FК0+{ih`;ih`( ;* (F,0+"#@F(2C(FP2p27F#% K` 0(,(  ,(P2#N F1h O;`q#03 h0<` h"(1h Fq O0p2l2pOaF@ FOb!kl FkNNSs"Bl#` #X0`#nմ0!#r F|Ax!4`p F#3` p2p FFKEd"h`Kh`chECli  @% CC@Ept2x2FF FFgI+F"F h@lt2pF|ElO`i`Obi#Fp@BؿLDx B\B; 0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB F22pF JFh FX Jh1 LJ$h&DB HO0p*F-(222A{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5H +ч FGCF+hS$+h3)KB# FYCF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGGCGFY-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(F DdB F>*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(FF*KFhFFO4 Fi@ ?1!?F(F! (O4(F@")F F㊻ #@!F"3`8Fv3h4 +O!F H>$dB#$4 H3 #$3`"!FH)(#2s|-E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H %H?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @, b @D#a2-M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`({hFO0 FDBF*FFF0FPEѸ0DCCDF !?#?F3F ?(?@F"F)F@FIBF!0FX(FFF8hhŊTiiCrDh , kCi!Dy H-o8jdB(,FicC)D8iF "!(F#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IF(F8(O0+\.+oOT)F0FZ0FOq F,!F( -AFF%NO., ,!F Hx# Ԥa+@5B(F_$ -EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF FX8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(F6"8(DB5`x +.+))-MChF+FFS + +\н#@FYC>F FiBOh B(F8 D0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDD QhhB ` Q` CBubh *Os@q* FE &5F;O1@ 8`(UMHyO0  cBs FV⊐B:F0DP ^⊐BcVDD+67+K9Fh.(Kh<CB eDDEsAOCFK~QF FkbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOu|2' cu61%)F F'(5ch ++ ]-:㊦if3DcKhB+aH QF Fbh *Os@q* FB?QF F)FFQF FEFRK&ipFFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@s2F i?3#?@3 N ?x"0`$?H"F! (#O53`(FF"Ip"F(" I6("IR(22b iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Fd(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0F#{!0Fn#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF2FiF@F`(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0F*8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FYP<1SEBFQF0FO(iz!F F16LpF Fv F@(F<V ix p<1B1F(FH(-MFO F }Q 2OC[PB_&lF5FO "! FI#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "ii= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFF F)o F  " !(F.! F#x .+$A"(F0F +"_#0;I+FRF!F(f!FA(ROBF A"@F!F+# ݸ 2$Iy EFF 0 +ZDI+F]8Fyhm(8FX|+F IG FL L0 ")F0FSj$e o ON-MAhF:F(o0FFziox *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(FfFZFPF F(BF(Fjh *JAF(F(F0##aO[;a*Or *@r F(ЅL#h3H$ FhGFH#hHYh h F H  " & H@+@2s    0IF@ FiF*)F" F F F@ 0o@FF@ I^FxiF8o(F F "9F(FFiF(F("9F(FF"##ii0o @-MTFI@ FF(K(@A"AF(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?FFXO3 !F(FgKgH * *OrObBUBFF!FL0XHiXFh  j RXF1J1U!FD(F ++OsOcBҢFEv+F!F2[H2/KQFxCE[F!Fб)H(~ ++OsOcBr CFK2 Br2 [DQFh@(FQ + +OsOcBE FKo*o )@  FF@ IF!JwS8FqT)F"8FJF8 F4`(Foo pFp F[(6Or!0F!1zaى\1dيT1!X@L! z !#`i`#.`poF F@pG0F Fh0(F0 I0 F0 -MFܰ @ !FXF0"Ff F8(Ȁ ,"FAFb 8FF(9F9FZHo $if FcXF\@ QIF(YF~(@( KK` F" l F FEH FF8izmѶ??iЪBAf ah*Fd3FI0@1H FFUJ9F F o F +F( )i "!8F0 +Oѻ{ # "8FrTi9F F (H FF^o [o Xo Uo Ro X @2 3 L 0  EE0-MF0"! FCrIF@ FnHo -iF@FciI(FPhI(fHo F(@ `K)F` F"FF)F\HoU FR@FO(F F)FoizD 8 0"9FXF[@ BIFo ,PF)--+)F@H]F!FjhŖ#L@ YC?1!?(O3=FPFS(5%hijhY *(F?9D(F0#H^oajhBѣj"jaaz* F- FFs F7(xk%@= F( F(oX@e )j6{ 2  L -MFڰ0"!0F F>( "FQFh 8FFP9FF@9FH$o %F @ IF(1FF(@j}K@`!F"(F~FF!FwHDFM0hJ(FG FDXFZ(FF8kH\Fo kic (BF9F(F o aIZ(_IU(o QF(F=F(Ѻ(i/h "! F({h +OѣO0 ca "AF F g@ WC?!?eFPo BF9F(F(г:F! "LbL`0hF-?VHQ LR9'An  X H3 #"-E FF(H(I;F0&KB%H+#IFH#F+ BF9F FhHoIHFHHeL FH&OS VE(FBF9F5F(6,  "  -AFHFF B%$+F9FJ0F_"F0F I KB 5?HH FP9 -AIFH^FAF <Fб1F#%gS" ICF HF0F` F](FM 𵋰F!JF#IF]F0H F IHF(:Fm)F(P:R1D0D;"IH/F99 -M$"F IF(@A !F(;FF.FF[E#.@"I J (QгF KFBlOFE@'IX F(X#JhF oF(L" F(C  F  # VpK0H9F;x`lO &B FtbHB8F ;hbH _I"D  7r /Q (! WJVI $F(?s F F +ذF8F0FF`"FI(#FZhB Fh9F "r 3EXFO F 0/O XF/}F[Ex0!0F0F"0"IFxDRFCFBFI7FM;vF(  X58F:O8H3Y  >9JhBHpGBh pGh-EFO TPEE #%S` F`%`e`s(F.FVhB-hhB #S``[8F?hKhB`KKh@ pG3 3Kh8`Kh@ pG3-AMO &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBHsFFF0*F F3FF>FpF FF$/L F!0F)`!`F(FW/B F3$!`h*F TF hB*hQh4-EFFrFF+H"8Fv(KB$! F"1F0a#bh|`5%`c``PEEO1FH 0F F ! P#S`` ``` F H`+j(b#`h4(LR F)h(FD!F" F!,ѠF'FBظ'+hCD+`IS'ȹiFEF҃EF(h B@аFS'007L-MFFFF*@.# `#FF[/ ZEѱ+80HhiBѼІB+H C@hC iE2`! (<+j(bC``0hz3``.) ,+#iE"i* "hhkF)#$hhBhREiBhi0H -AF FF[F,JkF,,,,(FKBJ ,0,@F(8F(EE:FCF1F<F-MF@FFF(1FF(𦀏 F(F9F'F3S/O '7FO E% /+"rFR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i =1F#*FhF!F F?hJ$-MFFFFF0BQFAF(FFp" F#(FN!L FF[hXE"0BAF(FzF(iB%#S```D`/ѪhB(FiQ)* J```D`FhLF4FThBѲhB Mi#0F1~F9F?hM1FHR(F0FK%a -MO FF @!FFF@4! zF0 FM(F#aOS#`K`]RFQF(FVYF`(FF*F0FITFX"F0F IMF @>`MH0F Fw  -MF#F ++(i+-@)F*F|IFF(xF0wL F qF(a@x E BR!(S 8F{i GF\  E BRk( h8FG,  "F(@;F2FAFhFe@r#C @F!BR9DKBwDK`{`FFAL*F8F@I `BF8F+KB$@r!FO;K[ZF0F S@ BF@PFGF$ ZFJ#8Fh;,,(f LFbL!-?whW#8F`K H3F FN0hB@q 2[O3B(jCR! F@!FRBhF\?cE hhBh"Fh18FF#*F FFF8-AF(F&ULԱ" FIU   F7FzIx+L F"CF!F8FF5c,6>FRZhl8hOLQ ]pGQK2 FFCF@pG𵅰 FF8%T !T|T,;#0F49F5=FRZhF"-HFQ ]pGQK FFF@pGFFF"F#(FFF:F1F(FFH"F#!F(F F02KhF F1(+IF0i*k+%I#$IF})abaPbFhKhhK`z KM`#aq)FjGFQgk"Fo#FGFF330F3(FFD##I(FF !#i++I/F0k{'(FkGF ) F#!I#O>Kh]H3-AFFF##F F&IqF%#i++ M F(FKhBѧ#ji`&!1F "j (#j2FAFhpiej` + F](F!H ##b3 8OqJ F J KD Jh MBb Jb 2bbc H(F F8LH3(@pp#"IHp !0J J02F I nF pF2F(F!F/9FFQa!Թ!F@i`a" FIF NF60 /١A+ء72*# (` shF F hFX KB ;B  h>H `+`2F!hEpH 0$B 0PB` 04H ~"K`a~>hKp(38F S44 (` 8 FB  F~, l!h!H GKu  h-AFO FF~hc #sC JIhBXBa Hj ! F8Bh$#S```D`m8F FFF ܱձϱƱ! FKgaZh\`#`b``4`$ FLL8 p FFF KhB Hp #cC Hh*X3`% #Ch+` hKOBZ`pG JOBAHB HZ`ZhBZ` pG)ZhB3;(F~(%FF& '9, /,0F-(F F%;,F0<FF&M+x3Kh@3(\N(WL?`` r?#++K+؉Jch@CCc` ,Bp =s(݀O([(*(Ӏ{Kc`F(O(08\vE8(&chCCc`#oOf>h +pB@+x+\1+R#!K{S[{{{{{{{{{{{{ ,H(:0(s1+?nR#{{{{{{{{{ ~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3XsiHG;6h2#(33 88F F% M+x F$" IK,ph<@' F8LL(33@ pF F-@,> MPz)xA F "ZL FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@L(33/@?H-(6 "*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F 3"I xx.C#*0FI DEF0F/I =-BD0FI by#yIC#yCCyCb D#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (F !S+-)++x+++++|++3+++++++"++"yymIC#cy"y(F xayyy"yC#B"eI"dIcK cz"za{B"zzBB#{&|C#{BbCC{(FCcVI Ib|.*0 ,QIQI0F 9|D* R,KIKI0F *5Wcy"yHIw$0GI+4' ' ./D0F/3I BDє$ >Izyayy"yfzC#$zB"(F7I &yy"y`y!zdzC#A!B"/Im"(F+I .%*J*O#D0Fz(I 5-:FDxx$IG' {D(FJ#9 D(FI 5BOb@L]kuwrj6,arIsH#y*FqIF!S+ՀU""z)0+g+!y`yyy*gA!AAAb(0XI"AFWcy"yB"yyBBMIBb(F &SA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*I xx.C#*?0F$I DEF0F/I =-BDxx A!9 FH xx!B":3F@(FJ D0FA!$1OgBObpFmhF/%,&s bB#x+cx+ #phFF F mpkxxC#D!F[F}XF(W%e F F%=FXF[n0F 1FB(F 0x.+0F 1FB(F #.FCEF)/*(F )FB0F   XF' l( F "#XF#9%#XFI#e `j68F(lph$d(F F8$8Fl FH8)Fh(-AFFFFr"8F/I (Xh/!8F =GQ,H2BOAA2mH0R ۲BLb FPO1@F20FFAFO2H9F F  F F}0FF`BBLLLL p FFFHA:m;m& hlAHp+h1F0h#\(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpFT@FOEFH @<RE-=5B  0F^F"-h< -EFFFO3+'aH\@<SEPH"AF wFXc|"|B"3B2< Hh8F1(FpF%iBp#S```E`SpF%hBp#S``hh`E`S````;F& ,jB F# FS``&`f`%-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! F(׀"!F0Nia#`Ocz%z'GE%z'DEEzEe%DB:! F(AF {ha(_Д,0- .C#+ T`(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1@5=F0+++ji FB+jiR+ O1F @   O 2LhLhi F(FCV*L*L ;P+'L FHO`@```by#y C#Esj ubC B* (F8(F(FLRFYF0uh J`;`x``PhS````#  pF F D)FFF0F 8(];((  p FFFs F H;h#| HT_BtH0Fh(-h -EFFF C0F T$HhBظHHFZ_UE8FhxhB+iB٧9FhiF-H*ihi?!8Dna@FF(kiD -h -AFFF F0 HT_B@Fh+iBjiC;R#P-(F3hFB0`xHF)F#4`n -h-E FFFG F XH+h#OHF&XE+hB .`AH 6D%i;&FEp4FBsachg`<`{`` c6 FVO3c8(F9H$h1BB?/(F1H,=O 2O3YBRBUEAE*ѥhhB&jjjjBBLje#S``#`C`rFhXEM,hB jH" I T F $hHD3Ȃ hd7@u RCOC BR o j0-MFCKFB}.{(O^O2@(f(qO<9HhB8Hh)E-EU$AE| 0@O2!F+F!J wO2p RFF&%DB- (.(I`_#&;+0Fp))HI(TP$FFF KB 8](@83%0#%0@4 Fr<4@ pFFa>=65OCo FpF(B$O4 FC<4@So @f7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFF#(F"F;F1F3F#h#`(FFFFF,#"F1F;F(FF FLpF FF2F)F FF Fp FFFF{ &L F!F3F*F8FF#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H|F Fp H L3W-AMFF$FO20F)hCX"8Fih"( #h4,  -AOFFBFFF1KB(hFh+FBF9F0F!( F#+`$ FDF8M,h4+hiDBch[  3+*"h2D# FU8@0 "! F M!FO2(`"+ha!#FE@ JF@F!J HF F0UbEfiVa `L#h3 H H#z ! Jch h}"(H؂~*#-M`O1 F(qFDF'; EJ٫:F 0F"F 1FP)JFB0@(F#F0F ".F(ch2#F#`3SD#FFK"#d# #AF# _@`#CKUbEfiVa 𵋰"kF :F LH:v"#)Fv H(#BB(F F -E2CFF0H /H.I.KBB"i)F :fiB#iDB  O18FFF+hS "9FPF##QF28F9FH QF8F@"PF I0kh+h3D&UbEfiVa|O1 F(HHO2#!F#H"# F(#*s Hx F iBBH FQ( #-MFD0FFF GL F*)л+S**#*"9FPFj@F$@ѻиv QF8F]FUsih)3)L&& !- 2K,++hBFQF8F)F"[FLLNih1CЍAE .(F,z?vxrpFF++(#J#0#J# FpLLJKFcKScKcKd޼p/0@7Hf#FFF@AFKh)K#!º"#P3K!#JH4FH9 FP3YF FFFW*F$! F0$":`(h[ FL-M, L @ FiB;؄iB6ؼ7'#\E2"C h  `24 B73DP@P@@@ @+HH 0#F Fm++i+% %#i FbiFF F0%LL-MFFFLX **  *@݁.ҁ#' .ɁV&RF[F@FAF( F &&E@𥁭:B B  B w \ B #%F\3FB0/DDM@n:Bi Bb  BZO w \`cEP %F<CS0CN;B  /DDM@*:B% B  BO w \`cE  K%F<O[C#0C.;B  /DD&@P:B܀ YBՀ BЀYDBˀ.ƀs# \BKC #& && ."J 1 C   37BD3+D.R0#@C#@#@c#B0OK o#o#@;!-6Ъkѭ :Bc B] BY)U O \ wSELGC! !!%F )ђVxxFpp20E  DD) h 6SO0O  _LLLJx$F.R&.R&+%%-M (_h UFVF3+Kx! F8(HC(KF F%I("H1!J(a JeaJ$!"bPbb". "eeh'cѺ#OccK@<sO@Chd#bc#OxAccOc##d QA?%  8oo[(F F8@M-MFFv! FF(1F(F/zOF(nXFRIwF(h#F#FF(]AFPFO g@Fi{h;;lBK#" fg;K"oРXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGK(ܠa+ 8pGBpG3Z*pGKpF$B 5`104.pO10@91?"?+pGpF8F~F,F Fp2F!F5-AFFFFO1F8FBDEd`O@9FEDF#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@Bр3`3+?#`o F0M\B0K$5@`@(@B}(} KS pGHpG4-phF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0F#Z`8F1F F,a F0D7B!FhF F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`J!B!hFF"!F Fj"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q($6W!yhFF"!F F##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`J!B!b!6r!-AF0HFF4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAFd(FII`v(Fvhh3bx3hD3`(F Iq?+J!B!b!6|!!hFF2"F F!D##p0#pcp'p``#+a#cq#(FqIAIq(F<##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`B!-MO6v W#*IlmF%FF"4$! F.3#0FQ)F[;GoEF/D$" FI%#"0FIeq !a0F)F`u F q=F!!!pG-MFhFO 1F L0 +;i Ka p1F8F FiI:FHiHGO07FH 0 BH0BwiH 0 + kh!h2O HC3B * JC;+@*3l& 0h[ABBУifHh ch DB[IbHTi`H!h@ OF(Rѣi[HGo #hD!khDD FO(OB"hJC  F GBF CIDHiBHGO6 "hD   *F|0 0h3BУi1H!h @ YC?1!?Fi+H#"h BC h ch DB?o%JF#3 [BFYF3F F G B4[FIJHiHG0F)! !!!##","V"{"H """#)#?#P#DDB#h! HcBs0F  D UF3 JYFci FGkhDD 0h3B?iHpIH7iHh id# ##p KF[m$0FFU?dӱ#јG&F熱0F2FF I"FH FpFI# $$sF p%.F Fv(.x.+@%#x46.( FsFNM| FS#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PFch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FH'FT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3F,$(Fq-MhCh:\+CC`oovO5iha;4DY(8`,<@ 04 LPXTC , ؑx@Ux2@)DD4 1@!}x@d_p3@O=FЌBUx2@.D4O5@&=D@d, ؑx@Wx2@9DD4O>& !p@@BWxqEtF>Dx242O7@&d@gDGE@  aE0ҀIa!O1U`]`BR2B`@B)s&43a8<@ >eEADqD6ٞFED AEcD'aE< QDADeEqDUDED FQEcDB mDϋBqFF-;F =Ox-_p x3pBB{eEADqDٞFED AEѭKx={pxp??ё=13/>OU 9FcF;G '* <LL31IxYp3</#G#FgF?(?LO&aD IMO5&9DI !`$~$$-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0*bرiʱ#!aAcOACa`aQaaF`S``bbbcccfedpGopG8F F*<x1*9<+7o8#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo''FirCjcQk"jGj"cjiG ao-M*FFOD xDOsBE=,DB٤DY!d ЗB#iQFiyaD\ 0p0jccK#h+p0BjPhk(@J"ij 0(Ghc(@=##`o/;?@D5!/;?@D5,/;?@D5A"i ,` aC"j*?Ba?"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiaDo##`#i- "BвK#"j*Sb/?[+?@D5%.F"j*@#b"#jc"FFa4 #/?=;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?ʮ;?@D5%#.F"d#`"l*?xE(FE(F?QFZF  D[D#l #d5/?;?@D5 -D!31"fcfeO6+AK7#f##`m/?n+?@D5-Zf7J=2083$ nB 0JC+cfd#ce>F&L&o&FFFhFFiC#"F+F9F0FhIChB Bi*قi*o pG IB BjRoBB4FopGopGopG /(((( $ pG pG pG@i$JhFB$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?Ds`opFFFF"FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FF/0Flsi +O tj$"FYF0F:F)F0FFOSka?kbo` #0F (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(FK?+`OSkaOSo`ai$a N8+ h+o F]o JC o (JC *F +h$ FF@KF!FH[h?o((| KS"pGJ#0I@  'uB(-MFFFFF!F(F!IF(FaF(F (Fo*!F(FFB#ې/D,ҹ9FAF0FQF0FPMC0F!F(F(--AFFFIF(FF(FO7F,8FjF!F(F@x/+D<[BF1F`( BF!F(FF(-p FFPI*FF# Fp@Cp;7F:O00"B o P"0D"02𵅰FFFFF[( #:F1F(F`` `` #:F1F#F(F8 ]-MFFF(o(F%'DB +T;c B"YFPFoO3BFPFCB BѻN%O1 O1XF(( 1`FBT;F?5FBȿ F FF:FT -MF TFF 4j *zC#DBӻQF@FF&!F8F0`F)FFO3-AFFFFO0AF F(۝00 :F1F F 𵅰 FFFF ۝,0*F F3FO0-M0FFFF5 FF FZF9FF FF"!D BO1BEZF9F F)1FF C!8D0FF2-MFoJFFĀ!F0F\OF,@t"!(Fy!FcJ$0Ft!FaJ0Fl!F^J 0Fd!F[J00F\!FXJT0FT!FUJH0FL!FRJ<F0FD!FOJ`F0F<+F!FKJF0F5#Ff!FO30FFJ)C( ""nCf!FO30F?JA( ""nCf:JO3!F0F B( " "nCfO3!F0F1JC( "@"nCf!F0F+JnCsf!F0F'JnCsf!F0F#JCCCCXFQhn(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDh #h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03` h8D0 hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4t[-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(Ft[-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% L}iD 8?C[E \+ 59D}h{a5#Fhh"F!0F!O= O\;iB # F3p!F whF`(яChh:sцP/Rh:oFFF1F^E\.уCFxkX+t[-MF;mFO # FF` "K` :PF "K1F"F#+U;m.#RFymhl:m`C0s@0(OpAFP(F5@F0+<(F) (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(Fh+ѻhh:mBTPAFl`!h(KHkh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HX0Fh9m(?QHkt[E,,|,FF$'khB *hX+40G(FFKJKF(F)F0FJuFGB);F J0kDBؿ$p)J0D_0FTj6d,F F!ǿ"iF iFHs 3]a-M F'<"   $+C C$ C  2K]fF1HME : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H!FH1FHP,,,,-MFF@+FFFF@ 4F$)F .F3XRF0F-IB('FO Dj  E #D0B2#.&}C!LB."P3kDH,Iy-0K*00FIjDD  - 00۲ +0 0;xg\ p32o{b vl,-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FF8`h ;hDD8o 7F , F-AvBF FO/0F^)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH,pF?F!?@ F(3*F!X FpFIFx3\pG F8CH#DBF#Sp Fx;A\  #h:B`\i1`i 3`i\`-AF%ChFT+HFFd3h 4BT ,TзB!eE!F pPB=D5ӬE4  3eEO 7003 ` A0þO00#0`F6lF&`kBp`k6l4DE(O2RE  *F!F( #*FG0$ F "p@Bdp FFF 2F)FHh Fp-#FF F "czh DB hD2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`x<.%.S.f.z.7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpF O2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80F,F F8!FGF0F+BLB_-F08hF=(F#; `(F8BFًB F FDBF9DB xO3FDBFx3B-AFFFQF FLFB$2F9F F=( FDɲB FKBF"FFB\2ز-OzrF33hFFOzs!pF% JA*FF LbBOr4 !D @0 p4ׂCpFF0F F$EbEBAppFNB%F(5F(Fdp0X#"LM\+$* 0* %-9KBKA2c\D;# ! pG-MF FF(n  .I1F(F"  Fl1FXF"@ PF_1F@F@" 8FR!"@ C"!3 "  2 !(F"  F#!XF" PF!@Fo-MF"F FhFI0F"IKnFOOFO*zO- s] F 9F*J44-  aObFF=(D@nF%65-F ѽ0"[ CC[00iF?C F0p0 FFhF*F!FhF0FhC3SCC`pGHK`pG  #FFFFQ WH.F &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '6M7N FEO | ӽM(FF  O O @  'HA A" OC O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@ F O  &>+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p3n@-AF*K*FFF  F'B<"pB "B0Bp;2B+Bȿ#D#F !!F(CD? B B"p7B8p<3TF%KF*FFF0FKF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2.-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p%N-*I0*iТ0 )OFO F+0 .]x.*mZx^0 )a1F# F+0 Q#{3xz+`g+aL+Z62xx*b*m%*X*WE<%#;p3x+E{pEFrxs+*Ы *#***TEEEE@E"0O8"0**ўT;FO;O Z+O3IhҲ!l+qxl)L#6Fc:*Q"сkwMcA{cBF;F !SE8p3:*ܸ3ؿODؿ#DWE8T;8;p !FGD* ܸ3ؿ#GF6SE8p3l+T+CFQF8FFf#FS+sxFU+I+M+SD+!и? OE E! i+pm+Aa+O hEa#QF8F#JCFQF8FFF F(CFFQF8FF F-_IIsx\3FRFE@#@ \  FHp@+ O:p3F3+#%@pCF JE@x%@4+{c F F <9 !cE##T  FO.xl+ B+L+""Ա F s+FBF"CFQF8F]""I I !L.o @F"hyF`4WE8:pE !rxE*6EE !l+Z+Dh+FL+T+>!t+4T+#F[hT+ 8FQFF?E:#pCE #CpF8?+?E80#T+T @3N FJB ` F S+;]pGF FoA0R]pGmF F@AF F mQ ]pG#F M Oku5 F !#F$01 +.FO0Fx[" Kt J]Fs] sx[!L7 F"F x x@ 0K\D C9(Կ08W8pGOppG px0+CxL\D۲x+"0F%&F0xB `(Fp*"* " "ѿ "ο#`FFFEFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#` xF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1A 8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8 pFF)KB J \@Fl;]v `!p@)B!`O0p "տ!xFF#Fy"?'_xe!F#x F&0F -FpF%@ F?0D5BFh F@˺-EFo9K5b2$d!@FJF)Oq@FB!Կ''@mD K :S*0!DhD, a'O0Q-EF&O8 jD# uB ci+#kHh#CЩh@F!D #BB!@Duj(??1!?6pF&Bki++kHhpj,DhC#Cch+!G!i#j!??1!? 6i)D-AyF+ѽA&iDFBܠi*i "ih@F!Dg(ijiB!@Dii(??1!?f6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? ?6+Bۨi!i)D%&('KhFBH +H ELF..#J`J`J`J`KJ#?`pGaaaa[a-M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FKhMaPZp N MI2h+h hS@ B L Kh Hi3h#`"h(hp@I"`aPhad/PKhP ^A1JhB  L#h3+#` H7#"#`K``aaa+/8-M*F FF")FOHM@ xJxC#(ыxxC#+"ёOy/ 0 :FQF B ѣyyC#г6@0Fo#q#qFBFF4:F!FPFBFF&I:FYF FF51F*F)F8FMO;h+"KhSEN0h"AF#MFFRF FLG"AF(h!h(h#;`#`3`V/PZaaabaKh8 pGa-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H0(b"!9H(\^##p#'cp#5Hpp'qF(Z(Ra#cq#qq:F0F4)H)K'F(FF@F<#;FFAF`p8F 7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH4;*d)j/w/-AFFB!x)ѽ)ex3C)[2))@5,D3+R#/7?gggggggggG)zS!oŐgѐggِgggggggg )"+Hi")H"(H- #*F%I&H^':F$HR#"JU/F?-@#*FIHJ?':FH>#J/F"HxKpi"HK_O*F8F UH QO5Nhd`//@b/baaa()/"sF1F KB#MEq+p+x1Fl+xl,p@pcSca-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F}#")FnHv"mKmHhDolKx l4 FV@hKx+Ob!FfHeI xdHWQF"cHR#3`aKh9^IF_HM!F=M, 3Zx2DWHM "TIF( "QF!+?yLN7h/?}/?q/ FAFO F(A0BI@)F@R F=IOb F)#D#wcw#0JwFwh5J R$ "% 4BF#&IF8"I2BF BFQF!J9Fhp-D# FC"O1})DbbcScLHTa() *Pb000ZabPMba K`K`]"K`K`bbbb-M$cOcH<`,(!F_K`_K`Hh%1`N@@R! FYIOb FpO #VJDwwFhQJ R$ "% ("","0 "4#FAF8":I_+F*FQFpf 0FC# (FCC Cc*K-h*1 "@F3$Kh;H#P " C" FD#O1KIh#H;`)DF`PIH"P2`aE0abbV0PbMbZ)bbbKh`KhBHD@ڼ J Ih@oOcFF`T@baj0b( (^] 8FF#h FkiG"!( 88FjB !F`h0ahH!o8+y+ F8@I;00FCl hki㱀lE FUyByCyCyCzCBzC#h FkiG&ah@H(ah@Hپ00-AF1F(F!#3`3qOIF"lF(OKI"lF(G+hki+UFOlEH  #y C  C  C  C  CBbyCyCyC"zCbzC"0F`ih2H9F2F1H~0Hz"0Fo(Fb "0Fd#ybyCyCyC"zCbzCЩ(FG(ObyCyCyC"zCbzC2FlHm2 GE#y H#C#ql3Fih)R-L-111A1X1w1sF0!FF( Fp[- 50F5 p"!F0hF+!F@( #h+pFhuF)F( N0`0!F( 0`%`$h FpbF $l`ClK`(bFZhB #FHIFF0FaX%O7( x$ F0FnB5DiF(FFh,<,3B F@j1F`h*(B٣lB1} z0s0Cl#`gdlO0!HF H`I@< FFhoFF0Ho F5FoOkl+h(FkhG (Fk#`#$qO Fp $oos( ,#Hr Fp!H8F(4F(/$[lHWHZhlQ.BHJ7[lDt+H8 o%21M11}#` "FF(opFF FF )F jh F#I9( F!I3(" FF +h3+`vKh@ KFh `KhsKJ`4BrK`K`KJ`"K"K2b8m#204,bbbbK(FFK`pGbKhpGb KF` `KJ`Ozs\CKC `bbbMbUKhKabuK`tK )F F`@߀rKh@GOv@qmK]B(FFjKB[f{#{C#@V[B&e}#}:C#[@v@w BоB B@𣀳o-@B@)F F@:O:*@@s B{{e|F&#|vC#[ :*oٮxxF&vBg.e+x@*`+\!(F(V"A.JhB3H" 3yyC#[ +8kz++}+ k}+/H@2F)F F@ֻ+(~k~@ @(>Bi}+}}C#}8A! H[IhGHD<‘P(2bKOsB @s@ B   pG pG‘pKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjt‘Z8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuZE"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "B" ;! Fr r@FFB"w"JFh!4{rd+uu#",v$kuulvvvP-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(FU 4$K`K`K`K`K`# F O0obPPaaaaa$$) x"+219:*K? "+#ppG;:!H[8 )(()) + #@J?O( KhcH) Kh#HKh H"IH(CF(H8 H H lE2Lh2P2 Z222 Hf" K` (H"K @83("_K-M`#"p\O0;`l[KF`%UN#3`0(FWp(o F#;`HK`-1)9 #BL3`-( >K`\";Ko`8He#3`"4K`5"0K`"hb]&Jh)JhB"h#`G0+0++!+0L?"hbFHQ!hHKHh --T$h#o?l0,8bb$bba3Pb'35U-AHF FF:!@FF@Fop8`*Fq F# ,D<(*FI)FCF#IҲ]H3hx0; +!h@@pOpFK FK ‘"K`8$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fh%!J!ueu[v#vuu%vevK6`uK u(F`E K`@lZ3UbaPPpaaa-M }F FF#+" 1 (%KhB"#K`0+Ob% QFrrqqF""YFPF! FTr r%uuuGu uFFD9F2F1F(FMl8P LhFp hF!h8K"h` K`dO0U KKKNh2h:*S]jSSwOrRAI F*?H0D F=I!=IK?Hh5>H=K F`1 %\g4 Tr> *k~W%#Q u1Hw6 8f 6 B f1禠f(akfff4ypfBfm6GurR  N fmOL4% %  %%fm%ttH; 8Q*fm> Z*YO #BmGfm U1WW #CQ1f]]i@rk%GJ #Cf YG #0#C f *fNC #C foopJ#kZY\UTooo:#C fmE   #C fm; ( #C fm* EܕE 4UtL#C fmk'#C f(*>~'#C f #' #C c 5(LQ6 g% %ȵGH       Ae|xe=.   < d j 8Ogz ԼygL50M F;]#༂Z8* j_Ew/r@& eb U9ԋO" MD>zAt6 ;G; eX5Mz* WSQ =Wp _\ s`k cH>%g s jEoB[ m3 o  q ;Xs L#u \4<w kBSy\ ]5Py N%9{ ;:  ͺ Ӻ % ᶶǩʤΫج׻ z    ө׫  ͫ  rE8׫ڬ %.^ƯVS 㺞 ڭΥ H K     ס  ` K ڞ     k  ?}}  c  Z1c L  u>*      6   HU*  Y0/   i@9  #  c8"     p  Q%      BDʬ ׷ é ׫׬#  ) שᶻ﬽ ͫͫ ج# RS ӫӺ 㺩ʬΩз ( l   kC} ig *g*xd]e`F\X#x{gSo+ HMBe^ QHW  | RAL# 4p:g*& sn *Z1ʬ(9 = 0Q%Ƭ(7db3 s ö '  S '=F2}'=)2X'=1+&=A0x'=n.'= s,&'>K)j(? s*KQ&)N(aԻ2*~|zxvutqomjhfc a!^!"["$X$%V%'R'(P(*L*,H,.C.0>13936369-9<%<AAI I 1IZb@r(>8r(Q8 Qd6@C@Ql r +@ܳ9""9#+3;CKS[bipw~;}l|#R1=C.)D:*j6?*  dydd%aihqihhhji=oo!o oK<  *w w  wW w < +w  +~y %Q+)M,,,E+)/)iYYYYYYY Y Y9YYYYYMYY!Y"Y%0Ym(", *$.)#-!+%/`>E520W@oNM`)p ))  /OHH MI}MY*0U0  dLL~ ~e~![NYd9ir;mgK35<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +ީB#8JzЀQjNYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI1M%a5uq'hUh=OtUR1h2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bAY!uC8(H-5Mgw! +AYew %2HWc `A\o!2M[dy-CSa}#:a>Q`B`4Mg  , 9 J h      !! !0!V1@ @ W))'@B&&&&''1'B'T'e'x''''''''3SSSS6 TT.T>T) )!)qqqqppp@x}uu@x}e 65 HͫUͫgpY Ѭ!OHH MI}M/Wkc  @ @    @3W3/545 !54yu04s-|b33}4% 9m4 63O4533355_55557Y5%7#5'4'5+53 555:N @ GM&T  ^ em/xofC=vCC-CDA{ qh*q(>q4PqX bq q xq q.a-m+`ppp@@@@@@@@@;Zx0N#Wbpbxi8fiZb@7p8&@kQ%-l ",FYoQ% D@ܳ(.6<DL !3EWj|KwCvvivvMuecdcNhc Yc `c Qc qc Ucjc9_Y?>QcNUchcYc]c`cdcgcjcncqcuc3Dh&j63 ('19DL   ' 'aSPu u u u u uu?rqr  r 9r Sr or rr^svt t t t t uur.uFu;sSu\uhuvu8t ?8t ?Dt]t sr ;s r s s ^sss t(ts s/s ;s r Hs Ss ^snsssss r r r r Srorsr P P}P1Pi QPQߙ  *`d.BWr(ySMQQeQ=RQR}R @B$Dd ѵ 3(X,8H T!$4"D6l      Y_ab`M3%S S @B* @ @`00P]`FC=݋# $4@Rb71--'?M!y~!!e $$$0$$ T88+998Jd(s*K>;;k}H57NO'g*&]f~/%%2%8%v>%H%B%L%Q% V%[%`%k%v%{%%%%%%%%%%% % %% %%%%%& &&&&(&0&8&>&%%J&F&Q&X&_&e&j6j6ioty} j6j6~/U$`$u$&$$$$$$$$$"$$$$$$% %g*%j6j6 "H4l$%EM^fM|  & %  ~/6 D J  [ e |    F   #  !! 2!;!M!V!o!z!!!!!!!!!!"")";"E"\"h""""""" ""!# #":#E#$d#n#'##(##)##*##+$)$,<$B$j6j6j67[fQQL@ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> %"K5e zj4u  &it ,~ 8;~ !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.BootCurrentBootNext1234567PlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      Xq 9Rk3Le~Fx@r:l4f. ` ( T  H t<'hUh=OtUR1h   +,;=[]__of_translate_addressfdt_fixup_memory_banksrockchip_dnl_key_presseddo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_deviceswrite_mbr_sectorpll_para_configphy_device_createfastboot_mmc_flash_writedwc2_free_requestg_dnl_registerfs_devreadefi_free_poolefi_runtime_relocatewrite_sparse_chunk_rawadc_channel_datadwc2_ep0_readcomposite_unbindefi_free_pageswrite_sparse_image__fsg_is_setadc_start_channelfdt_find_or_add_subnode(((((AAAAAABBBBBB"2BQYaiq 0@PX`hp(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32CACHE: Misaligned operation at range [%08lx, %08lx] %s: adc_channel_single_shot fail! download key pressed, entering download mode...setenv preboot; fastboot usb 0prebootsetenv preboot; ums mmc 0snps,dwc2Setting reboot to fastboot flag ... unknown resetSoC: Rockchip %s Reset cause: %s reset_reasonPORRSTTHERMALWDOGclk-uclass not found %s: %lu rockchip,rk3288-tinker/clock-controller@ff760000rockchip,rk3288w-crucompatiblefailed to set rk3288w-cru compatible (ret=%d) oscaplldpllcpllgpllnplldisplay information about clocks/mmc@ff0f0000/mmc@ff0c0000rk3288_sysconrockchip,rk3288-nocrockchip,rk3288-grfrockchip,rk3288-sgrfrockchip,rk3288-pmuRamdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) silent_linuxconsole=console=ttynull%s %sverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported Cmdline setup failed (err=%d) subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize## Transferring control to RTEMS (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./bootmlocalcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitlepromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-stdextlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efiPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootefi %lxbootefi %lx %lx/dtb/dtb/currentbootmeth_efiu-boot,distro-efidevtypedevnumdistro_bootpartprefixscriptaddrboot_script_dhcpboot.scr.uimgboot.scrarmbianEnvArmbianboot.bmpbootmeth_scriptu-boot,script#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesethernetethaddreth%daddrlocal-mac-addressThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: system-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 14.2.0-4) 14.2.0 GNU ld (GNU Binutils for Debian) 2.43.1 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizeVideo%-12s= %s %sactive FB baseFB copy copy sizeFB size%-12s= %dx%dx%d devicetree = %s serial addr width shift clockbdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryflushOFFInstruction Cache is %s Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheclsclear screenList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstatic-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quit## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! sysFailed to add system information to FDT: %s mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structprotectenable or disable FLASH write protectionon start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writableeraseerase FLASH memorystart end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banksflinfoprint FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # NfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected readingError %s the chip: %d Content isn't valid EDID. Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32edidloopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=%-15s LED '%s' not found (err=%d) LED '%s': LED '%s' operation failed (err=%d) manage LEDs on|off|toggle Change LED state led Get LED state led list show a list of LEDstoggle %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08x %0lx %04xZero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010halfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wphwpartitionsetdsrmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx eth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu rootpathdnsipdomainautoloadNET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part type : - set environment variable to partition type part set type - set partition type for a device part types - list supported partition table types| %-*.*s| %-*.*s| %s ParentDriverOps get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] -ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-rk3288-firefly-rk3288default-arm-rk3288default-armUSB init failed: %d usb_dnl_rockusb USB cable not detected, Command exit. use the rockusb protocol e.g. rockusb 0 mmc 0 mallocReadWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: start sector is not a valid number len is not a valid number unlocksfSPI flash sub-systemHex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type lcdputsprint string on video framebuffer setcursset cursor position within screen in characterError: Incorrect USB controller index udpFastboot UDP not enabled tcpFastboot TCP not enabled Error: Wrong USB controller index format usb_dnl_fastboot USB cable not detected. Command exit. run as a fastboot usb or udp device[-l addr] [-s size] usb | udp addr - address of buffer used during data transfers (0x800800) size - size of buffer used during data transfers (0x8000000)UMS disk %dUMS: LUN %d, dev %s %d, hwpart %d, sector %#x, count %#x Couldn't init USB controller. fsg_init failed usb_dnl_umsg_dnl_register failed Please connect USB cable. CTRL+C - Operation aborted. Auto exit in: %.2d s. Check USB cable connection CTRL+C - Operation aborted Use the UMS [USB Mass Storage] [] e.g. ums 0 mmc 0 devtype defaults to mmc## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image${Failed to get partition driver count Error insufficient memory gpt_partition_listuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname | %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d | status: %i Error: %d (%s) Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s First, set the PMIC device! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: --PMIC max reg: %d Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx Can't write PMIC register: %d! PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read address - read byte of register at address pmic write address - write byte to register at address First, set the regulator device! Regulator: %s - missing platform data! Operation not allowed for fixed regulator! regulator-name%-*s %s (err: %d) * regulator-name:Regulator info:%s %-*s %s %-*s %s %-*s %s %-*s %s %-*s * constraints:* parent uclass:* parent name:* device name: - min uV: - max uV: - min uA: - max uA: - always on: - boot on:* op modes: - mode id:Can't get the regulator: %s! Regulator device is not set! %s: no regulator platform data! dev: %s @ %s Regulator: %s - can't get the Voltage! -fValue exceeds regulator constraint limits %d..%d uV Regulator: %s - can't set the Voltage! Regulator: %s - can't get the Current! %d uA Current exceeds regulator constraint limits Regulator: %s - can't set the Current! Regulator: %s - can't get the operation mode! mode id: %d Regulator: %s - can't set the operation mode! Regulator: %s - can't enable! Regulator: %s - can't disable! enableddisabledRegulator %s status: * enable: * value uV: * current uA: * mode id:Enabled%-20s %-10s %10s %10s %-10s %s StatusModemA%-20s %-10s %10d %10s %-10s %iregulatoruclass operationslist - list UCLASS regulator devices regulator dev [regulator-name] - show/[set] operating regulator device regulator info - print constraints info regulator status [-a] - print operating status [for all] regulator value [val] [-f] - print/[set] voltage value [uV] (force) regulator current [val] - print/[set] current value [uA] regulator mode [id] - print/[set] operating mode id regulator enable - enable the regulator output regulator disable - disable the regulator output %s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed run commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storageNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! binman_init failed:%d modelModel: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storagedigital signal, analog signal, , blank to black, separate sync, composite sync, sync on green, serration vnon-RGBno Not a valid EDID EDID version: %d.%d Product ID code: %04x Manufacturer: %s MAGOQIVSCSerial number: %08x Manufactured in week: %d year: %d Video input definition: %svoltage level %d%s%s%s%s%s Monitor is %s Maximum visible display size: %d cm x %d cm active offPower management features: %s%s, %s%s, %s%s standbyEstabilished timings: 720x400 70 Hz (VGA 640x400, IBM) 720x400 88 Hz (XGA2) 640x480 60 Hz (VGA) 640x480 67 Hz (Mac II, Apple) 640x480 72 Hz (VESA) 640x480 75 Hz (VESA) 800x600 56 Hz (VESA) 800x600 60 Hz (VESA) 800x600 72 Hz (VESA) 800x600 75 Hz (VESA) 832x624 75 Hz (Mac II) 1024x768 87 Hz Interlaced (8514A) 1024x768 60 Hz (VESA) 1024x768 70 Hz (VESA) 1024x768 75 Hz (VESA) 1280x1024 75 (VESA) 1152x870 75 (Mac II) Standard timings: %dx%d%c %d Hz Monitor serial number: %s Monitor ID: %s Monitor name: %s Monitor range limits, horizontal sync: %d-%d kHz, vertical refresh: %d-%d Hz, max pixel clock: %d MHz %dx%d%c %d Hz (detailed) None Enter choice: usbkbdnulldev%s: warning, ret=%dUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusb_kbdusb-keyboard%.*s%*sstdoutstderrsilentNo input devices available!No output devices available!No error devices available!In: Out: Err: pre-reloc realloc() is not supportedalloc space exhausted (unknown)CRC32 for %08lx ... %08lx ==> %08lx vidconsole%s: Failed to probe keyboard '%s' (ret=%d) bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKRKMTDVirtIOBLKMAPUNKNOWN(%d) device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type MBR%s: failed writing '%s' (1 blks at 0x0) DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOu-boot,efi-partition-entries-offsetPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! %s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtd#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesclock-frequencyfixed_rate_raw_clockfixed_clockclock-divclock-multfixed_factor_clockfixed-factor-clockclock-output-namesext_gmacrockchip_sysreset%s: the frequency can not be 0 Hz %s: Cannot find out a supported VCO for Frequency (%luHz). %s: Failed to match output frequency %lu, difference is %u Hz, exceed 4MHZ rockchip_rk3288_crurockchip,rk3288-cru/clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Index Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p little-endianbig-endiannative-endianbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kx%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%sinputoutputunusedunknowngpio-rangesrockchip_gpio_bankrockchip,gpio-bankSystem reset not supported on this platform resetting ... u-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvu-boot,i2c-offset-leni2c-chipi2c_genericrockchip_rk3066_i2crockchip,rk3066-i2crockchip,rk3188-i2crockchip,rk3228-i2crockchip,rk3288-i2crockchip,rk3328-i2crockchip,rk3399-i2cdefault-stategpio_ledgpio_led_wrapgpio-ledsError enabling VMMC supply : %d Unknown modeStatus Error: 0x%08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)MMC Device %d not found eMMC%s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed non-removablefifo-depthfifo-modeclock-freq-min-maxrockchip_rk3288_dw_mshcrockchip,rk2928-dw-mshcrockchip,rk3288-dw-mshcspi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave jedec,spi-nor%s %s: Erase operation failed. udevice *)(NULL%s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-readSF: Detected %s with page size , erase size , total CPU not owner of tx frame failed to enable clock %d failed to get clock phandle(%d) phy-supplyError enabling phy supply Failed to allocate MDIO bus failed to disable all clocks max-speedsnps,reset-active-lowsnps,reset-gpiosnps,reset-delays-us, fiber modeDMA reset timeout Could not initialize PHY %s %s: No link. Speed: %d, %s duplex%s eth_designwareallwinner,sun7i-a20-gmacamlogic,meson6-dwmacst,stm32-dwmacsnps,arc-dwmac-3.70aclk_mac_speedclock_in_outtx_delayrx_delaytx-delayrx-delaygmac_rockchiprockchip,px30-gmacrockchip,rk3228-gmacrockchip,rk3288-gmacrockchip,rk3308-macrockchip,rk3328-gmacrockchip,rk3368-gmacrockchip,rk3399-gmacrockchip,rv1108-gmac(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYgpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: could not find pctldev rockchip,pinsrockchip,grfrockchip,pmubias-disablebias-bus-holdbias-pull-upbias-pull-downbias-pull-pin-defaultdrive-strengthinput-schmitt-disableinput-schmitt-enablerockchip_rk3288_pinctrlrockchip,rk3288-pinctrlgpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8regulatorsact8846 pmicactive-semi,act8846REGact8846_reg%s@%s: set %d uV; set %d uA; enabling (ret: %d)regulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltenable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedrockchip_rk3288_dmcrockchip,rk3288-dmcstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uart%s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) spi-max-frequency%s %s: Invalid cs %d (err=%d) Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported spi_genericpower-supplyenable-gpios#pwm-cellspwmsdefault-brightness-levelbrightness-levelspwm_backlightpwm-backlightvidconsole0no such font: %s, make sure it's name has x format 8x16Video device '%s' cannot allocate frame buffer memory - ensure the device is set up before relocation %s.vidconsole%dvideoError: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel simple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51panasonic,vvx10f004b00ahb%s %s: failed to get ahb reset (ret=%d) %s %s: failed to assert ahb reset (ret=%d) %s %s: failed to deassert ahb reset (ret=%d) remote-endpointedprk3288-dpmipicdn-dplvdsdclk%s %s: failed to get dclk reset (ret=%d) rockchip_rk3288_voprockchip,rk3288-vopvcc18_lcdVCC18_LCDvdd10_lcd_pwren_hvdd10_lcdVDD10_LCDvcc33_lcdddc-i2c-busrk3288_hdmi_rockchiprockchip,rk3288-dw-hdmivcc50_hdmi%s: can't enable vdd-supply!%s: can't enable vss-supply!vdd-polarity-negativevdd-supplyvdd-microvolts%s: Can't update Vdd. Error: %dvss-polarity-negativevss-supplyvss-microvolts%s: Can't update Vss. Error: %ddrivers/adc/adc-uclass.cError in %s/%s(). Wrong channel selection for device: %s Requested channel is not active!Requested channel is invalid!vref-supplycan't get vref-supply: %d can't get vref-supply value: %d Dev: %s - can't get address!rockchip_saradcrockchip,saradcrockchip,rk3066-tsadcrockchip,rk3399-saradcFAILOKAYfastboot_bootcmd0x%pBooting kernel at %s... 0x%08xN/AU-Boot 2024.01+dfsg-5+b20.40x%016zxplatformplatform not setBoard not setValue not setfailed to set partition_ayesinvalid partition namemissing varfastboot.%sVariable not implementedversion-bootloaderdownloadsizemax-download-sizeserialnoversion-basebandproductcurrent-slothas-slotpartition-typepartition-sizeis-userspaceExpected command parameterExpected nonzero image sizeStarting download of %d bytes DATApartitions not setgpt write mmc %x $partitionsCannot set recovery flagCannot set fastboot flagCannot set reboot flagcommand %s not supported. Unsupported commandcommand %s not recognized. unrecognized commandReceived invalid data length downloading of %d bytes finished getvardownloadreboot-bootloaderreboot-fastbootreboot-recoveryset_activeoem formatoem partconfoem bootbusoem runACmdUCmderasinginvalid mmc device invalid mmc devicepartition not givenfastboot_partition_alias_fastboot_raw_partition_Invalid number of arguments. mmcpartinvalid partition or deviceno such deviceno such partitionunknown partition table typeunanticipated error%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success mbr%s: updating MBR %s: invalid MBR - refusing to write to flash invalid MBR partition%s: writing MBR partition failed writing MBR partition failedFlashing sparse image at offset %lu too large for partition: '%s' too large for partitionFlashing Raw Image failed writing to device %d failed writing to device........ wrote %lu bytes to '%s' Erasing blocks %lu to %lu due to alignment failed erasing from device %d failed erasing from device........ erased %lu bytes from '%s' rk_pwmrockchip,rk2928-pwmrockchip,rk3288-pwmrockchip,rk3328-pwm#reset-cellsresetsreset-namesrockchip_resetdr_modeutmiutmi_wideulpihsicUNKNOWNlow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusperipheralotgRx: failed to receive: %d Waiting for Ethernet connection... done. unable to connect. asix_ethError: SMSC95xx: No MAC address set - set usbethaddr smsc95xx_ethdrivers/usb/gadget/dwc2_udc_otg.cWARNING at %s:%d/%s()! drivers/usb/gadget/dwc2_udc_otg_xfer_dma.cBUG at %s:%d/%s()! BUG!No memory available for UDC! crq->brequest:0x%x ep1in-bulkep2out-bulkep3in-int!cdev->configcompositeusb_dnloaddwc2-udc%s: failed!, error: %d | / - \invalid number of LUNs: %u Linux %-8s%-16s%04xFile-Store GadgetMass Storage Function, H%c=%unwritten:%zd amount:%u Unknown x%02xf_fastbootstatus: %d ep '%s' trans: %d Error %d on queue Bad status: %d buffer overflow failed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in unknown command: %s FAILunknown commandFAILbuffer overflowRockusb command %x not support yet f_rockusbinvalid device "%s", %d failed erasing device %s: %d failed writing to device %s: %d failed reading from device %s: %d read storage id EMMC read chip version: rockkusb set reboot flag: %d usb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No working controllers found usb_dev_genericu-boot,bootdev-usbdisable-over-currenthnp-srp-disable%s %s: Error disabling vbus supply %s %s: Failed to reset: %d vbus-supply%s %s: Error enabling vbus supply USB DWC2 Root-Hub submit IRQ: NOT implemented unsupported root hub command %s %s: Timeout poll on interrupt endpoint dwc2_usbbrcm,bcm2835-usbbrcm,bcm2708-usbenv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,silent:silent,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksMMC partition switch failed u-boot,mmc-env-partitionu-boot,mmc-env-offsetInvalid ENV offset in MMC, copy=%d No MMC card foundNo block deviceMMC partition switch failedWriting to %sMMC(%d)... !read failed** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsfatext4unsupported** Can not find directory. ** ** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s error: overflow occurs Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driver/EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed 1234567Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting kaslr-seed ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx out of memory%s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition Cannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event ERROR: Failure adding GOP protocol Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### Failed to install ECPT %d iterations in %lu ms: %lu/s, %lu DMIPS dhry[iterations] - run dhrystone benchmark - run the Dhrystone 2.1 benchmark, a rough measure of CPU speed DHRYSTONE PROGRAM, SOME STRINGDHRYSTONE PROGRAM, 1'ST STRINGDHRYSTONE PROGRAM, 2'ND STRINGDHRYSTONE PROGRAM, 3'RD STRING/binmanmultiple-imagesSuccessOperation not permittedNo such file or directoryNo such processInterrupted system callNo such device or addressArgument list too longExec format errorBad file numberNo child processesTry againOut of memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeMath argument out of domain of funcMath result not representableResource deadlock would occurFile name too longNo record locks availableFunction not implementedDirectory not emptyToo many symbolic links encounteredNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorNot a data messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyIllegal byte sequenceInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on transport endpointProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection because of resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConnection timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale NFS file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorQuota exceededNo medium foundWrong medium typeUnknownmanufacturer01/01/2024Unknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassis%s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!Malloc failed for: CHUNK_TYPE_RAW%s: Write failed, block #%lu [%lu] flash write failure(incomplete)Bogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILLWrite failed, block #%s: %s %lu [%d] flash write failureBogus chunk size for chunk type CRC32%s: Unknown chunk type: %x Unknown chunk type........ wrote %llu bytes to '%s' sparse image write failureevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okaydisplay-timingshback-porchhfront-porchhactivehsync-lenvback-porchvfront-porchvactivevsync-lenvsync-activehsync-activede-activepixelclk-activeinterlaceddoublescandoubleclkseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcintel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address DT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM ethactethrotateethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipnetretryonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead  bootcmd=bootflow scanbootdelay=2baudrate=115200preboot=usb startloadaddr=0x800800arch=armcpu=armv7board=firefly-rk3288board_name=firefly-rk3288vendor=fireflysoc=rk3288mtdids=mtdparts=fdt_high=0x0fffffffinitrd_high=0x0ffffffffdtfile=rk3288-firefly.dtbpartitions=uuid_disk=${uuid_gpt_disk};name=loader1,start=32K,size=4000K,uuid=${uuid_gpt_loader1};name=loader2,start=8MB,size=4MB,uuid=${uuid_gpt_loader2};name=trust,size=4M,uuid=${uuid_gpt_atf};name=boot,size=112M,bootable,uuid=${uuid_gpt_boot};name=rootfs,size=-,uuid=69DAD710-2CE4-4E3C-B16C-21A1D49ABED3;scriptaddr=0x00000000pxefile_addr_r=0x00100000fdt_addr_r=0x01f00000kernel_addr_r=0x02000000ramdisk_addr_r=0x04000000stdin=serial,usbkbdstdout=serial,vidconsolestderr=serial,vidconsoleboot_targets=mmc1 mmc0 nvme scsi usb pxe dhcp spi0123456789ABCDEFuoincompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1hdwc2-udcarocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] ep0-control Android Fastbootaddr [-c] [-q] [] - Set the [control] fdt location to fdt systemsetup - Do system-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.Mass Storage0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c edid chip - print EDID configuration information i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to Rockchip #(-27] - Run script starting at addr !R\248>Ž ;?2H53F6CDBALinux U-Boot 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000)QMSROQUITSUSEUEXOyXY5ZYOY_8 j6j6E5 j6j6  j6j6/  j6j6L5 @j6j6T5 j6j6X5 j6j6]5 j6j62 j6j6( Inj6j6:rj6j6:Irj6j6><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666nnioYu=sAs=rr'suu}w:uD-DDD}G:OD:Q;::zy:::E;:::K;:Q;::BOOTSERVdmmK/ ՊՏ1)}sM=I݉ٙ͜Eٖ=ɓYKum%88aQEũ5 hPP21ȂȂ1a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ (ܠsH}(]P9 aBj^j9 o9j6R: r[:: j5j64 j5j6 =v=k6FF8F7n)7|7-n)  j"57Յ iۅxEAEE3= w9=0;9 E!j6> iy>j6#k 'k6k> yy>j6* IYkekb jj=  y==* yHx' ,S?z)?@ze ={\?q?#=$C.Cj6 qi1B0W6WIWF eFj6HHHI GGFFFG GGHH6HT eZg )MK KKqL٘yLLL GLI eIITJ WZJhJN˘H6HJIJJ/SDnX uXX+Y 2YLYY  Yj62 i22f`;`ݣ s5 kx55 b2L> x>;>3 Ik3%4 aePb c'c a] ccY YYHǥ\\gUgMghɹh>hfUgMgeUgMgb Mij GZ ſ)l8l]v ybvxv nnb kk i~~}}}b kk6- b kk5 k66V  <Q mXs  Ҩx %MTUT~T) l kb5j6vi}ii, 6H(2A2 %ǎ qPx"[ե'[A[aj6 !$FYس  Q  )h8H^Qx Wxux81o8 Tl qb mu qxpx#6 i;t -; q[j, =4I6 lm6j6cio($SHE)xmRU*YUL*\1UU)TU)oPPeP0V5( @ 8G &0,e(GYJLQL@$, (TAT@0 5 (u ~8 r8u9X?9! aLYY*Q-/lwyu WY[hhR Y<cp-qc0-q@!d9!Ltz^pѶ2\e8y6lw _ (U8} $daHqXhH7m76x@lHZMc \^ј(m mQQ(,;s uwPdr8Ot1~}q} ~X >hehg~BxX8bh2t6i?ew:-E3ɟ(>T3%g]yU3=98 - lj ! @UA \d;I[Y}Ue(Rb(=U(BG ()0l! g*&a{}1-(MQ)f2W6  8>5 ]?HLQSWY]pZ^[f^a,cjei8elrrm "q y}x =s.r7uw}5 @ $~~WL D@ $~B݉ 408| @hlLTX $   $(,048dhlptx|048HL(dhlptx|Dl HLPT(!!!!!x"|"""H#L#P#T#X#\#,$0$4$8$$''''''''''''''''''''')))))))*****+++ ++++@,D,H,,,,0-X----t/x/// 000022222222222222222225 55555 5$5(5,5054585<5@5D5556666666777 77777 7$7(7,7074787888888888888888888888888H99994;8;<;@;D;;;<<<<=========>>>>>>>>>>>>?D?H?h??@@@@AAA AAAAAAA B$BBBBBBBB\CCEEEDEEEE F$FDGHGLGPGTGXH\H`HdHhHHH@IDIHIIIIJMMdOhOOPPQQQQQQ>??@AAA\E`EdEhElEpEtExE|EEEEEE0F4FFH4L8L>>>>>>>??H?@@@AA AAAAA A$A(A,AlAdBhBlBpBtBBB$CCCCCC D(DDDD@GtGxGGKKKKLLL LLLLLNNNOOO OOOOO O$O|OOOOOOOOOOOQQQQQQdShSSTTTTTUPUUUVV VV`WXYYY,Z0Z4Z8Zl[,\x\4]cceefffffiimmmnnnnnn4r8rxs@uHuLuPuTu\w`wdwhwlwpwtwxwyyyyyyzzz zL{P{T{X{\{{{0|||}}<~@~D~H~P~T~X~\~|,048@DHLPT` (,04< X\dhltx|048\`h Њ  (th@DdL04 8<8\Ȝ Пԟ؟ܟ$08<Dt8HLPTX\ħȧ̧8ب,0 DL8ج$(,048<@DHLPTX\`dhlptx|ĮȮ̮ЮԮخܮİIJȲвԲزT(,0$ļԽؽܽ  $(,048<@DHLPTX\`dhl<@DHLPTX\`dh`dhlp$(,HPX\|X(0LPT\`lp$  t\`dd   p  $(,ttxP`d@DL   $  l      p t   p x ,0lptx X\`d $(Ddh   $(,`L `dhlpt@ D H L P T X \ `  !!!!h$l$p$t$x$|$$$$$$$$$$$$$$L%P%T%X%%%%'P+T+X+l.p.t.x.L/P/3 3$3(388888888;;;;;>>>,?0??????GGGJ$K(K,K0KPPDQTQxQ|Q(RRRWWWWWWWWWWWWWWWWW X$X(YYxZZ[]^___abbbbbbbbbcccccdddd(fhff(g,ghhhhjj4mXm$p(ppTqqqqqqqqqqqqssssstxyyyzzzzt~(x|āȁ́48<,0|ԆLċPTX`dhlptx|ԏ؏܏(,048<@DHLPTX\`dhx|tx| \`hlptx|̔ДԔؔptx|\`dhlptx|$Lěț̛PTX\`Н$(TXpĞȞ̞ lptxğܟ 0tx|48<@DHLPTX\`dhlġȡģȣ̣Уԣأܣtx̤@8<@DHLPTPTX\`dhlptx<@DHLPTX\`dhlptx|Щ8Pd  $((,0dhlptx<@DLPTX\`dhlptx|048<@DHLPijȳ̳гԳسܳ  $(,048<@DHLPTX\`dhlphlptx|  $(,048<@DHLPTX\`dhlptx  $(,048<@DHLPTX\`dhlptx| $(0HLPdp ,8<Pdlt| (08@HPX`dhlptx| ,048<D\tx (8<\`dhlptx|DHLPTX\`dhlptx|  48<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,x  $(,0X\p  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLTX\`dhlptx| (08@HPX`hpx8@HPX`hpx $(04<@HLTX`dlptx|(8HXhx $,4<DLT|  (4@LXdp| $0<HT`lx ,8DP\ht(08HX`dx|,08@HPT\ptx| $(,048<@DHLP\lptx|  ( $DHLdlt| (,48@DLPX\dhpt| $(04<@HLTX`dlpx|  $,08<DHPT\`hltx (,48@DLPX\dhpt| $(048HLPTXhxUUUUUUUUUUUUUUUUUVV VVV V(V0V4Vspi@ff110000(rockchip,rk3288-spirockchip,rk3066-spiARFspiclkapb_pclkJ  Otxrx ,default !C}okayspi@ff120000(rockchip,rk3288-spirockchip,rk3066-spiBSFspiclkapb_pclkJ Otxrx -default"#$%C }disabledspi@ff130000(rockchip,rk3288-spirockchip,rk3066-spiCTFspiclkapb_pclkJOtxrx .default&'()C }disabledi2c@ff140000rockchip,rk3288-i2cC >Fi2cMdefault*}okayi2c@ff150000rockchip,rk3288-i2cC ?Fi2cOdefault+ }disabledi2c@ff160000rockchip,rk3288-i2cC @Fi2cPdefault,}okayi2c@ff170000rockchip,rk3288-i2cC AFi2cQdefault-}okayvserial@ff180000&rockchip,rk3288-uartsnps,dw-apb-uartC 7YcMUFbaudclkapb_pclkJOtxrxdefault ./0}okayn6serial@ff190000&rockchip,rk3288-uartsnps,dw-apb-uartC 8YcNVFbaudclkapb_pclkJOtxrxdefault1}okayn6serial@ff690000&rockchip,rk3288-uartsnps,dw-apb-uartCi 9YcOWFbaudclkapb_pclkdefault2}okayn6serial@ff1b0000&rockchip,rk3288-uartsnps,dw-apb-uartC :YcPXFbaudclkapb_pclkJOtxrxdefault3}okayn6serial@ff1c0000&rockchip,rk3288-uartsnps,dw-apb-uartC ;YcQYFbaudclkapb_pclkJ  Otxrxdefault4 }disableddma-controller@ff250000arm,pl330arm,primecellC%@p{ Fapb_pclkthermal-zonesreserve-thermal5cpu-thermald5tripscpu_alert0p>passive6cpu_alert1$>passive7cpu_crit_ >criticalcooling-mapsmap060map170gpu-thermald5tripsgpu_alert0p>passive8gpu_crit_ >criticalcooling-mapsmap08 9tsadc@ff280000rockchip,rk3288-tsadcC( %HZFtsadcapb_pclkG qtsadc-apbotp_out: "H }disabled5ethernet@ff290000rockchip,rk3288-gmacC) /macirq?;8fgc]MFstmmacethmac_clk_rxmac_clk_txclk_mac_refclk_mac_refoutaclk_macpclk_macGB qstmmacethL\<sinputdefault=>?@Argmii 'B@ B0}okayusb@ff500000 generic-ehciCP FusbhostCusb }disabledusb@ff520000 generic-ohciCR )Cusb }disabledusb@ff5400002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2CT FotghostD usb2-phy}okaydefaultEusb@ff5800002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2CX Fotgotg!0@@ F usb2-phy}okayusb@ff5c0000 generic-ehciC\ Fusbhost }disableddma-controller@ff600000arm,pl330arm,primecellC`@p{ Fapb_pclk }disabledi2c@ff650000rockchip,rk3288-i2cCe <Fi2cLdefaultG}okaysyr827@40silergy,syr827?C@\vdd_cpuk PpH syr828@41silergy,syr828?CA\vdd_gpuk PpHhym8563@51haoyu,hym8563CQxin32k&IdefaultJact8846@5aactive-semi,act8846CZdefaultKLregulatorsREG1\vcc_ddrkOOREG2\vcc_iok2Z2ZREG3\vdd_logkREG4\vcc_20kREG5 \vccio_sdk2Z2ZREG6 \vdd10_lcdkB@B@REG7\vcca_18kw@w@REG8\vcca_33k2Z2ZREG9\vcc_lank2Z2ZAREG10\vdd_10kB@B@REG11\vcc_18kw@w@REG12 \vcc18_lcdkw@w@i2c@ff660000rockchip,rk3288-i2cCf =Fi2cNdefaultM}okaypwm@ff680000rockchip,rk3288-pwmChdefaultN_ }disabledpwm@ff680010rockchip,rk3288-pwmChdefaultO_}okaypwm@ff680020rockchip,rk3288-pwmCh defaultP_ }disabledpwm@ff680030rockchip,rk3288-pwmCh0defaultQ_ }disabledsram@ff700000 mmio-sramCp psmp-sram@0rockchip,rk3066-smp-sramCddr-sram@1000rockchip,rk3288-ddr-sramC@sram@ff720000#rockchip,rk3288-pmu-srammmio-sramCrpower-management@ff730000&rockchip,rk3288-pmusysconsimple-mfdCspower-controller!rockchip,rk3288-power-controllerLh\ cpower-domain@9C chgfdehilkj$RSTUVWXYZpower-domain@11C op[\power-domain@12C ]power-domain@13C ^_reboot-modesyscon-reboot-mode RBRB+RB ;RBsyscon@ff740000rockchip,rk3288-sgrfsysconCtclock-controller@ff760000rockchip,rk3288-cruCv?;GHLjk$T#gׄeрxhрxhsyscon@ff770000&rockchip,rk3288-grfsysconsimple-mfdCw;edp-phyrockchip,rk3288-dp-phyhF24mi }disabledsio-domains"rockchip,rk3288-io-voltage-domain }disabledusbphyrockchip,rk3288-usb-phy }disabledusb-phy@320iC ]FphyclkG qphy-resetFusb-phy@334iC4^FphyclkG qphy-resetCusb-phy@348iCH_FphyclkG qphy-resetDwatchdog@ff800000 rockchip,rk3288-wdtsnps,dw-wdtCp O}okaysound@ff88b0000,rockchip,rk3288-spdifrockchip,rk3066-spdifCtT FmclkhclkJ`Otx 6defaulta?; }disabledi2s@ff890000(rockchip,rk3288-i2srockchip,rk3066-i2sCt 5RFi2s_clki2s_hclkJ``Otxrxdefaultb }disabledcrypto@ff8a0000rockchip,rk3288-cryptoC@ 0 }Faclkhclksclkapb_pclkG qcrypto-rstiommu@ff900800rockchip,iommuC@  Faclkiface }disablediommu@ff914000rockchip,iommuC@P  Faclkiface }disabledrga@ff920000rockchip,rk3288-rgaC jFaclkhclksclkc Gilm qcoreaxiahbvop@ff930000rockchip,rk3288-vopC Faclk_vopdclk_vophclk_vopc Gdef qaxiahbdclkd}okayport endpoint@0Cewendpoint@1Cftendpoint@2Cgnendpoint@3Chqiommu@ff930300rockchip,iommuC  Faclkifacec }okaydvop@ff940000rockchip,rk3288-vopC Faclk_vopdclk_vophclk_vopc G qaxiahbdclki}okayport endpoint@0Cjxendpoint@1Ckuendpoint@2Cloendpoint@3Cmriommu@ff940300rockchip,iommuC  Faclkifacec }okayimipi@ff960000*rockchip,rk3288-mipi-dsisnps,dw-mipi-dsiC@ ~d Frefpclkc ?; }disabledportsportendpoint@0Cngendpoint@1Collvds@ff96c000rockchip,rk3288-lvdsC@g Fpclk_lvdslcdcpc ?; }disabledportsport@0Cendpoint@0Cqhendpoint@1Crmdp@ff970000rockchip,rk3288-dpC@ bihcFclk_edpclk_edp_24mpclk_edpsdpc Goqdp?; }disabledportsport@0Cendpoint@0Ctfendpoint@1Cukhdmi@ff980000rockchip,rk3288-dw-hdmiCct?; ghmnFiahbisfrcecc }okayvportsportendpoint@0Cweendpoint@1Cxjvideo-codec@ff9a0000rockchip,rk3288-vpuC   /vepuvdpu Faclkhclkyc iommu@ff9a0800rockchip,iommuC  Faclkifacec yiommu@ff9c0440rockchip,iommuC@@@ o Faclkiface }disabledgpu@ffa30000#rockchip,rk3288-maliarm,mali-t760C$ /jobmmugpuNzbc  }disabled9opp-table-1operating-points-v2zopp-100000000~opp-200000000 ~opp-300000000B@opp-400000000ׄopp-600000000#Fqos@ffaa0000rockchip,rk3288-qossysconC ^qos@ffaa0080rockchip,rk3288-qossysconC _qos@ffad0000rockchip,rk3288-qossysconC Sqos@ffad0100rockchip,rk3288-qossysconC Tqos@ffad0180rockchip,rk3288-qossysconC Uqos@ffad0400rockchip,rk3288-qossysconC Vqos@ffad0480rockchip,rk3288-qossysconC Wqos@ffad0500rockchip,rk3288-qossysconC Rqos@ffad0800rockchip,rk3288-qossysconC Xqos@ffad0880rockchip,rk3288-qossysconC Yqos@ffad0900rockchip,rk3288-qossysconC Zqos@ffae0000rockchip,rk3288-qossysconC ]qos@ffaf0000rockchip,rk3288-qossysconC [qos@ffaf0080rockchip,rk3288-qossysconC \dma-controller@ffb20000arm,pl330arm,primecellC@p{ Fapb_pclk`efuse@ffb40000rockchip,rk3288-efuseCq Fpclk_efusecpu-id@7Ccpu_leakage@17Cinterrupt-controller@ffc01000 arm,gic-400( C @ `   pinctrlrockchip,rk3288-pinctrl?;*gpio0@ff750000rockchip,gpio-bankCu Q@9I(gpio1@ff780000rockchip,gpio-bankCx RA9I(gpio2@ff790000rockchip,gpio-bankCy SB9I(gpio3@ff7a0000rockchip,gpio-bankCz TC9I(gpio4@ff7b0000rockchip,gpio-bankC{ UD9I(Bgpio5@ff7c0000rockchip,gpio-bankC| VE9I(gpio6@ff7d0000rockchip,gpio-bankC} WF9I(gpio7@ff7e0000rockchip,gpio-bankC~ XG9I(Igpio8@ff7f0000rockchip,gpio-bankC YH9I(hdmihdmi-cec-c0U{hdmi-cec-c7U{hdmi-ddc U{{hdmi-ddc-unwedge U|{pcfg-output-lowc|pcfg-pull-upn}pcfg-pull-down{~pcfg-pull-none{pcfg-pull-none-12ma suspendglobal-pwroffU{ddrio-pwroffU{ddr0-retentionU}ddr1-retentionU}edpedp-hpdU ~i2c0i2c0-xfer U{{Gi2c1i2c1-xfer U{{*i2c2i2c2-xfer U { {Mi2c3i2c3-xfer U{{+i2c4i2c4-xfer U{{,i2c5i2c5-xfer U{{-i2s0i2s0-bus`U{{{{{{blcdclcdc-ctl@U{{{{psdmmcsdmmc-clkU sdmmc-cmdUsdmmc-cdU}sdmmc-bus1U}sdmmc-bus4@Usdmmc-pwrU {sdio0sdio0-bus1U}sdio0-bus4@U}}}}sdio0-cmdU}sdio0-clkU{sdio0-cdU}sdio0-wpU}sdio0-pwrU}sdio0-bkpwrU}sdio0-intU}sdio1sdio1-bus1U}sdio1-bus4@U}}}}sdio1-cdU}sdio1-wpU}sdio1-bkpwrU}sdio1-intU}sdio1-cmdU}sdio1-clkU{sdio1-pwrU }emmcemmc-clkU{emmc-cmdU}emmc-pwrU }emmc-bus1U}emmc-bus4@U}}}}emmc-bus8U}}}}}}}}spi0spi0-clkU }spi0-cs0U }spi0-txU}spi0-rxU} spi0-cs1U}!spi1spi1-clkU }"spi1-cs0U }%spi1-rxU}$spi1-txU}#spi2spi2-cs1U}spi2-clkU}&spi2-cs0U})spi2-rxU}(spi2-txU }'uart0uart0-xfer U}{.uart0-ctsU}/uart0-rtsU{0uart1uart1-xfer U} {1uart1-ctsU }uart1-rtsU {uart2uart2-xfer U}{2uart3uart3-xfer U}{3uart3-ctsU }uart3-rtsU {uart4uart4-xfer U}{4uart4-ctsU }uart4-rtsU {tsadcotp-pinU {otp-outU {:pwm0pwm0-pinU{Npwm1pwm1-pinU{Opwm2pwm2-pinU{Ppwm3pwm3-pinU{Qgmacrgmii-pinsU{{{{{{{ {{=rmii-pinsU{{{{{{{{{{phy-intU }@phy-pmebU}?phy-rstU>spdifspdif-txU {apcfg-output-highpcfg-pull-up-drv-12man act8846pwr-holdULpmic-vselU|Khym8563rtc-intU}Jkeyspwr-keyU}ledspower-ledU{work-ledU{usb_hosthost-vbus-drvU{usbhub-rstUEusb_otgotg-vbus-drvU {irir-intU}memoryCexternal-gmac-clock fixed-clocksY@ ext_gmac<ir-receivergpio-ir-receiverdefault Igpio-keys gpio-keysbutton@0  GPIO Powertdefaultleds gpio-ledswork firefly:blue:user rc-feedbackdefaultpower firefly:green:power default-ondefaultvsys-regulatorregulator-fixed\vcc_syskLK@LK@Hsdmmc-regulatorregulator-fixed I default\vcc_sdk2Z2Zflash-regulatorregulator-fixed \vcc_flashkw@w@usb-regulatorregulator-fixed\vcc_5vkLK@LK@Husb-host-regulatorregulator-fixed default \vcc_host_5vkLK@LK@usb-otg-regulatorregulator-fixed  default \vcc_otg_5vkLK@LK@chosen"/serial@ff690000(.same-as-spl/mmc@ff0f0000/mmc@ff0c0000binmanDsimple-binTu-boot-rockchip.bin]mkimageTidbloader.imgf-nrk3288-Trksdku-boot-tplu-boot-splu-boot-img dmc@ff610000rockchip,rk3288-dmcsyscon Cabcd(lmno<Fpclk_ddrupctl0pclk_publ0pclk_ddrupctl1pclk_publ1arm_clk?;*BN  $  @ CH  `@0Ud''Z syscon@ffac0000rockchip,rk3288-nocsysconC configfirefly:green:power #address-cells#size-cellscompatibleinterrupt-parentmodelethernet0i2c0i2c1i2c2i2c3i2c4i2c5mshc0mshc1mshc2mshc3serial0serial1serial2serial3serial4spi0spi1spi2gpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8mmc0mmc1mmc2mmc3interruptsinterrupt-affinityenable-methodrockchip,pmudevice_typeregresetsoperating-points-v2#cooling-cellsclock-latencyclocksdynamic-power-coefficientcpu0-supplyphandleopp-sharedopp-hzopp-microvoltrangesclock-frequencyclock-output-names#clock-cellsarm,cpu-registers-not-fw-configuredarm,no-tick-in-suspendclock-namesportsmax-frequencyfifo-depthreset-namesstatusbus-widthcap-mmc-highspeedcap-sd-highspeedcard-detect-delaydisable-wpnum-slotspinctrl-namespinctrl-0vmmc-supplybootph-allbroken-cdnon-removablevqmmc-supply#io-channel-cellsvref-supplydmasdma-namesreg-shiftreg-io-width#dma-cellsarm,pl330-broken-no-flushparm,pl330-periph-burstpolling-delay-passivepolling-delaythermal-sensorstemperaturehysteresistripcooling-device#thermal-sensor-cellshw-shut-tempinterrupt-namesrockchip,grfassigned-clocksassigned-clock-parentsclock_in_outphy-supplyphy-modesnps,reset-active-lowsnps,reset-delays-ussnps,reset-gpiotx_delayrx_delayphysphy-namesdr_modesnps,reset-phy-on-wakeg-np-tx-fifo-sizeg-rx-fifo-sizeg-tx-fifo-sizefcs,suspend-voltage-selectorregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onvin-supplysystem-power-controller#pwm-cells#power-domain-cellspm_qosoffsetmode-normalmode-recoverymode-bootloadermode-loader#reset-cellsassigned-clock-rates#phy-cells#sound-dai-cellsrockchip,playback-channelsrockchip,capture-channels#iommu-cellsrockchip,disable-mmu-resetpower-domainsiommusremote-endpointddc-i2c-businterrupt-controller#interrupt-cellsgpio-controller#gpio-cellsrockchip,pinsoutput-lowbias-pull-upbias-pull-downbias-disabledrive-strengthbootph-pre-ramoutput-highgpiosgpio-key,wakeuplabellinux,codelinux,default-triggerstartup-delay-usenable-active-highstdout-pathu-boot,spl-boot-ordermultiple-imagesfilenamepad-byteargsmultiple-data-filesrockchip,crurockchip,nocrockchip,sgrfrockchip,sramrockchip,pctl-timingrockchip,phy-timingrockchip,sdram-paramsu-boot,boot-led