eGON.BT0`SPL,sun4i-a10-pcduinoᆳ61)  <Oo/Oo   P!:0@"  Р`K @J" I((_" I O0CDCF+     H  D" Ii_" Ivi CD8 FD B8,F (4 F8pGKhB `pGTJ3!6 !7 !7 9)!H@_Os",_AA_,pGpGq FFF/t$t;h_3@B"BHI&DKh "` pGXJ" FF4 <]"F 4 H]7 F FX04C(F07 F FP0#B#(F0_Ot Kce_K #`_Kce_KbP_Os"enB2fpG#OsnCf pG"f-E&0KS6PBS.K/L-F.K(F+D 4 !F')KD8OhCF"F)F&H%K?DpGpF Fb0o)F F\8"#F6@BؿO)F Fp@6?D8pG/٠P-PIHЀ Р )/@J РmРm000 S PР 8 /OOF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGpGHd qDC?@ pGpG8#F" I}u0B*F!FHO08DD! $!! @! $ F! F!K F!4(, @ @B8GFO`HC@@{C@0C C CHMF/c<H <  H8h(o%((6Ho8hF8hV)F{F .H%8h}?hm 8F?Fio?0"FFQF F|GP*FAF0F?F|piAFiF0D FAFVF8FBFoh GE-?qhi)j H4EOEJFFFoFF@##F-]P08 pG"F!D4@KS CkGOF  B0 pGKS kGpGO  20 pGF  J0KXhkGpGO0 D; DIB @BH 2"F F!ݿ8(FF*F! F8 Q @B2 ,A@78<,<Цk< #cC+F-2[B 20G 23B 2!BcCBs Ӕ@IOzqh Hn#@080#30GpG8 ?@)F F)F F8@ƹ-MFF-&FO  %` F#hӳ#E(F T%0K&0CD%0m6RD#[>R&T#D#CBOOC ERD#[#E=F-AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FH;GBFًB F FDBF9DB xO3OzrF33PhF|dOzs!pFNB%F(5F(F3dp D4#FFFQ #F.-MF FFF%) FhGEFix"-) x550) ##0 +#l)'`i)#q'%)ʀ)иF00 + c)d)u)V;(у #`0# 0##qp_+ \#%777_77%+ !`-![B O O JH!qFBٔɲQ )OWO0AD ;I OшV)O OPO"sF Bٔ۲S +OW O0 SD 0 O?[#; !` 0PV!#hpCF3#`F:+O0 O #` 2YF FhG :ܸ?)? FhGʚ;K FFhF ]RK ]pG$" (ʿKK 80pG,0%P!0@#@C@!00F@ F@0% 1P!0d@#@C@!00F@ F@0%L1P!0@#@C@!00F@ F@ K J KZCBF L Hx F(,# qDPK|K.PKeGpKFJJSCB Fh"F)FG #bEaap|KPK.-AF FFF*F!F3FG-AF FFF *F!F3FG0 FFF-M$FFOD &FO % kH@EӰBFD +F4,ѿ_ v0F6npF_P#@5`&i_.h_. p Y=@p@FGi_h__%aD `>_ga_&`_e` F@F F@7h_# #3i_B$CDtD ?3i_$CDt p &@&FF_`#``_`_@#`1F Fp@pF H4 HG8 F@jbB!ҲFF`_@#X!(F`Fh_(FE F8 F@j!F @jFFF_'aD `1F F_%`_g` F@-E@jFF FFi_ -b!(FtO@ F O@ c+(F, F/60_`_(!(F 7FF;_`_(!(F F-M@jFFF NFi_ OF1!(FO@ F  T!F(FҲ F >t(F, F 0_`_(!(F F!.տ##X!P!C@_(F`@h_;>sFh[h[hGFpG7F))$"o FEa 0&(1[hP1hFO0O0pGh[hhGFFFF:F1F(F<FOzp" F FO`r F#0#FYhkh K@ @BCCC" Fc #0#l0 F#" #`p)FRѢABAAr@,Ld)sL!!CBB@r#(F"wFPBOzrhF[hi;!(FGF&iF(FF8Ro d 0FBomFp!OtoX!$@$p1# *F #0#h+ )##" ]#-MFFFF@hIF`(Fz(jiB)H&0F Fo(ѣhZhiu2FAF FGFFE]F(UF-4""i o## FFȹ- F@ H9F*FBo /DѲ"GG#0##Or# ]0Jh}B }0 ?$?!F\Q(ѕ 0BoI 0Bѕ 0Bѕ 0B"(@p)F F}!+ #"!0FF%- ?%?)F0Fp K*F F }p#oFohsJ?C|BF}ʀ ?%?)F`(@Ā\@Op\(Or)F40+_JR#^K`B@0RBR^#C3BOPpTK($bB0r00`Z*#s0n0 q 6 o [0#00[0#F0:x<"<D*An02 #CR3#0EAЕ0ѱ#"F FF#0isn [CSR$#0ԕ0p000 }\1+#\1o o?B@@-EFF'_ q0"#!(FC F(? N1F(FF(F FF(ڣh[hh F@G Bh\iiB(!FB8FAbwpG-EEiFF-@#p1# F#webh[h[i+vO`Kh F[hhGF(@oXcg#h#b Fb*F)F F FF(k F'#r0h FhJK@+ #Os#*Fz(0+BK`@8?N7#"0# Fc(>)#0#hhhREOCC FJ0+۸JOzp FG(ck#xscccsa#Jhl0B2`%(F n) F. F)! F>Fk+ 0Fzd 5#T1omHo^FHhFhCSCCcHh[hh+! F @#Hcaoz#U10H-MGiF'%(F`8FU1+e%T1UQ+e#,0#" p1 `#1F FF(@"\#3l0*F`#1F Fs`F(@h"+1Fl0 #3#s`l0 F`mF(@|ihehpiOdP`eEb:*>jlnp FaF(ЇkTQ+ FS(FF! FeF(@Hk+ 0FzWd sOBa#`l0mF1F FzJ`I\IQ#0OSC"igcg1ChX!d@-O C|CCuF 3  #E CXCO O 5Or(D$0&(*,.0gakZ "2"1F F`r`#O3l0"1F F`F(@# Fq0F(@ F)z FYF(@hnI*7#H0l0F!c F1F`tF(@3#3## ``S`1F# F*? ^F(i0bd+ r+rPHOPKFP`H#khDCS#cKKdB-O ? (?#d0#@# # Fl`S`F`0պ 0B#kC#cORO^#kbk0M@#xs"+hB+K5B*H)M#ca((J(J(J(J@sCs0$KKO khV+@ кOк_6к_À"o Fh!agX! +O @;IdCTCdCFH@@@@ O7#1#l FB@"A~F(!# H A FOH@BiF(Ѻ_## F#b"hKB]+hh1+@o"9F FggX1kh1l1X1Osg F#CsoF13!;#A19!!9!?a4""a"o@+@@@ka# 0I0^0#ca;On+h#+5O#0#!KH"@#`# ?*? F`S` (0CE?x +pJR#pKBKAt#r!clI\1Bt jHjN&c0`1gJ FF&cHFckH&c" Fo@O \O]KB)F\HW< 3B`< E7W<, C B@W!0F&Ka&K3bO@b$KsbOssc#Kb#K3c-1#) Ka Kc`<#kCOrP#n5@ C0FIf1F D@KceK#dK0KgK0K0)FH OItC u6n IF! $@-(@B#F/O/sL4<# xB 411ɲ# (Q(@! @SBF/O/sI' 19ɲ(@! ǻQF0! @ϻ( @BB"FoOb K#[ ;Aɲ( ! Q7F0@! 0@ % iF% j Ck@SB+F/O/s I19ɲ) Q@! Z0!Q$KS-B( ,h0( D-! 6! @C<C ๝0+@$!4E,! @! ! o0@H%Kh(&I O0Cs0@iGFCj F@GFj F@G8K9 (FS!P !(F!F(F8@C8 FD8)F!!ۿHHK8S @I F >F F@ZC6n I H(FH, 6nHpGJ{۲_#C_s˲_p!_qӲ_spGFQ}۲_Zտ_#q_#t_"r_sKƿpG8 F_!q_#t_#)Fr8@}۲_տ_ )ppGF#}۲_ x_}_pGIK[FHDB pGAhB08KPK8KpFh F0Ci;)F Fp@Go%pF Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-_X^U]U<Tp89S\6P-P1151P5115511511ᆳᆳᆳᆳᆳ@@@@@@@@@@x}uu@x}e @ @ `ppp00'@B7M7E6x@l  (ZZn,^eGON.BT0TOC0.GLHUnknown boot source %d FELTimeout initialising DRAM CPU: %uHz, AXI/AHB/APB: %d/%d/%d Bad mbus_clk resetting ... SPLsunxi SPL version mismatch: expected %u, got %u DRAM: %d MiB Failed to set core voltage! Can't set CPU frequency U-BootTrying to boot from %s SPL: Unsupported Boot Device! SPL: failed to boot from all boot devices U-Boot SPL 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000) SPL: Image overlaps SPL SPL: Image too large spl: unsupported mmc boot device. spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_sector: mmc block read error spl: mmc: wrong boot mode MMC2_2MMC2MMC1alloc space exhausted cyclic function %s took too long: %lldus vs %dus max ### ERROR ### Please RESET the board ### Error, wrong i2c adapter %d max %d possible Missing mvtwsi controller %d base twsi0MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d MMC Device %d not found mmcmmc %u error cannot set clock to %u SUNXI SD/MMCWrong mmc number %d Cannot find console #(-27q>5>)>!>>HH?5 5"!"[" "G"D aFFF'V|fAHJJj!U-Boot 2024.01+dfsg-5+b2 for sun`JJ JJJ@JJᆳ (OР iHMP  H4P  OР iHM  H4P q OР iHM! H4P c HOР iHMp! H4P U OР iHM! H4P G OР iHM0" H4P C hOР iHM" H4P !1)  Oo/Oo   P!:0@" Р|J~pGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDHJJJF !Fh a a8 DBpG;?JKFdKaKaxJJJJ-EF F*M+OB*K`E@06L \$KB43B"KB;B*y*KX hDCH 0!? ?#IHE5"SEr BR  NB~FIHEyJxzJHJJtJwJ J J7%F#h#`0FF9OBЄB  "F4{1HBHAG2*6$`B`A+)h D 2"`K`J I"K`JJ-E"MF+h iFFDB,3B#`##`%h F#FAFX$#hB$##`P(F-h5BO :FAF(FB( ,#`-,JJ-A FFFH)*h(Fd!FB)F8F++  F3K,0hZB2` (F"8F FHHFFaFFVF H(+"\ȱCh;`###hhB"`- 1K,(Fk FHH IM h.hB($3i( ` 1K,hD79D![R3a@-h F*i:haJJ-M`O1FhDc  Y D)D!D?1z`F "XF*F F ` V P2"D"R*a :{ha HJ K!hi ?60 ppGJHpGHpG&޾F B3 pG0j L;:۲T#0 ЋFL"WB{9D3 DI/B@ҲQ" B V[h@ŲT%P%T  ŲT%P%T  JCC%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHXJ$ xJDas U-BootpJpJRUNTSERVdPm~JY~JJJ~JJJ5JJJ~JJJUJJJ#??OopGpGpGpG@pG@#???OopG8F F10?"3@SB#@BؿO)F F8@>?DpGpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF w Gl//ПBM P-~xРEРELPРX T@G,,0 SLL @/H~xzJJEJ _/_ РP/@ /0Od@P TP  Q:< 80QR:/ggD# kl#iF#]pGs0F[k`H F*(H!D3("HDKIt,FHDO@CO`?0;  FGp0kJJJJJpGF H*03 F HCH F@JJ$JpFF(F0Fpo!F(F(FO6F`I9(^Hl@KJSJ0G%@$0C#&@CC'@CcLBLBHF )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHD (oboxuJJF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG-@:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk! H HL HP@ORHDJJJJJP L P :P pGOCiF< B56L0J3 `pG@JpG pGHChJ-AF"KI1kkIH%lD pF TkT kYAHDj"kak?HD#jbjj=HD#i+"!C@Q  Bȿ O NFF((izHh7)FyHCr*hxKBwHOpM0+nsHOk(FInH(F# kH(FOiHCFhHi)fHC<-Ы+ ++@0h0+ZK!(F?`@")FXFB#K\sdSHhd#)F0F (( d3e ped@F0((1AH000000 0@D000000++n0J! h(l0j+HXiml(HOiml$HFiml!H=imlH4liml(H%xzJ]JJdJ'V_ JJt JJ JJJ{J|zJJJ {JJ8JOJmJJJkl+hЫi00+ 0 D0|x՚J)D@Ւ0++ #RF (ǮvMo` 0 O0k1F0FZF@F| (3 @F  F&  2o@F+mCpJimlQ(nHnH} lHClHC-hHC?1&?!?0 V ѳEI BF BCcl+<Д"0+YH RF(NH)LH)"ԔFxoq  FAHCy@HRA0F0F|F(hx"9-4{<#FObQF?F ?M?KSF O8A#FRF@ GF(AFHC(4#FRF GF(#FRFOpGF(OLxzJ {JJ&JJJJzJJ1J>JIJJwJpGoFO,@58 AHC S A H HC#08 FJJJ-AFFF&B۽U FBg(hB6Do ZlB@H!FCG  'Jo FFF#[lH)P!C-F #:F)F@ H!FCfG H)F(0FB `JiJJ0oFZl 0 I(FC#h5pF\!kF"F, Jo-E FFFD[l "0+%O --&FW(B/0EED0F #:F)FFG@H!FB3FQFJGjF!PF+H)YK(FF JJJp FFF)0H) p1F(F0GJ-MFKHFF)*FhFO 0FABغ!AHB#FZF(FM>F=) Z,f*!@FC J GF1HB{ ocl+=0)8(F(F}FH)FJ83H)F`Ak#D+F0FJI(8*IFHB3 F  HB' F HcJJ J2J1JJ9JLJJpGpGFFFF+F1F:F FG0+дpO0 KS pGTJhx *pG3`hFBhHB׾J-AF xF/+ FF}{ñ#0(FAFAD*FHBo# }Or!iAv)FA} HBBF IBy+F FfhG( +h;`JJJsFF FF)ch!B( 3F)F FpooF@h7h4 i1`i.i+i( j%`j"j F@-E# FFhK`xF )F )#) F+R *#k`44` ) #*0,IF+"\ *ѧ(`X#E(h3#0#&(oJJJJJFIHJJF  "5I6HA&3I5HA" wF`}FF;F2F)F+HA &I*HAhB"i"I&HAbiI$HA*% FIFHA%B)F F*FIHA+% IHA5 +!ihH R@9@AJ-JCJTJcJtJJJJJJ8FF#h+O0`h()F@\ h8 4FIH&J JFIHݿ' JhJFIHӿ'JJFIHɿ!JJFIHpJJF2AK`  JH' @!AνO@5J8H' "!A88PD@< ,DBH<@' "!AF`?J5JH'@ӿ"!AJJB-AF FFFDDFE7F(GFB)F F:F@B<s N FFF1hX1h+F FF FAZFp J#iF3]KhB6@ @ 'Vl8 pG-EF#(vF;`3` MhE(FiI@#lcl+Д"0+!haHA! h%#l #m[LQF(F XQF(F +F(FA ($(o-:!(F@m(!0A BKlAI F V(Al j :HA5 9K*hB8Hqo[(F@3H(F\1H_(F/H/HV++ kE+Ѹѫ+@FcF%HA-@h*:`D3`x## F ( fe eHo hJJ JgJXJ'V_ Jt JJ JJJJ-EF%H FFF' @!A&F#3`;`"zFC,OR)FPF?T0`HO0Bc4`*F!FPF;`? ?M*:`1h HAn0hO3*F!FWHJJ7JJv-MlF l8F(W8FlOO CF8F(J6( ###9F(FHH(8F(F 38F8(N3 L^ETO ]F [O QF 4`BhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFi'pGpFKF*F!J@y k}? c'.1FF F(F6p#d#bo JjJ FlFB k(#bco-AFFF@F7FAF8F F'*hBAAF8F`"#1F F#'+`o  Caa 8Fh`h`iB 88`pFF H&#F3pXxKh@(F@t`0pp`hJKh(FJ7F F(` F07(`iB08-A0"M"L  1F /K\CBkh+ 7D5\JIH( "AFH? O3BF)F#L(bJbJxnJJJJ pGp FF"!#k#k J#Fop1F,(UJsF FF!"Fh@OB"`F*FpK` )J𵻰 F عci i#fiF0FFu/F:h1F F"KX`W?+;*F/Fo"O1 Ft("lk>"!l>v #")F>( I?tF+ H?(?Fd(o JJJFK-A FFF"!0F#<j1F J(Ft>F oAF(Fs(mWJsF FF!"Fh@OB"`F*FAp-E$FKFGF  BFIPF@L"!F(h XhF :hB;` oo2JJ(H F&(F"!@#F zF8+d/!?u`4"FbjUJjJ!+FJ@?(c o 0F7#b0F(9F2cO67JJJjJK` FJF F{0KFK` JF FM( F]H)F4KHS!p&)P;FOq0FJ@s H&FH&FH&KJ(F-F;FOq0FJ@Q L#FoJ~JkJJJqJhJJzJ-Miư F+b4I0F?#0F?50F?{p(U-I(F?(F,I?$`iF3F" FF(9#Fb#H&FFO 5p  AF0Fr;F2F!FF2xBmCeo0F?|d(o ge#e(FFooJJJJ!-ACKܰ"F   #$!;J?:H F !8H&&Fع6H&Cر!F@IF!3H "!0F OF@O1.H&X(o F\)Kh(d%H&(?+l(cF#H3F#I"H&(!F@IFF@F?j!F8F(8F>d"!F @!FH&ne(e#bmCeo 2JJJJ~JJJ JJJJJ8mFCie F(( F8@K!F(F8@˾-E?H F!&F i((bei(FF)F FY(O#l1F2"# k'(A ic@jF-;khi !%J?!k" >!/! >4#p@FXB($@FWk"k m3gmm[3F2!J ?! (o=l H! H&aF3F2!J ?~JJJJJJFFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-E F!FFF 5!F0F5)FSF:F%FEE(x,h?`h?AQpD532-M$ FFFCFF&F;O ZF!(FLF ]Dȿ6$ȿElEL &FRK$FFFF5 (`L#9F0FJ4h#`#6J-MFFF5 !F(F S+ +"9F(F4SDIFDH?O0F1F?!F(F4 F ;FR (F {+ +"!F !F(F $4PF ,#F#FRK$!"FG F DO4O E4BF1F??F DJBJ-MFFF4ۺ ;F2F!F(F M5SF2F!F(F4(F FFFF4CF*F9F0F5gF, F5*FFIH? FJ]J7F4T5FH?H%fF$ F0> 0#F!(FJ55FHiJGJwJJ-MBFFF$ F!=J(F4*OFFEAF(F4#[EBAF(F5O8:FCF(F5 5F'H?TFAF(F5(?O !F(FJ5U8F5bFH?l;03F!F(FJ5 4FH?4F Fp H>$0!F K(F J54FH$?J2JJOJtJJJs FFP4*FF!FHp@?˻pJ-E+FFFF #2F.I.H?O4 F4 4&IF'H?!(F%J#!F(F K!J5v &CF  B \ C# CCF:F(F !FJ(F5T4b IF H4\ IF H?eTF03$JJaJuJ?JjJKJ#iF#]-A5IF4(a%1I F4F F40&FB7)R# F4"F(I>)8%I>P$I>%б X0p6FE#&9F FJ!#9F FJ5 F46F?XCF( I??d0px+0 nJwJ5JJJ=J FFX47&FB 1F F4 #+B1F F5  hQ#j1 DDo +c` (F6#"F FS4(KJ-MFkFF F4F Fn+ ""@0S)!C03A0, F)F+J5&(N !)J ? )F F 4(@O)F F J5 (1)F FJ?4(%)F FJ64(XF>10[F)F FJ4( H>$0)F F K J4pjJJJJJJJgHJpF IF4L1FF F5 4FH?-H?H? FpJJJFJphF$H? p F3 4FH? 6ai )" H?i+ai"H ?H?#+` iJJJJ}JFH F@HJJ-MF F3F F4B! F8J4I F3F ( -# )F F4FzFBF9F=y( 'Hz:FSF$H?.5#)F F!J<Fp)F F;H)FJ F;O (7 OCF:FYFv=?( H@ZF3FvH?)F F3tFZJJ:JjJjJ-MhFFF+{h0F320>HP ;HP%B@WF?EBF :F1FXF=.E1HOR9FXF+=tF0+H=~F(?R?2!F"D&H?:F!F0F4(7"Hp9 k l dAEtXFB( F9FDOR==(F?R;?21FHs`2D?g4F@p HqJJJJJ0JJJ-EF!FF1`F)`% F(Rcl+|Д"0+x!hpH?) ! hB +kkH!F? F3t(ÀgHh?ݿh/Уl#wmXQF8FXQF8FF8F?s8F((!(rPH' '#mLKKl FII(A0 CH> F@H F >H2 F:H:H+8H 7H@@F34H,'i?BGE /H!F>4`ch+`hBB'HAF8F>O18F  F({fcffH>Sch BH~JJqJ J JJ@JJuJJJJJJUJJJJ pGFF FF ( CH>O5BH>(F F(=H F7(;Hle(F=!#D+F F5J6I F4H%f "!>(0H>p0B#6ӱ" xFF'H> Ff(4F!H>/bh!F8F=! F0˱0c`!F8F= F  Fs(%*FJJJ7J^J1JnJJJJFF38p$%F"DB * e9FH>hO0%FPK$ 4` J-AO`#!FFF=eFPCEAF8F>0` 4,`-AO`:!FFF=IFPCEAF8F>0` 4,`FJ3 `@ @B'J8 FIF3|*F F8@38JFJ30cò #p#O0{JFJ30Yò #p#O0JFJ30Oò #p#O0-JFJ3~(E p O0 JFJ3l `o8( ` fJFJ|!JFJsJ7FFJ3I(` "`0FO03J#FJ36 h #`o8J#FJ3$ h #`oDJ#FJ3 h #`oRJFjFFFFhjF9F F`h0 D9F FxD4`+`+F2F9F F@oFJ3 `@ @B\J7FFJ3(` "`0FO0-FJ-EFF FF1F,HF>)F FF((HE>ټ%H>CF)F$J F3CFF)F F!J3FQFH>H>H>#)F FJ3qF :F1FH>)F FF:F1FH><HH]>4BHaJrJ 6JJz JAJJ}JJJJJc6J-AF" FF3FH= IF8F=m8 K2F)F FAjH=~IF8F=\KJJJJ#-AFFF0F)FmH>5.kH>/9F FR`0F)FFeH> 9F  FV)FF^H>9F FF)FZH>bTH>)FVH>]OH>.\Os@"9F  FG)FFIH>+.x9F  F))FF@H>?K@G9F F'F)F;H>50H>>.9F FF)F2H>.7'H>.H>p-H>.#9F F3(F+H>.9F F()FH>rH>m+*F1F F1F K@ՔJJJJ3JFJYJoJ. JJJJJ-A!FFIH>3H>/I F33FIHA>H>& F3O(F+! FxI3zvJ#)F F3FkIsH>&9F F30(F++")F F3k2FF]IeH>w)F FYJ>F)F+s")F F3T2FFQI[H>)F FwFLIVH>.^KH>)F# FRJ3rFDIPH>.SCH>MJ#)F F3bF;IJH>IJ#)F F3VF5IFH>O#)F FCFBJ3XFF@J)F F3>F)I=H>xO#)F FCF9J3@FH)F F3(F+->F)FcH>X1FH>SI (H>K1FH>G$H I "H>;1F H>7H+1F FJ1FJJJJJJJJ%JJEJJJ_JgJrJ5JJJsJJcJJJJChDpGF FFF( 2F Fh)FhG Zh`O0-EFFF3@(F o9N"!F(F3DF6H=4IF0F=!F(F/N!F"(F3."F9F(F3("FF1F)H> ' %HQF>!F(F#J3Lx+ hSH>H!F(F3!F(Fo W&?RF3F@F.vNBN0F=( N N JJdJJ 6JJJJ'JBJUJ J0F F"3)F F`")F F3 IF H>" 0p )F F@JJsIF3{ 3IFH> p&)FH>!F(F2/(F+ +"!F(F3k1FF H>!F(F6(H>JJJ6J}JF 0XBXA F 0XBXA F 0XBXA 8F F2عclh(F$!F3FFF J(F3Cx(F I3(o F8ooo)'JJ FIF3 ]9F0FJ3F8F#!(F=iFpD`F)F"%FT9F*F0F3*F F o JJ0F3F0 F -MFFFF#M3O \Eo[FRFAF0FFF0FI(B  F,F F8 FlFF{ #*F F(o8o-MtFF| _ h h k+JR#H:FYF=O18FF`FYFH= F kF8F#F,.YFH=8F #ڣHo!F8F2FH={-!FdZF#8FQ"FF8F2ZFH=b0!F8FJ  H!F8F(Ho H!F8FVL0_BF!F8F0}(b"!F8Fv(["!F8FoF(S-@8"!F8FdF"!F8FN(@#"!F8FF(@"!F8F>(@"!F8F6(@ "!F8F.(@"!F8F&-#!F8FL<FpAF@FG!FF*FPH=o(-&-(!F8F}YFFH*h-!F8FH$YF>H=o+Qzh-:D ГBҹBYF2H=o2FYF/H=#8F!F ??0(dѝ?0 +_Ы+\-#BDF FF 2F+F9F xYFH=ToJVJ^JJJJJJJ0JJJQJdJJJJJFVF-0F2{H_B1FBF8F>F-ѝ?0HN `! ` +?S +F `H.&B-WJJl FF I:FF(####9FF F \J-MF# F *rhr@,r F<(#!<F(^F"+FFB#Z##)F Ҁ(FjJF (F2( ,€@E4kh+DE/aH=f'o`  ``08F0FO2TFO' CE(CFDJ (F"F(F2##Z##)F =(#5H= ,#! F<F#;#!F(F'JF (F2u#DF FZh ro F i F (H=o sFF3SH = FfYFDXF3CH 9FXF( XF30'JFHo `JrJJJJJF#h h"hH<( F JFF #hKh"hH< F  JHpG-Mh F "l+pB (omm-II`h(F?(F FNjFF0F!F2(9I@FF(>JJ-AF+ FFO0" Iph(ChbB-hKB)FF3A`G `!JJ0F#*3 OCH<0 M`h)h()h`hF(`h#F(VFdI FqF>F`H<|-H!F^HJPJYJaJJJJ=JJ5J2J7WJJjJpJJJJJJJ*-AFFW I"Xh@hCF:F1F(FFA`GO0|!J*8F"XhF<"FFh<FF(F*F!FHJJcJJKh`Kh `pG|J|J-EF 0F*BFFJhDB"!F(F-i8O1(FFFpKP`BF9F0F+ K`<*F F+I F.K`N|J|J|J|J-EF}Or!:IN  3lE% ql"DH)D;F(rl*DQ||C#||CCSc ;H"`:H"@9H9 IDF(4OUoBOH HV:IFXF:"IH".\#F;q FV(FV,yhRVFM%JJJ %F" F!F*FH;Y(FFб#FH"F#h*F)F0F2-(FJKBF FLJ|J "@!KkJ" !K@kCJCh)j3BC`pGi;BC`pGi23abpGj:;abpG0F F 8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF  8(7iroF(@Fs< F"S'/Fp@Fd_F-kiB6(FX/W#h+' h hGF'-@ Oa F(?VQF0(F0;JCF@T(7G(OS  CF$! F(-Caa'"##"## hh G'}Of'ZFCiGF'n/73H(F OXF KB?/? JNJJ"JJJeJJJDJJ{J!vF(`OD'?"# PFG'$ B'"AF0FpK8O E@/?(F`(9iKjJjK(FhiKiIF-hKEOc' ZFPF0GF&/+ ! %F PO1F1 ع8F LRO&hG&(FA.R0F </Z#}+?'SO2 P1H0O2?I P1H8F   3 vO1 Pr\#T#;q<``F(pV*0(F-Jh$F(  cV# 3Bѧ OO1hD@B(FFBhhh#p#h`chS`#S``U (F 5F6h O/F%JJ"JJJJ JJ*b-8 A0H: .M+x+3-L-I h'F('"h)I'('I h'F($N1F"h'(0hAjhIhGJ;+`H#+p&#(N!H@F(KIK2hKbF F<KB O0J|JJ J|JJ|J|JJ"JxJJJJJ#-M$!F F F(ڀF)F F,hph.F(̀)JF/9F F)F8F)>  D F,O1k1FO1k1A DFHkO1(F)FF1!"%sk 80 ,F(PF"EI-VF R F Ok Lpk Ih F0j C ,l ,i8F,f@F,c(F2F F2IF(a F/IF(W F*Kk*IK(L*F F'K(IA(B*F F$K%I7(8"K#J#K Fh"KF+ KB?ODF M F)FN'FI:bD=H F (;I:XD:H F0F(940F9(F9(F)F8"@F(F9(F8!@FBFAF)H:Q8F:8F:F9F$H:E h G!H I H:8zI: FI:H o JFJtJ}J2JJJJJJJJ-JJJJ#JJJJ JJ`JJJJJ:J* "!Xh:B 0 $!$!$!$!$!$!$!$!p*FH: "p#h`h Fh#8+F2FahH: $U"J"J$!$!$!%0D<F MB  4B xH+\0F BbJ-AF8H F !:F!F0FF1H x%BܽA-H pO7-*H h0F e0F9C5D0F9>0D&ѧB"F1FAH: %H:,4lgBHA:V%JHBBF :5BH: OBH KbB;Fq]F H:5'J'J'J'J'JJ|7JJ'J'JfJ'JFFH:K!F`H@ 'JJ'J-M*FFO4K"IXh9F(~ѧ FF%x-+!: F/9б-?0F>c+ q+'?+  8%-p0#$ Kh(EIH:T F)F~H }IF.(5uK1FwH` p !:JhB/FmHFF//(/FhH:"fIhh9F(;/kFh:`@FG(!Fh:/FChF1F/r/FPH9!F(i:jFFBhBJH9u0F$>N3hEH i"DIhh8ȹ/"h0hh/0/F)ЧBHrQ4X$PJJJ'J'(J'J(J6(Jd(JJ(J(J#)J&)JL)JJ|J)Jj)J)J"(F9*x?* 2`23Q))FH+F)x2 )Ъ[+*0MJx])F )14X$0BS\Dx])?Z9pJ3 CF{M8(F8S4BDBED7hhxg+@#/!/њ0s+)i0h /#0n+s+H/F!F0h/!FF0h.0Fn+/!hi9FO5{BݓB 5n* ]E !F"0h.F@FG!F0h.ښ0s+@FiO;>H9b!FZF0h.F(b)`ۚ0v+Q 4I/ "!i9F-)F F-"h*I9O6. F8P7D F8K0>DBܻ!F'.۵T& - YGI97B1FHa+F@FQ s+RF/FH)J|JJ)JJ)J!<J*J*Jp+#l+@O//hQF0h.: ,D)F"F0h.F`"FQFH9O l$-(!FH9(FXH9")F0h.EF pxK)FIH 94,݋H!JHZh,F93h;Hh 93h9Hh 93h7Hi 9!F5H93h4Hi 9,3h1Hi 9 3h.Hj 9,3h+HYj 90h. F'H9&I"8F(H/㫨h93haJ"Jk*J}J%(J"J8*J@*J(J\*Jb*Ji*Jf*Jq*J~*J aJ*J*JJ*J*J*J+J+J1+J?+JV+Jm+J+J+J+J"{Ihh8CFȹ/"Fh9"FFh!F9BF;F0ht˻"kIhh8"F(]ѫhxp+'0h.FeH9 dH9 E/AF0h.U.F]HܻAFZH29a+"Fh9"F F(iAF9:F#F0h/ (.FIHd+'Fh9JF0h/ (.F@H̻"?Ihh8h0hL(?ԫ.F8H"7Ihh8Fع//Fh9!FFh9<0h["F9F0hF'I"hh8Fȹ/ժ3h+?h9(?0h(?I"hh8dF(/Шh9F0hv./F9JeJ+JzJ+J+J ,J(,JF,JJ,JZ8JnJ87J$ $ $ $ $  -AFF")FFFh*#h)ЙՆZ #h##`1F H9#h##`)FP#jF8FkF0iFH9HC3JJJ-M*FFF@*^h4"0FI8(Ih8FO 4%h"0FI8F(p+x+%2 ;O FAF8FM O 4O UFO TAh"FnH9tF1F,CF+(8F=1F(F8px!9#F1F>\CC"F1F,4B=3xs+c+i+O4t+&"(FFtF)F>H9!F8F F F&&&6IF02H9瞹FfF)F,H9_!F)H9$..FQ_Fذd !F$$H9:_FH97$B H-?{(FX7.$7gHJM3JP3Jo3J3J3J3J3J;+J3J 4JKh+H o` J4J7F F@+F"!F0@o0* >$ F"!Xh9F0#F( F H I9C eFH ~ 4J4J5J*-AFFW I"Xh @hCF:F1F(FFA`GO0"JFFF. 8FFH9  Fhh9|FFH9!F8FF(FH *5J@5J\5JR0ZH9 ]}5JshFFF>FH.$F"hh9hFH %.ۮB ")FP )F H945- @ pO6 5J5J* 0lH9$O1Xh!9FF H9z!F6 F@FH9o  K`5J5J5JJFBhlH9WclաlH9PH9M FOhChhRhH9:F6J6J}J6J*6 \h,<,3B  Fj!Xh9FF6 NF(!FH9 D6J*sFF(!Xh9wzF0FIH8$. Fh9eFFH FH8 FpO44J4JJ*sFF,!Xh9?iFBF0FIH8$ .Fh9-FF( FpF(H8O44J4JJ#\.*D@x08pG3+O0pG-M*FFO4 FDKBKhAKhAKhF8s$1FZF:I;H8L$!Fxh8!Fh8Fh(Fܸ!Fh8FF_F/(')F;FFFF)F$H8GEO!H Y=DGE 5 K`K`K`KH8 ^*H . H8$JJJJ4J4J\6JJb6J|JbJ-AF+FO5(F!ph8?!Fh8:Fh*(F(F5F@{9FF!h8!!0i8!Fc+ #NdF0B 71FFIH8{% h6J4J-MFS+FFM G!ph8!Fh8!Fh8Fh(F@F!0i8F8FF8k)FEPF:F I!H86'8FFF!FD E ЫhC`#LF(B 7e!F Ipi7(ѫhRF#`!FCFF(оh6J4JJ*-AFO0Xh!8h!Fh8cFhS(F!h8X!F i8SF@FTHk;F"F1F,(FIH8 )F(4J4J*-EFO5(FXh!8!!Fh8Fh (F(FFs1FFع!h8&bFD!FH8wFF'D;+ܺ 2FIH8iFIH8c%#!F F  @F" 4FAFH8Ip6J4J4JJ-E*FFO60F@K@Kh@Kh@FF@{Y9F%F(R8I_h! |!Fph8!Fh8Fh~(F,+Hٲ8*H 6%DD K K` K`, !H"H !H8b,F'KB#F)FF(Ѻ%D)FH8#F)F(F(FIH8&{,JJJh6J6J6J6JJJ6J4J4J S P-A*FFGXh!8 !Fh8Fh(F7@FF8k )FuF8IH8g !h8(( .F i!8F+F9FFIH8H F7OztO0h6J4J4Jx F**O 08,,xh8,O3$@ x*+!08$+Cx{+0FF;}+# p{+FpG pG-MFFFF7F4Lh BF(F!h7(T h7 EOeh>PFF8FF F7-G @ 8 (Կ  (̿  C1FPF|1FF8Fw-! #XBXA  B  BBB  4\E)FH8 0J6J*FFh (F(3 H (hahho#O06J"K`KhK`pG<J,J4JKhK`KhK`KhK`pG(J$J<J8J4J0JKhK`KhK`KhK`pG$J(J8J<J0J4J @ O0MFA`)F FF(`*FOa /hϱx I (F (h FH8O6$DDaJ3FFH I8F (F z?0F!?[!F"F H8!FH0F MeJ7JJ7J7JJKh#JhY`ppG<J4J#I/*D?pGDHJ8 K Mh,L (8(x < dJaJHJ-M'mp F6>FO44@#F;x ) _PF { kgܺxкu QhIF B8F ?(B@l'''''' ' ' ' '#3p##'spY#pp7qK 0x0qsqqB!Kh!Khd'  Ozp7_?&"KH`1F F2F1FH71FHLc!FH7K`$ JHJhJdJaJ#J`JJ(J@J$J4J,J J:J7JJ8J*-MFF:|pKhKh!F :@;F)F"F(F5b K5D`Kp`!h 1F7 KhD1F7 FO0 $J|JxJlJ*L!Xh7 `!hH7k lJ;J* 3: FF!H ]O06JF+F;!h7!Fhh7/F!h7H74H7#F&%DB$B1FH7" PF7h@F7D #F7`U4O0;Jᆳ;J*pFC!h b@!ph7x!Fh7s( -#h-#h-##x-#FF*S:-#FF*S:- D#FB+#FF*3:O0p FF-Kh-Kh!F-H7-!!h+H7*H (C((O!;x-+.kBD!h 0`h9F7 KhD-!hH-!H!xH"H7OB K` K`- `.,D-- p .+FtJpJ6J <J6JJlJ&<J,<Jb6J*F O0pG*F {O0pG-AF+F-!8h *!xh7K"h!Dh7F !h7#F8  -`+D-- pO0 lJ*-EFF&h O!`h7eM!Fh7]!Fh-h7W( H   xG O0lJ2<J-M*FFZh X۫+,JO`hR#7&(O!;hh7;h! h74FF'E$-#hhBЦVD8+F"FAFH7v$BF9FH7p F--##xb\绲,D 7O4$TJC<JlJH<Jz<J8 FBFB H7@cAh)@8@H76H73?J?J?J-M*FFkݧKx[x4 50KxKKKKh60KBhhx406'(!FkhYx.53Шh7yòx-+;0!7n_. h7f_x-++0!7[_. !(i7S.6!hi7K"|I 6hzH7O4 FFB40r+i+m++"mI 6F(@ԁ ػ @ȁfH7$w+$.&$VF_OB$\ 3!F 2](*!F20 30}!FFOK!F(;F LJLI ,(F!F GH7D4Os2F60)F 6(02F)F=H7/$6^ESEE8H7"5UE*#K4 p5 Zp!K` K6 KKK`K`KSEE2F)F$H76#H7FF$2F)F(2F)FH7$6^E605UEFF瘁JJJJJJJJ?J)AJ,AJ5J?J?J?J(@Jo@J}J@J@J@J#2F80)FAwH7)FvH71FuH7$6^E5UE?oFF80#6  @C2F)F80+(eH$3F 8*F_H7g#$ 65ZE kZH7Z3۲SE?4EFTO;;xCE[EC3\h*FLH7:# ;BEH71GK7B # ~hDHfs@7r*Q@)@08J9N_2F! "5H7-H7 32J*))F0Fs.IE-KF,H7籈E @)т)F0F + #I$J+F))F0FI# l"I 6(.{8h4@JAJ@JAJo@J}JJuAJdJAJ?J?JAJJ?J?JAJ?J?J?JJsFFF"7+FB0`x-) PRxB"!7 ` p #`O0-M*FFF@G[hxKh Kh KhKhKhKhKHKFphHx6`(1sh[xx+-Ѱhkh 3ChCj w-[j+hr-яH c #7w->/V'!7GF#r-7/ V'.!@F6 K I HF6 ,`(F$O4%J2LJ!LJJLLJ'}F FO`F"IF5(9 ?&?1F(F00 C 5D  SC SC"h"b`"FU?ihS [ CSaha`2B }h)ch[c`9F0F6/``hJ  -EFh}hH6WH6cham+O! H6mHӲ#TC6viH6rFH6jjHjHaoH6^MahH#5!(FBH)F6O!yH6JH6GK!iJH)FF6=H ~&}J4K IH*F Fi6)~H jsJH 4bhyKDyJB򘀔fPwH .Fg` O LdJH 4nH B(eKlJ(?.F4h0@fH /~eH +6TJ4bH #8PJ4_H *^KKN -F2F4sZH ,2F4k&6-\Дgp7A2C1FPH6?KFJ/F4Qh03ACAH .  FAFFP!F@H6+0+0ЋDB]  RF (D,="Or!0F%|:F)F s2xI+F*YF FI50F45-1F F  H5O0 }ODF  XJJJXJXJ-EF!} FF!Or +CjF }( !} "AFh5 xFBFù!F D(//0JOq 5-. h& h 0#FJH5IO0JXJJ-A*FFO4MIXh4-Fȹ3+hh x(v.(i F"@H5?Ihh4 8"A:Ihh4F8"A]4Ihh4"1Ihh4"/Ihh4F-H-K.J%FO +OB(H(H- :!,!X$H55#Ihh4F(.ݮhh0F9F-i (:F1FH5$(F F۲r#)FH5 |`JJarJJJGJ]JXJoJXoJoJXJ}JXJJXJ YJ-AFFT I"Xh XChBhCF"F9F0FFA`GO0&J$KK!F"FKH5GZ "iF[hhhChH51]J]JJ]J-EFF&FEih$H54F F #9F(FF(FjhH5  Z#RF9F(FFFkhH5@F4(7Bۺ o$Z# !H5O O WF]J^J6^Ja^J*7F Kh H5 ! 0IXh4FlhZ 73,!FH5< H5 HYh5!Fo ('缁Jm^JM3J^JJH3J** \hZ !F J(!F H5n Kh+H5fO0YhH5_缁J^J^J^J0FK~F2" IkF! hP(F +hca0"o2J_J*-AFFW I"Xh @hCF:F1F(FFA`GO0p&J0*FHF0$ F 0*/\h! F5(!FH5Hl#J)FFH5F,Ob I H7O47J_JJJJJJ-EF1HFFF0#.J CF(N*HF!1((&K&Ih5x&O *F (( >N*F (H8`0 I*F (*F (V) 3o Fo JJ`JJ)J&J*"H,б!5(#y FX H50 FH5*$HO47J `JJ!`J-AFx F**0!054F,& %%%%x0` O14OF@F}F0 H5o BF)Fj# FUh4!5aoJ-M FFFF % UE O PF*F0F4k :(.;h#D[H5FB ХBr2PFq45"F0F ;hd#D;` aJ-M};b<x2xb` FpF`40LUH5q xj4#}jxcbkFD"(2F! F{jzkai<R#F)F0F4(j+w(t2+#htach{a4^;jBBcF6H50XFt4O0C\;ch^F18  !_:ѻk{i(FihiR4'F(лh;j(3"0{`4 :{h(:iBch #h0F#9j08F(ч (wF4aJOaJMFFFF84@H5 M <(F$F)FH F4OBOAH5 P!F04X C@3h POAOSg0( Q(F1C4aJaJaJ*-AFFO60F!h #FFh>(GYIh4N,,,9FhhF8FALIh43H# hhiFFIh4$,h4D(#AF(iF88F&hx-++)8F4&F F4"0D0F -H5&9F4!F@F4AFhhF%H5@F8F F H/+ $+,%; +)#(((((^+ |+GhhV99!F8F7F!F8F8H5aJaJaJJaJaJ-E*FFFPFE j:IXh4QF&=4--5H^F8 -/HF.Ih43-Ih4.F+Ih4(Xh)H5Vgi"H9F%ch!h@F5(AFH%##QFJ H5.9F (H5# 2F F  eJ7JJeJ#eJTJ'eJ_J JJ?eJFF F"!hF5I:hFhxh`"#1F(F##` pG pG*-M@O O7FTFV#Ա3+  BU 3kJ( hE$@  *%*/5>M\l|hh3d d @gJGgJVgJegJbgJgJjgJ|gJgJgJgJgJgJ 6J-A1F+OhQ!<1F +H4 8F3,H((63FBF9F$H41+7"H4!LH41)F@(#!(H4 ! 1 !H 4@F3(0F3(!FH4gJgJgJ}J!hJHhJhJ-EFF F3)FFSH4, F, B(,  (W,9i }([, FCH4y ",!h>H4m "/U|"sT#6U!chF;+4J5JR# 13H[4N@F3p( HSFBF)F+H4>)F*H4:,  ; ( ' 5H4"PF3C(0F3>(Cl F z( u(  p()F FT#;p ?JhJhJ@JyhJhJhJJJF "!hFiF F0FiF} ClhF  (Cl Gаq ?$?Os"F(!FH4PhJ-MFSH41QI@QJ F 1NIOCMHNK F41SJH4| FGH4t%FOEO1CEAHM4f?H4a !=H4Z.FO %1SE5**KF:F(H4&+1{+"+"+ H!H40HC!4 +1+і.H4 H4  6HHhJhJhJJhJhJjiJ}JhJiJ.iJZiJhiJhJpiJ'JiJiJiJgJiJF F#,  Cl %( (  (  7EiF  0h,<,3Bclj F _hB F (cl LhBIkJ( K`&JHJp*FFO0p"IXh3MHKx#H4> "I`h3=(H41"}I`h31P-zIszH4  qKxvH4F"uI`h3(sHQqI"`h3 F-nH(h4FFjH4 FQFgH4 FEcI"`h3F(@-ݠh4_F4F()FZH4 !h4P 9FBFTH!i xS+&E+QHF; +R#J'J'J'J{JJ'J'J'J'JJ'J'JJf;ڲ *=H4$)F;H43hnA!AA]##"d  E%%"0F?0.HS.H4j$,H4e$+H4`$)H4[$(H4V+F"%H`"%I`h3S p@}"!F(FKp@JJiJNJiJiJNJiJiJJ#jJJJ5jJKjJ7JhjJjJ*kJjJkJkJjJjJjJ kJkJkJ'lJ&J-M*FFFF*.!Xh4u-F)ѹh%XF :YF RF3H3F4#F*F B 2FQF-H4 $OD! F((0%H F#HO F|h-@5H(D7B F1 ]B F(O1XF@HHehF- FiC K@F`9hO0ooJoJoJoJpJoJ J*sFу  FFhh4!FFh41FF< Fp$O4*Fу  pah Fi8  O0-MFKFFHh/!ph4/F!h4/Fh!4F F@((VoHXO ]F&"F)FlH4"hkKBjH4  FfH+bH40+/]H[\H4 FZHZH4 FBWH)F F/[ݝ)K)wPHNHYF"FLH4O1 FIHYF F|YFDHAF F/3AF F@=HAF F+F9HAF F )F1H7F4W$H0F?1!?)H(H W?%F(O5AF8F*F3/DDd)FH4-O0F0(H~ J]JeqJpJ'V_ Jt JJpJJ JJqJJ:J/qJpJUJJJqJqJJqJqJ7 F3[Fh+I3t8% F,F F0hFI3f()F2(3:FrJy7JpFF O4 F p2("(FI2F((F2(D<}+(F3F(28"!F(D(F2B(F3/(Fp!hF3iF(FP(Fd dB0`(FMrJ#-Mx )Jx0(KBF&H3do x "LDDE28FciGF4jFAF8FhG2o D5oFH3?o XF2 # 0hCE3x30F2P#0D<1FHOXoJoJrJoJ8rJSrJ-MHF2-FH2)FH2%FH2!FH2EDT5=DD%4.W0F2ZF o IF% b`()F3K蹐H3oI2X2,`I2E!F2(!F28\O ;*"TkιYFx 1F(PqI2FPFW ,;*  fIF(@(F38FaIz(!F2("FD2"%8FSI](oNI2=x"3J Fi+n6rEL 8FBI6б]"3) Fi+Q6PEP<8F2uF+/I2(\#8F#E<6ExY]#!F24$(1FH3PFh@Fo"F(F2U11frJrrJyrJrJrJrJrJprJ`JJJhJJrJrJI2(#O0oXJ-MF+F h 3hF xKhH3wO07FFhF83FhIH3e I`h2\8H3[(F F8I`h2OF(5Ѹ2ьH3I!i>ta(F*hBфH36H330(؁HiAF2F;|(F F@F0F,wI`h2F(Si[ !F6LD?4$?@4 nF G AF(F$?C aH3!F(F Fxi0(WH3O4WHF3zAF(F#F jFi@FLI`h2(U#iJJ{`JKB HHu O4^F BO:AF(FhGFxh$2Pi. (Ff+O?+#F9:FIT0(EO5'J FJ8 *-AFFW I "XhZ@hCF:F1F(FFA`GO0&J#0 FFJ 0h,H3F F 0 ! H0SH3{,F FJwJwJ*FF[hx-*[xa+!<5,'&BK>HhOd)!b)c)O0%r)t)*^"O *X"O )&F*M"F!'(H   RE[xC  YFH3 "F!FH3(FH3"AF F"F  B?zH0 C0h H&xJhJ FJ JxJMxJHyJxJxJxJyJp!F"<,S_.x-.iF F!o.a.f.нp@%"),FHk p}yJ*[h J# 0@ ]O0 FJ-EFF.FQ_+x-+ =!(F2Fx)F7H3 >?+f+_H1J.h`0kBF(F,I0 0 'Z'270BD FTF!FH ;F &P+:F)PE&pџBKW# 0o8Fr+ K)FhH3O0yJ'J FJyJ JyJ0*FM/0 M0hhFȱOa FJ37"!FHU(kh x JiF#8" C p#" O0 6JzJsJ*FF")O0pGKhpG'J K0#0Or x3iF ]iF  sJ-MFh#FFF 'F^F ;-`h x-)4!3*F!'>4/OP" !V:H06:7K8Hh3 s)b) c)O0t)+S '+OF#)dF+EO PFM!334FI3Ho ;OtP"!H0۸9]* 8`1 H;F"FH FJ J%zJVzJJZzJP8 pGOrF!t@ H "O1apH2+}J3}JpG pGOzsXC2 LF0>J>I` =HQ` J1ePIZ1t)F Z1}Z0 D  DOZp(F1+FRSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F1=!F1QOp0F0!XY\F!0[YB0F50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%JJy7JJF!&F!0S'0B00F;07 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F1 #+T(DBp!(F(F{7Kh{o4J`FEF 1;h C (FDNF(I1_;h(F&I1Y(F 1U 7h(F I1M(F1 0BF:6pF;!1v0( HX2TK8 ;F43+6}JJJJ}JJ-MFF"!VO8O %'  HKpBFF9F HOr-"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH1=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhG}J}JJJ}J~J~JM1J ~J+JJ! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H1#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?oj"K`#|/?K E?'?Ϯ!?~EѪJ5~J K! K##Kh]M1JI-JJ8M,h\ uK(``KaC`#`` 8JB~JO~J8HR ! "1~FH gFHE!FH ^ A H! H T A HK F`8!J JJ'J0J@JJ-AF "Kh8FA"O1k-)FH12F(RH$4 ,н FFFH;&!F H%F1g4FBp0@FzlJIJlJrJ pG pGIK [H0pGJJ@0 o @0pG KF H@ R@ @ o @ l epGP0 {C~#P0pG pG  8c@ d 0IFX@0Or\6CT0XqKF [ht jtpp0Zh_t p @0 @ ]H zJp°)Fw `$FN(h0H1 BpsOr @I H,1F1$(F [FJ}JJjJO2 !HLF|` J o pG pG pG pG pG pG pG pG pG pG pG pG pG yP D:"P P D"~ p p Rh2"x xP R"P P xt pGP0 s#P0P0X0pGpGpGpG !lD@J/D0%FF ;J;` [   >C '@@@pv @ @ &C _8F <!!R  !4C &@IAqd @ A $9C _1FBшB H1(F!J/E }  JgfffJJ< O,< pG pGOB88 8P.D ){H0A8BxH}0x[E2ДQ-tHr0F%Oz1By&ok1# p F D9F" %!"&!;xDj#C&!2&!) )VHADBTHkSH hC#%ݓNHn %!"p D9F DP)FHBDHhк?AH hC Fp2F)F FI60B5#hn FA!d##!AA "cFH)+H0o f gBp/( ")F@FH ")F8F)F "0F! #BF Fj! #:F Fb)?ۮ #2F FXJ߂JJ#JFJlJJJσJJJ<JcJJ#-Ah`FFFF0 H0& F1F(FnF(Ѹ(Fd#ih/`#"(FAA H0Bp/N.(FAC!(F=F(JJ pGFFF,Y(FCh+h;p$9 i<(H0#;p3p(FiF!Jd#0hn#D$##"DAu0d#pA, *%)%hn#D$-DA"#AVpd#0hn#D$##"DA?0pGi8 pFnhC&d#"#FA#AF, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>1 /JBF1F(F(۸@+7/O O4oг $$Bp/+"F1F, "1F(FA1F H0$"1F(F2co$WJ-MF:}, { F&?(`"1F(F(7x1F / '(F:F(׀:F1F 3yx!#rq ""! yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/q/kѕ1+@##d`/h+hn"A!d##AA(F#A(y(F(&q, F(FO3c&gz 9Be۔H0"F0B8F 5d/d0&`azp a 9BQ&O 9BQ0K#0KhB\#0 ,@4S@s@h#,9i8Fac1+.݀+hnA!d## "(F #AA( :}i66"1F@F61F F/! 3([H0o `D`{h `z``a6`T 9 ; g#? LJ BД {iB11F(F ( ;iB"#ihS``#  C F~:iB"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F+AF(F+AF(F["1F(F|"1F(Ft"1F(F7i2*a1FH0o4oJ)JJJJ@'9i "a pGFhhnA!Os#"zAA"!#(#h9%H/ hazhA!nCA@AA H/ hzhA!nCA@AH/ O0IpF "!(F@C h0hn&A!Os ##z2FAA!#,H/ hazhA!n MC)C hzhA!nC)Cw0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA.+hI0F zD4 CD@D0+ !F(hF O CECFFOs !FSF(h F(h 9!F*h9 E&(h9;Ѵ E 3ЛF  D+J#sa# F%0$0F j hKOzuisBp/=ѣi3H/uao #{+ 3x++ 8 @Bp#++O0 ޅJ-EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0FJ#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x/O0H/F:FFi(ۓ:JJpLF "! F`##p0)F[cp#0#q@060 F+ # #0+kG`p@J-MFFFF*cF FIF !-Lz0#`4P]E(!i%HjC "`|*""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ !3 :8F  DD@J-MFFFF*c F^F !-Lz0#`4P]E(!i%HjC "`(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ ! 8F  DD@JOshn#D$"#DAF-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)FsssOs2F# h-( FZO0FchA0.n hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz+J JUSBCUSBS7} %0 H/ 0]FAhH/ F5syJkJ"K`pGJ(H/pLH!h/k h(̿  @BJJ׆J-AFFFL&!1+Eі"1;+@8"AF Fu'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fczzc{ z{!{)0K+02H/1J1K1H/ +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!bK$9(F( ?O# I#_J YJ(J[JYJJXJ-MFF'L (?hSrz0 "! F##p01F[cp$#0#q60 F+ # #03kGFP?oH/nO:0FB0+єL0:+єM0L BdH/Wk{+/sPF@`H. .p\K@Ԙ0"+#ks "I OO "^(Yb "!AHG0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO ! "+H%##p01F[cp#060$H+ # #03kGx "H/shO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@@JJOJ J-E\F , E!FF(F8$  F)0h'hn _A!Os#$?3zAA#"ABؿFOȿ;F !$J/#Os0I, }#F(#FCrr1F(FF+030F( ItFX(FF(7EډJJJ‡JF BoS @B0-MFF.QF$,!.4F0\F00F `F0F,!.oF(=FJ'8F!RFPF@FxPF}0Fz8F [F!F8F( @F(G$ 4B0FSPFP,%JKR(`S(B(pC(@UE0F> !F8FV% jBF@FC5JJ-M'F"F[&B AF0FX@Fo 5 I. !F(F.(F.PFB7!F.Z&Q'@,4 F.(F F.5AD@FF(@Fo  FJJrJp%sF.BAC H#DB x\ *! FpYJFO0|+"I.(ѣ|+|(O0 J#B0 DB۲+o pG-AFF8HA/mJ||H/zzHC!/#zH@2 bzCR@3@20P /xc{%{E%{EE{EekИI.eyEI.^(U?eI.S(YEZE)FH/Kb|!|rH/D"}M KIFK+FH(FN.FO/FFAH/#~~I}K~HF/a}}{H/ ~zJ  F)F@ F+F *FtHtJtHtJ.tH.#0 qH.#0_oH.#0lH.#0jH.#0gH.#0YeH.#0bH.#0`H.$0 ]H.$0_[H.$0XH.$0VH.$0SH.$0YQH.$0NH.$0LH.%0 IH.{IH.x%F&GO'0&?B)>Л ;۲+Aj=J2 JC2z<Կ # #5HR .I&5E;4`JJJJJňJɈJވJJJJJ"J2JCJSJJaJeJ7JFJiJJJ~JsJJʉJJJJ>JVJnJJJJΊJJ J$J<JTJjJJYрJJ<+7<+3<;+ (FF0H.5B-H.(FF)H(FF'H+y'H[kx+xxx.DF1F-7(< ,`o-MFFm(}){Ѓj+{h+VOFh [ <#i FG'FW ?hBѣi+Cbh0H(+%jB,H.biJS 2 +F-hS GU ]F-(=kh 0H.o m#h[h 3`iGF(%j+hBU FhYF-(=oojJ^J5~J-EFFF(7FT oB F88F- ` FWo V ?VF9F-q(.F kjjb```j3b o-AF, FFFF#`Ba aG`aab](F-`8 F$ F` #bcbFرFU ?hBѠh F S 8F3F6ho8*(K\ pGNJ F! F@HF F@xBp-@omii+"#aD pG:B3pF FCa p+Ai1 )Aa !Aa!ɲ)L]ɲH"ЎLA Dɲ+(S,рL β."4J4JQ\TҲ*1J!T9,рG,р(F:۲+ؤF۲+!(F=,O!(Fɲ[!(FxA,1!(Fr>,=$ɲ(FiN,?|O3=<@?t~!H, 2!(FVC,4䲤K#DIzJ_JKJJpFHFȱ JIiȹ F!gF1i(F0l0F Fpo"FIH.oBO4yJJJJp1F+o Fp!1+ѐ"1+ѐ#1+" sB P QF?H.xF)ѓ)2 3P"!@!F3K(dY9xn FA1#hA!AAA)`( h`y"`O3` F^#F Fnh"+l F)h#(a8 !H.pP"!I-,#KKF(u H IF-(?k F)FbFd県JuJČJyJCuJuJJ-ADFFFlFF)٨"-5B "l;F FAxDF -AIF#lx+TєL0#L0&'9F" 9FF" 7H/F"lx+ ٔFB# Fx C.) WL #?`*hnA!"1 "Os(FAA!#"!lD&A8++єL0C0EliiiB + #3aD  I(F!i2F(Fv!i(F9h"#l(F!h# a `hC(((FX8F)* 9+L -A%K0h+Ozt$(Ely|B"I(F!iF(F'!i(Fh"#l(F!h# a ]` Yii hCJ(((F0FHJ@J"!:FFy|ZhhBQ`Dy`t` nh*" ` ) )h*xQ)" -LQ[(O(jQD`q1)  TXHDPLYy[)QD`qhQ`Dy"t0(~(љy19)T!wJ%wJwJwJ%wJ%wJwJwJy2)0)ص~("`!F`" `" `" `|" `x" `t" `p"`(l"q f-AFhFFF{<8 +(#hBNE @F;h;;`H#h;#`+x h + 0Dy#h#3#`50 `(xQHi#h;#`"JJ-AFFi)Z )F8 chT)K+BZKdPj+@m!h)fhHv2F)D `(D-y "h1FH*D.  3F>+B #h;#`#h+"chTo #o+phBhB\#h3h+ #h;#`B>6 A2F)D(D-0"h1FtH*D.  >ch;c`hAhBkJkH.v ch"h;Bc`خhAhB_H.cch{sh)N] +'s\ *$bhR@Fc`2)D-&`&B@F&B#'Bu W7>F N6 I6 D#h;#`#h+ah)?U6J7H. 3ch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` +'KS!`.#h3ahY1F(F,(F,!h``BjAj+I hBH3h`BĿ#`BJR#` N #h;#`JH- ch"h;Bc`JJJ)JJJ\J{hBhB"T@i,chjFD#h)F`i(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D-#h1FT"h H*D-Y#h3#`>? x#h!T"hH*D-GJ-AFF FF,a"F! Fh#%a#s`~F.D#hah+B yB KEѽYa`T"h!H*D-#h3#`J-A0F FFI hO0FJ`J`J`JH`J3+@+pB# `8F*Ob)F# F-0.0! /4'F(+x sOñ!+:htK)FS",u;h3+̿3FF;`iKhBkJ`h3` F:hfK`,FF6fF0(BAo,F8F ,F8Ʋ ." .YS&}J~J~J;~J~J~J~J~Js~J~J-~J~J~J-~JF..*.2E##7H#pw`#+pO02Hm;!F(FF+x +Ѧ!F(FF@3B + .#8F#pI,DKD1#3k3s3#` 0DJJJ)JJ\JHJJJJ"J"KFpJ-MmFF F,#FF(-#oR&T#D#CBOOC ERD#[#E=FDpGpGpG pG F ϹF ù08(o pG pGHpGtJ-AF0"O>FVHE% " FI+!й,! F+,FF F,v?F)F Hс %(F!F@H+(lBlH!F@8+(,JJ8F0P! mF,F F8P"!FL FhKHldH3dd `  `o,J!-MFFoFmF&FZBѻ3(FI+\6. llNS``# FddZVHOB  "(F1+%H @ XFE+kH%5-$ho JJ,JK HddpG,J0> F,0%P"!FtI+KKKKKP"!F]I*K"K#K&%l F+0#bhIH,NJ)J#JJJJJJJJJJ !!KpF FHmFx% +&! FF F(Fp!F*FQ#4FsU&*-AF'AF458H+ )F(7BO0 xJFHI `!H18  JJ H+) R H+}"!hGFH+r̎J xJJWp-E FFF'8F.!*ox@F*xF#'FO FBѺ*F@F!h*F8 h*_B'F  4'FKJKIZCÿZ%`(ѸCF !2hH+5"F1FX%88{ 5;kBX%H+ %RJ\J7F FF , (O KOs Hp0(OKhhOs}JJ-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F*)8@F*2F$5? U,F$ F5BU *PERF@FU*(ѧBJF$ Fo籏J-MhFIh *F 00F*%1FȿH̿F*(FK xF , ,t5A+FK< , ,- "0C,-WvJwK#uLuH*FaC '(q([ и q0U *@F*"F@1DBPDBy$t0 02U"pD k``2S x$+и #IK!Os)(((FpAXF*@FQZF#-?A 3 < 2E3BF۠ ܱи 0U *$, "xPFU7~H*FH*N%F pX HH+ 0F *'{M+ HHX =DH6J|J '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O JJ_ J-MFFFO pL)44+.+@O +404,T04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F`4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C 434F #)4-Д+4?|POo(4+  C 434JpG FL4;+ p m j g d a ^ [M#)4G(ڽ@H*{J0&KS HpG J+JIK[FHDB pGAhB0oJXoJoJpFz L J Kp@޿0FciGch3r Fp4B$oJoJXoJpFJ K LB 0F!h)`hp4oJXoJoJF$ F!(-E{F+SHEh;)O)LJVLHE*')K5) ) k)ܡH*CK@BHI^ 0})Ѕ) &#!(F)QF((F)"sTFFBF8F  6ZF1F1FH*PF, F(J J7F,hFk,H,, KJ;,Fkha3 I*0K J},FJJJJUJGJXJJJ]JOJ0F$jF!F(F4,$ F0F FFF8F+S( ѳhB ,DB4o! o%o-AFFFFx FF FkAhCF:F(F1DA侽FFFp FF FRAh:F(F1D@#-AFFFFx FF F9AhCF:F(F1DA龽81FU+-ѐ1+)#FrI  34, " I6)B 8"IR)9( O0O0mJqJio@3 ?%?+F"!F(FO0F(F(ѣn+1+Цff-MFi?3#?@3 :` OFFx"!@#?  iH*O3{`xh7F[F"AF0F(BFqh`H*!U)Ѫ*[H100Fx`( rF p)xIL)y)I0SEEѸ @)>;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,)8+y9ISBSA*x[*C d SF*>%" P)+yu0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`)PPIS0FAA;hD00:hSF Fx`1wJJӔJJJF"#F]-MFi?#?@F FF FH*7F W$?#F"(*F=H* Fa(!8H1bxsDF{` y(IE+$#y+I{h4Bј0*+Ѹ 0PFAAjYD-ZF F3FEѩ(a" BB+LL*D!x(Ѐ)IKj1FHcF*a-6( F*+Ѯ)IKwJJӔJJJJJFH*9"#F FD4JFi Fi-MFiFo FFгrN"3F! F(3x+'*FahkH*O:"iIp)@/+FbheHq*O 0[0E 3F"YF F(3xk"XIYH)F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,)J)F  Fp@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#OsJbJJJÕJJJەJ1J^JJJJŖJ#jF!]p#!F0ahH) p H)% )F#H5)#)F F0!JMJpJ# Ip" F M0#\.#2$*;#$0HpJJi!FF@,D?4$?@4 ?$?#F"!(F\(JU#!Bsty*Z@@(3B 8FO0F`"!hF"iF F) 8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@Fgb{#{!FC#{(FCC{Cb"F @FSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PARTFC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : aw" Oa"$0Cw% p#`&0+1 '0005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCb# tctCtt-MF HF(|,zІi@1F,<f?6&?@6 ? +? "[F!(F(F_#FQF(F(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF FjiWn"8F8 "9FPF(dh#"QFfl*Q P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F, @ F(Щi0F,I0HFA!J0KAAAaSF2F(FBPF#Q P0UC#R CCS CcT B"VBBWBbZCQFY X0C#Z CC[ CcB  IGNOREMEFm Fi8F,D+F"iD0F( ;F"F0Fl O0O08oiF H| )FO0,)F,(8 8i8!F,!F珗Js#F"F F( bi# FV:CXBXAp-EiFF!F[ F,C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FSO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`{JF ! )I,("I F(00@ @[H@"dP(6@F 6JJJ-Mi!FF[ ,T%D?4$?@4 O *? QF0F `6(FH)FH)EH)EH)P0hB7F Fh5(Д!0 $`H("0 FHH#0Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- K+. KK/ KkkBF)F{hH)100 5B"203BB40BbC#6HCC7Cc){!F H)w H)r~JїJޗJJJJ*J7J-AiF F[ !F,D?4$?@4 $ ?(?:AF0F|`x(F )F8(Fxh F7Fo-Mz`iQ0FP F@ R0F@@S01F@`8,T1F@,Lf?6&?@6 ??*"?F{"!(F;`(F;hH"!p;`JU";h&!"ơ!aji1F:! !(FRF(FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh7#Y0Cb{Z0#{XC#{CC{!FCb[0F# tctCRFQFtt#F(FI(Fo7FI0HKA!J0BFAAAa{h(F-E F100BFA!20(FAA30Aa1{hEc~!~~A!~RFAAAa#F(F(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbi,E W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(F"E(FF"0{A !H0 8DB0 H"j9F   B Ppx75Q2FD]"qoLoIoF稸JE# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww sCiF;" 0! B" #0$P%P&P'PCi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/08#P0o"() B* +:F0FLPMPNPOP-P.PQPRPSPT0UPVPWP%tetttXPYPZP[P8(@ @B-MiFF[ !FFF+D?@ !?F"F!|iA0!F+D?@ !?{F@(F o  F"F!^CFZF)F0FSF:F)F0FF(:F)F0FF8F(FO4s#F"F F(O0p0h!0 %A!"0jiAA#0:Aa$0C#&CC'Cc+B#(FF8O0-MiF!F[ +%D?4$?@4 G *?  "U#0F Gri;$?F+F0F:Fo F0((F+{+oJJhkhGo%pGFpGo8F F .)F F8@h8Fhh F0!F(F8@Y-AFF F+Fh,<,3Bo FhBChB@(FjF h@(] ]F0!F@-EFFFFv#hF<0#i:F3FG0F FCF2F9FGBF i:FFt Fo%-AFF FF?#h<0k;F2F)F FFA`Go%-AF FF #hkhS2F)F FhAGo%oooݿsF cFPoh,<,3B0Fp FhBChBFj,<(0 -M ?FFFFF,/RFAFFX4F% h,<,3B FhFB BhE8Ft`\Fjڣ F193!;#A19!!9!?a4%%a`CargD``-AFJFF!ChT(N'FرF F1F ;FiF0(F= F o J8FF(F F8 MdFB ЦhB#hB ѦiB&iBvDvEӤE A``!!`)hL`,`< J Sh3S`$h!iPi Jh3`-J-J-MF )OhFBF/:ijh B""JThJ``""`b`hi9`aiACBi"ai0Faap FM VF(2F #aea=JhL``h2`-J-J-MFFO PP@&hDEѽkУhBhB#S``i\ FY0;04F6h-J-Jp LFh FB#iB!O0#`%a#`c`p-J"I#J`S`-J8F`#"#h\k+h<<<43B8 FkFF)hk `ShG pG7F Fh h#`hkhK)F FG!F0jh*h#Fo0F##`l%JB `!F(F0^J0F#JI-##`!F(F0^JJl8#F`F F)I8"F(F8@ѿkJl0h#hkhGpGF0h#hkiGFpGo%pGp FFph[hksiKH)F Fsip@GFpo%F0h#hkiGFpGo%pG-MlF+F0. #HJHIl$BEIl"(ۃ!FF(9o ("FCF(F8IA4(_@F  SF"F(F1I.osB(6B_PFBAFPF&(ڨFIlFF [E)Z/ZF;F(FIorBF$ &B  B_hF F  F|!lF FJIiNJkJpFhFfAhi zFB #SChЍhԽp@ I H'Z%hX_Ih6 C_Z!hPp"JJ! !  pG8?0 ?!F@ F8!"F(F)(F8F8@ -M0FFFF#0xheF(@P! F(׀O24Ccc,bc `Ca <dcdabd[hZlCh[ldh) +p H$(;ks cl Ccd9kz(`[hkIcl Ccdk(x a3hk3j[hlIcl CcdY(c`k4cc#d` FFh.:[hh+DѸGclC@cd(F FGF( FUF&#lkS``clc&dhZ`cl iS##aclՠhK#` FF3hj+ FGF(лi+ FG FGF(@o o o oo 4#$FhFFFOFl_ O3(F#oO08F(MCl/Ԁi0%hj(,#j[hXk0bj"YlH`bikhPkj[hk0j#)lȱb#hiclCScdFpcl%(F8i+)lp(o  Fal* FGF(osF({Cl$ Fp" FNF((F.hF(?ѨiklCkdi#(FF(1ѫi3l+!(FF03ic(FFh!(FFklս+j[h[hZ+(FIh[j+(FGF(kl(F#kd(FGF(iC+j[h[hZ+(FI" F(лoJhpGhpGipGipG@jpGjpG8FP4O<<<Bo) FX,`8k9<1k) F(, `#acaf```l hK`!aba`j FGF3k# hb##`ci"iS``##aca FV(F<`%o 8`o"o_o -AFFFVO,<,Bopl(B@(Fj}([hh] hpGFF$ FtF04,O4 F2F9Fh&0((h&HBpjFhB ,;,BoB `pj0,;#7 F`F3hB!F,;,Bo+`0j9,;# F `0R?B,;#`#h`jj2B,;` pG7 F F,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh&FPhh&BP FjopFFF F&3FF!F(Fp@ChFZlp hjp##FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`opa(T?,;,BlB3`j#s F`opC(T?,;,BlB3`j8F#FF#`FlO2"F(F8@zo88FF!$F%`F8#F`"FF@#F`="FF@׿#F`^"FF@ȿ#F`n"FF@#F`}"FF@#F`"FF@F##`}"FF@ F!F@hF]# ` Fm0#h#@F F #h+oFfh@y\JFH l0h;nBi0;j,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGhR?,;,B]j0 p FFF) 1 qB! 2ر``a! s`B`` phBhBhooo 0)1 tBohBhB i`0hoF8) shBohB hB $#S```D` F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Fcl F! Fcl F! F FFi+#lkS``c dcl`h FGF((F8o-EFFO U4OT<BPF#hB FF8ahH&Fk4F<狛JhFj;zy! F9#j[h[kC Fpl! F0i{hRkj[hkC FaZ! Fcl#Scds FF(VClI" (@F"F(FN7.ho2l*;#aR3+4(Fsi۹i3l _KF0(F"kl #kd #(FG(phj+(FGoopo-EFFF'ozT4Pch+o8h`BhBch+ hh`-EF0@F F<hFh( F$F0hS"F@FGF(0F F"hhX @Q 0$CA 0h;iC"`oo FS+(!% F @pG F*(!Foh FFk!FFh{h"h` @Q 0#A 0+iS$ +iC$!F0FG(o0]ƿo]IFa F@Ľ"Jp FIFRPjhH(hHd hkjV4B3Fhp@G"VhJjJFlF+ F@׿ -M$FFOD &FO % kH@'EӰBFD +F4,ѿ_ H1F'$KK@ $10F6nʚ;Mb8 F)FFhF`H'd0 a 8ʚ;-AF F@8K2# h_# #;i_B$CDtD0F#;i_$CDt Mb '@'FFF_`#*F`h_`_@#`*F9F F@F_P#@6`K1 /i_/h_/ F#>@p@Mbp FbihB3F!(FҲFh_@#2FX!(F``Fh_1F(F Fp$ 8FF(F `O3 Jlp``# Jlp rJIl}` 8o iJtJJ-AFjFF!(F<hF!(F%hh&z_OD `#9F(FF_.`_FH'd1F(FB@F`&a ʚ;-AF F_h__&aD `#__'`_f`)F FA-MFC"F! ,Ѐ,̀,Fh1FF3)Ahh[h,h-i#i_fп_)F F.@OH+F! FF@#`>$!OJB+F FҲF^:)F FCFFFh DL9K _`_(!*F F`C!.տ##X!P!C@_*F F`1@h_;>sF_)F F@OH+F! FQO@ FO@>D*)F F`+F.80_`_(!*F F FFF;_`_(!*F F FO3zBiiFB`ii 0+ИG(FiciB*#aD y0+ FG(O08F F"!w 8@lhkhGFpG@lhk[hGFpG8FihF "0#m##`Ked#dKPcK!bKb8@ɿJQJJJDl Fm#@P0#hkh F@Go%Dl Fm#@P0#hkh F@Go%FFFF:F1F(F<#0#FYhkh K@ @BCCC" F#cFOzp#" F FO`# F7F))(&ao' FEa 0*,1[hP1hF"O01@#"~Z$ F!AF(&FH$bJ (KS HpGJJ #0#d0 F#" H#`p)FNѢABAAj@,Hd)kL!!CBB@r#(F"F0BOzrF!(FbCF&iF(FF8Ro d #G0F!BomFp!OtoOzr FJC!FW&O(F{pS`o9B H$oE,6Ozp# 4F,H$om@J1J0c#0#" ] #0#Ch+ )##"a ]#-MFFF>F@hF`(FzF(jiB&H$Z&0F Fao(2FAF FFFEUF(]F-4""!i boٹ## FF- F( H$ 9F*FBbo /DѸ"MJyJ#0##Or# ]0JAh}B }0 ?$?!FP(ѕ 0BoI 0Bѕ 0Bѕ 0B"#o(@p)F F}!+ #"!0FjF%- ?%?)F0Fp K*F F }p#oFEChJ?C|BF} ?%?)F`F(@@Op(Or)F0+JR#Ka`B@0RBR^#C3BOPpuK((bB0j00pZ*#k0f0 i /D g [0#00[0#F02x<"<D*L o02 #CR3#0E/ 0B0 iD02 #CR38# 6#([CSR6#FՕ0Ѽ3#"F F Fл#000#iKG [CSR(#0 00h00x0&0F }0l"D330(3#0o o?J@@#"Fž!#"!)у#"-EFF'_ i0"#!(FC F(? N1F(FkF(FV F-M} o*FF&?1BhKDJB ٦H#o{ F }f0ўH@ HOh/58F!F&F90!FF&)H#o+i[FO F !FS;0F&F  9YFH#B k 0# C˲D#tH1F(F~F(і 0B0DEQFjH#w{ 0+ՐLC  "OP zFF J_* (њE Ж0RHIF0NH#;O4?+?<0#"F(F(e#000O O"x!(F۲ҲF(W  O't!(F۲Ҳ{(8я'FOZFh!#(F۲f   _73/ќ"!(FOh+?Ԯ0SE#"F(F@FSF"!(F8F(нF?JơJJJGJtJJ͢JJBhihB(!FB8FaupG-EhFF-@ĀyIhwIa#1# Fa#u(@ F(@O`"(y FF(#of#a F*F)F F FvF(i Fx#r0#h FhSK@+ #Os#*F (0+JKc`@8GN 7#"0# F(L)#0##hbhhREOCC F(3+ ۸WOzp"=)F(?y&0?vj#xsbaF(?z(F #cs#a#Jahd0B2b`%n) F F)! FF#k+ 0Fzd "5#0omH#o^F3J?JLJFh[hCSCb" F 0`H#qoz! F(#0zJ-MF0`h %(Fb0+_%0P+_#40## "1F F`F(@"T#3d0*F`#1F Fs`F(@ch"+1Fd0 #3#s`d0 F`F(@vbhhuiiOcdHd'e?b:*8dfhj FeF(Ў#kP+ F(F F! FF(@B#k+ 0Fzd "sOB#a#b`d0sJb`I\IQ#0!SC"#gfch! B+FW@'i0cg/O C|CC'%3  #G /C]CU7=D(5OsO O BԿbgcgB*,.024g`ckZ "2"1F F`r`.#O3d0"1F F`F(@#O Fi0F(@ Fdz FqF(@8bhYI*@7#P0d0Fb F1F`F(t3#3# ``1F# F'?`F([;hcyhSE f+fIlochCc`:IlfchCcc`7Il]chCcc`3IlTchCcc`0IlKchCcc`,IlBchCSc`)Il9chCCc`%Il0 `#J#IXchCc`r!Il!chC3c`Il(chCCch#Sc`3J\J=JKJJJJJ̥JڥJJJJJJ.J=JWJ{JJJeJqJCl hF-A@ F#h FkF;j+2F)F FAGhXip@ F FF#hkh+2F)F Fp@Go%ppFFfF(FzFBДi0+ F1FF< Fp$o{FFH 0!FH" 4JH 0 p!]7H H %h,<,3B0 Fa00Q j,<FH $ H"FFD1FH"| .Hh4jhLK4"(F+h(Fh9FBh H"d!F H"_$}JbJJJdJJJhFk FFC#OslJIH#IF'```O3cc#css;~3r #P1o%(JJrJ#` -MFFF@FF(O5(F AFH z3(P0F)F%8FF)F%XДx0+ds;DjB+D@)F0H;:@"O %Bch+) 2E(F!i:Do JC+ !#!O!#$#  F"F0H F 0xF(&# 0# FjF(Ozq FED(UF}O ʦJ'J-MFFF8FPFF8QFH z( FoعFO #h F[iSE(SFDFBiB F1FBi#H":-:'8F-3-""!i oSC # F FH"- #0#  F HOzq F!(o ѾMJ9JyJ8FF(F#h[h@O hS 0.#h[hհ@ 8 pF!HFBOt1F%0!( ) 2F)hH"O0p$01@KBKBKBO"DSCC8CC#CC_jh `#"#"6nKJ@x}u-AFTF0FDF0FIshF+`O@`#k`Oska.K)F`-K0F+aF(J0Fs a#&J#F&IlF(9 Xi"IspC 0x`;`0Fzh0FZ8FIXF#F0FI  5P_"iOzp`!k FO4u^JJpJ6ntJFF  F@8F "F_ Jiaii_+ ۣik__ ic8(F oO0 pFF FkFSi]h_%2_iZ` #o`p Fk(%3#_iS`C3_i FS`(ѳk+ѿ_"i `+ѿ_"i_"i-MFFFE FKhF-@; + + O#OCzhCHCPHCsޱ2h@rhhhTCSCS*CS_iahhJC_iJah_ia:C._iashh ##hiSChO*BBo`O8OjO EE: ?KzFik_@F5z @m.O{h #Fik_(Fo򌀳zhiSj_`a EwӢik_BKhX%P_iQFMCSD i!@+`Eѿ__iahKz+4OOHFik_(Fx(8 5Гj_`ij_;ai[j_{aij_a%_O2icih_C_i`(FO5O5ik_om_"i F`ZpGjC#h_0_#Ozp0!_ _00jC#h_0_#Ozp0!r_#0_pFF FF F(`l(T#hbhhH"o(FpJI#IF*Fp%4#hbhhH" J Ic 0F($#hbhhHJIJJJѨJܨJJ-AF{F0FF#hFG;:F!0FF`F3hrhh+H" F)J)IOrShC8FS`F@&3hrhh!HJI|0#<C4|0! Db(H"io KJbjIcjbj0! j;F(#2F!jtb8o+JJJLJpJA6J6J*J8 FFh_#CaU+_Bb;_ahC` 8FF FhFk Cc!]m#Ce_' 'e!R+h__`_?Jc_ "ejiQJBJAB2_f_"Zf_@Bf_Crf_Obg3yryC#y0zCy)hB"pzC_ _Ozp0!.h_ 7`!_' 7`!jjF0hHYh"0F*kRiHJ)FYiH"/cj[id+co Cs#scgji+#n C##f#hC#`SJJJJpF;FU4;m_l_JBh"`kBck_hB`m_*o %`Fpl_ ?)ݱo H"3oY"42D*Fl_BkBoMACJ pG-AFP FFFF`M2F!H"$ FIP"!.O3"a#a#abbccJKcKgdH%`DBKc`ibbh"c[is FGXIH!Zhhz@B83. KB6E&@:J/JXoJoJXoJXoJ%JcJZZ-AFj#FFFG(o(`#BF9F0FjG(+hC+` -MF/MFĕ"5F  ŹO34Fo`KZ%  F5-".=Ж&W!X%8FFx `C[E S#F8F(_@F#@$( \J8CkF F#GC !z)F F8@ChiGFpGChiGFpG0FhF0j% FFk0`GO00pGpF"O1i C H1O0"O1(FOzp 4ͪJ-A !O1@FFFFhSBrh!h[hkH1!`$ F*FH!JJpFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA^"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1o-AFhFFF&ahho[@Ch|h)ѿ_"aCO"!h_!AC_!` x_L@ 8@_ p!xɲ_1Cɲ_!p!xɲ_9@_rB!pOUѽFh FchhfXBhPh@ro KBF3h_EC_bX`@r#8 FFhkh+ ChhhBқi@b`8ooFhgchhCh!0 pFhVchhcCh|J|hX_C_P! F(Fh#: h H!^(Fp J IhF(#" hHJI@JJJkJ-MFF(FF(Fo`(FnIG(&(FkI ph70hB$Ei@񫀧d YF(X YF L YFXXFUIF!XFF0[|["hFNI +XFLIF`!XFF0FXF+F( FXFBIoF(!XFF(3F!hF:J!~iF(F@F`=3F)hjh h3H!3F2J2I3F!1JhF!ciF(F =F Ѓ P-3F)hjh h'H3F#J#I3F!$JhF!E:FiF(FFP-3F)hjh hH3FJIN0|+>a67 C3F!JhF!"iF(FqGh (痫JJp4JͫJTJJJثJJJJJJHJTJJ-MFhoh F(JFx#J h`H!0F^J^IhFP#" hXHUJVIch}+Okh+L pF`+h; hMH!FFGJHI pFH+h# hDH?J@I qFFH+h# hJIJJJۯJ8 FF*FF $ F8(FF((FLF((FFPh;( F@FFl`( (F FI|+ FIFC FF#F(F Ie( F( Fo J JJhk opGpFl F($ F%I(F .FxZ !J kl)Fo% p%B V%jFY h#FFFX<#hbhh H t5 J IjRhRhZ*h!Fk[kG&J4J?JJJhkhGo%pG8FhFk[h;G)FF F  8o%hklF`Go%pG pGpF FFNF FJ0D0F #F*FI 4F FpjJ-MhFFHF<F(TFl<1F8F+Q1FHF(HFl(1F F+A 0+71FHFFlF1F8F,%ۣ#ѣ1FHF(IFlKF1F Fo F o #B $O'OO;иlи1FdH^F(FlF1FPFJ,+h<0;!(FGFEo%!F(F0GF](?41FJH(F(܀FltF1FPF,+h<0+ )(FGFE!F(F 0GF(X4(FW#+h kjGF,h1F+HF( lF01FPF3W   1FPFBEQF(?+h<0o% *(FGFB!F0(FGF0,1FPF4J4J^J^JeJ+hk i+"F(FGFi+hkTj( "\E 8 * C )h+kh0 kj,(FGo sFFFZ00FoFp*F FL(j"pFFFh$ r 0(F ( `*FI Fi p*FI*FI)F FJ nJyJJJ Fh 0y Fc ByA3D!JH HJ4Jy@ FFFF8F "3h2h$ e 0Rz I_ J𵅰FF F1F(6F FZ F8` FlbhIFFFyB F 2Fر$!:h"`P"qjy IA22DBq"qO2S86oo F{JfJpF F<FEk ,$$h2Fa p$"h +K2:?o##` -MFF6'F,8F F@F F(=#   U U2 8A0FBа_аOаO аaO а?ЫFH  !FHLP0+@ILP0-S (HJ8JJA@ahkj GopGpG F7Ci ```h`Zh`h"thtibt[ica𵋰FF(F&F1F(F!B?2F Il a2FIl`"Il1F`(FIk_`aciSNI2Fl(F3Fca/ # & # ao$J/J9J6nJhiDh@X\_pG!F@i`i@!o  F!@i$@ihh#D@Ҳ_ZT8 F!F@i "F!hi , 8)o  Fi  * 0, +J@i!V HyJpFF@i!F@!`i`i!`i"!`i%p@!8 F*CiFXi!Q"F(F 88F F!`iRB"!`i{"!`iv`i!iq"`iFlk)F F8@87F FiFF F=hF FO1ha(F 0hkhGo%pGhk[hGo%pG-AFFFFF@Fh1FZhC$h@rjH4UCUizn+D#N -MFiFFF(Fh&Fcj i 3#Oh@H3E(F#F"F9F-AFiFFF`F0FYhihdjeC|C10 -E FFFF@Fi<F(F5!hhji@+iH1 ;nn#BO$ LCsj2FDi#D#+FNhho FFF(FFi>`shF#fhcfqh @"eh("ekf"ehh"e8(o% pG*h!`D`*!*!p-Mh8F8`ع$Pj@H4@B XhFBXwB'hBFhO hB h7(D`hD%6.FO .\E(v U0j,F,vD  ,Ѭ,-EhF0Fp$@H4$cfB 'j_Bѽ&F+h, `Q,у+h7cD+`,ѣI 4J Fh[h#`hh#YCK [X`pG4Jp FFI h p(F!F0F4!h))FHo F4JJ FAhahSh"h+OR[B@#``70FjhF0`(F BihHo0#` J F0@hF PKF"h  [h!FFhF**) Fo@ "PCKXKh@h@ @ "PChK)Xchh) CSC@`@@@CCCHJ8 F<Fu!1 F2P)Fb Fb8%!hFkC F 0 FB h+ИG(iiD?1!?8F Fhi+i+!FWDB(F8@!ɿ KDB@KFj F@Կ𵑰FF(FhFaCjC#h@H3SCCbb!SC(Fa(F!khJJ!8FDF!i(F)9FqFx FP3}C#o(F#I Fo dJgJpJ ]Cl!Jkf@mBؿ1mBؿ2CnKCCenZCo#epG8FLFiH f8 " F `8F4nFnfl{ ! J##`Ked#cK Fcc8@IgJ1lJclJJhk$hF`Go%pGhkdhF`Go%pGhkhGo%pGFFianbm#o DF#ebe"mB{"!(Fmj(F9cmbnce!agi@hkhGo%pG8 FF$egEe8F FoF+0FoF/8-[-7-An@m"L#o m!nH0"B#g g {gK'D[]P#K-g@-٥A +R#iJiJiJiJiJiJOiJcjJOiJjJjJf-Xm-ѰiGFo7'D4B FD)))ѕ1A(F1b #an`m!#oF m!nH0!A-F-E=-"C-D r&q F{D-DiF09*:+\i!i#ce#o#eOiF+Can`m!tjF0F8%) )o109#Cɲ{(9)?c20#Cɲ2 iYU2(F1b(F bH --Z+WR#OiJkJ}kJokJkJkJjJ-Cg#0F|0Fnm)F!Un%eBݮ0Fi0FS3hFkic+m*n)o#B+e !i0FG&0#cgm;SCjn+ekmH#keJ0F)+FBmmF0F 0F.+F0Fbm!m(#mnD#eegBDl FWi@!ټ8FL F(FF(8Dl Fi@!FFFFi{n9nC;-;B *FBF F@ 0)%xp0)Ѣxax%0xBa CB* bxx%0BRB`* %0bxC#xCCC%0pcxCpxp#p-M FX` {F,#xB+cxM+!FHo!|}H(#}hHHc}Hh}C#"~CCb~Cc"cB"p ؙK# YFHfZE *@𱀻л @,  GvB@s[#sGvk[B@s[#sCDBn DB3F**@ {{B"2 jjiOC# CC! Cc+@ʀ hz zC#"{CCb{CcD;O #x+EB$EF "F+Fѓx+fxx2B E(.F8F8 c +&vwD4*?L#YF7HO0 )_ D3X)g D3`fx.. 4;[jDxDx8Zj4SDKC3iB E ٘E,5F 8FF#F %uw44Dq4nZ YF U :D zJJDc YF @D ; mz+CFhzC#"{CCb{CcD#B! M&F8F E DDDkj D3 YF6DF F"lp8 FF!03)F`h8@пF!0%`h@7F!FFFJc 6!FR J+- #" FI 0JJеJpFeF FXF F!F0hZ&,"(FI pJOs0hAB`_bh_d_@Qd_!eBhTh:BB_!BhTh:BB_!_O4A_ ABhUh:BB_"BhUh:BB_"_B_ BZhBZ`ChZh;CB_Os(BhTh:BB_(__Ob((Br(k*(BRB(0OrShC3S`Osp(Bp((B(pGKC` @pF NC4t_(@BHo=p`uJ-MFF',MO4FSF! O#,@@@ `@@P___ @@O@ ! J~_ dEѣE0FFP J KAF/F HW? Fo=`eJJJOs-M"}FP!FP!_JKJL 5bF(@_ #(5_O@s1F@5mF(E0F;F@9H o ~ OEE 0J5#C5OsP!P!l||)*3~&Ho F "} YFPF* (UFFEFO >0FFHox)Xx(x@H9`23Bo#F;`"`JնJJ-MFfF@F\F@F[ F!  "mI OrkI "iIF O2gI O2dIF ##`bKbIF# #_I K]J(^#`#h;+eOzs VHOsP!"@rP!ZnBbZfP!BBP!_OB CZ`_B"_EJ"_DJ"_" ".E?K/+<+B;J Sh#CS`OsP!"BP!Zn"bZf##`++R#3#h ;+&J%JR# )Hh_%H" F0" F( h(?>> Ho@H##`HHJ!J6J+J6JIJAJOJpJ`N`MJzJJJJ޷Jk%r& `h[R`0K8sF(¦H\ aHQ0I`OsZnHBBZf!Br!OrhIC`HJKh_`Uh_P h_Qh_RUh_RQ[_S3BOrSh%CS`OrSnICSSfHKJ_C[BOr8~HC8Os!BB!ZnBZf#hhF>h@FO  {o XDV!`hhhQ غ@ˀ#` @Fh!; [h{ IH TI!PFCH OI!PFyFxd *iihB̿O O@ +hXC <#(FFԿJ J( I1cD)۲[BG0ZIZK _ Bѿ_"PK _"RI RJ# _ Bѿ_@!rEK"_""iBBa_Ob=K#_OxrZb_b"_{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppGJF0 hkh]$`6F F!FGpo%-M0yF:hF8j}( Fi-M'F $?`FOb9F F(F0 ,YhF3#`(F$9(K(FuF F1yaF(;s $ sQF(F 09ll(#hFTO:#0VKX TDE`SJ"! . F(@o PF :FFDpб #haa3h33`(hwF(d3h;3`/(hPF3+F $/FBF8F+I 0B8FFp;:F7 $#(F hF({i CaFŗ ';F(F IyF(w_+h`nhyJyJhyJJjJJ7FahF H!" FF( H0@)h)H0@H0JJPJeJ"FKiF} pF(7C%FFh,>,B+єh,<,BR;hCh,<,BTYiF F`P+HS+Kx+o Fqh'HF0FF#H5j,> H41F} JFH#Cq"K5pHcl FCy FUjcl FCy FHjJ߼JJ}JJJJJpFF(FiFi(F,Y 0 i F#`p@)Ob FT a,Yp#` Kx 1 pGJpF FfA3@B@p0][#F$RO a`3B0l8PDT:[h_!Կ_OBT:Za#:_T*S`_"%T:`T:h_=H_"2%T:`T:[h_Bp=HUO08 @J Jpj#OUAT4XBRDp3+"OUX6CDSPD2*H `JpFB%&#hB F pV]5-MF FFB"HMO  (O@F!?F"h]ETh3F$(@+Fbatfb.F"`c`Ʊ=5D`O F!?%cihZ``iaiO1!?M`疽J-MPFF@ T?!?"@:0@ p_zH:3HH:O4 F0_@/@$O4 H:3H:HlPF.տ_#00_%@ ?!?@:@P@ $?!?Ļ-@_#00_տ_#O40[@:Ozp0v_"ZS 63Z#0+@$_ p'O F!?"h9cibH$0`KS"`iO!?hh!ջ$|1BF 1[!h! C`0|D;0`iO!?%ah$z" `iO(F!?/,h$0i*|:B hQjhjP1 Dbڈ$ڀ ,K"FS$+H*JR$@وB=ћ 9h*4i+6 O%?)FXF0 #B&ћ0+"0)FCC0XF *Ӳ!+Q+#0 bDb"Zb *歽JȽJJJ!JتJ0 PE 0S:#:_T*S` _T:b:EE0:0 `O1!?_0 PE 0S:# :_T*S` _T:b:E0:0 `O1!?- 0ax%+?@ PC@*R% ZE! 005 -ћ0۲+?V PBX X Dh 3_ x$FWbh#hB (chT" Qj)3Pic`-M hFiFSiFiiPCH:3HUO3'Sb \O{oC#~Z#~ՈH0H"~X)sb:Db`chR`##v_cv838#bCVCCOXOhHRhPBBBAHB8H@Pc~+#~+ڲ0#uuO#?F F3,л6л%лeb1! +a,`(b$B-"~H(FIHX3@+"OqHq 1.)eb0"?HAebYFqHq 1O OX zc;D(N?[(FD  @#0* ""vua~)ʲH*t*?1F!?on _!CfOTOt$BF*总^<J\J~JJJ` Fu PC* _T*b*"a**jL*R*B*_T:Z` PCJ`` FG PC* _T*b*"a**jL*R*B *_T:Z` PCJa`}_"}ҲB)+`'@u#CnF ZBT2Z!REȿF3 +9F F ZAX1Q# BDA# ;D+ݝ 09Fcu O PC E AF@*  DR "}B` F ` @ ?!? D3 F 3hFEODKF3D_>K?H2FF$[F C PCL**_"T:` F [FOR8CV  GF!?_"Or@F ".#HO#2F,8F[FHJ.F" PCL**_"T:#+iDp@2FOT@ @ -MFFv.("QF( Fȱ%, B ! #FHD# U FOHw$ Fa a 9Fa#K D@ H[T#5#%`c`JJ<J-MFFF0FFFg!F F05H4o `a aGaa)F-H"O0O{ 1JBJAPF1hF("FPF 0!HBpYA8OzxPFE((cjOzpBH#cb  #j*9 @;?D8F!?N F# JbJJJ-AFx FF#*F!F3F AeF FFx#*F!F3FSp-MFFF_!FF0FH!FHO5(F PEp;"B@΁,tkŁ 0C# @A! D$@#B~г%ڠ+X܁+OQЂ+OЀ+H%EDFFBF"F8FIYQгLУ+A%K oB ">ܳoo@#2B9)0߷////ճo^oѿ_O2T:%#%"T:m_##%"`T:4h_)%"_O2T:e9)S!MJaJۢJۢJۢJۢJۢJsJۢJۢJۢJۢJۢJۢJۢJJJJãJףJ_T:4#`_T:4#_T:4Os_T:4O3_T:4O3_T:4O#_T:4O#_T:4O_T:4#T*h_b_"T: D`Y_T:4OsT:4h_D_T:D"p9 + ++BE(BF*("H%BE(BF*("HԿJEJEJ@BE(BF*("-H@3BBE(BF *( "'HT:l_B _p$Dpop!qCqqT:l_xq) #rBE(BFxB(FD r#xCr1pr"p%$#"F1F;FXFSFEJhEJFFeF(F^'Oq'qPDFTjF@ (Or!@ ?!?(F0yO3@RHzSdB8B0B9BD1 B@E91:_%T:b_T:b@*_T:a_B/"T:d_RT:`bZc_ObT:Zd#HZ:_T*S`_JT:Za_T:B`_S"T:ap[1h_H(Fo oJFH0PD@ o8FF(F[@0PD 8 8@8-AFF(F|[G7F9F(FFMF)hjh hFH FFDJDI8FFűF)hjh h?HPF F(-e h7HF2J3I[G79F(FF` -F)hjh h-HF'J(I8FF౽F)hjh h&HHPC F(U hHFJI[G7F9F(FF(AF(FF(8F (5+hjhhHJIJIJIJJJJJJJcJ@J`pGhn_#C_fpGCh[h_Bh1 pGO3 `pGLP0(-AFFFF4h_ c<@DE=O0 -!$ Fhh_# _h `hKOA0CFHJ Fa,##-1ѽ@˿ -AhF FNh hJ[SCHi@F@0o'n6@@ Cf+h!hXh?X``(m!?D(m竪FF#00Ch F;+  G0 ~SChC` F?!DF!? FFl"F N#F@OT4@BAa 2+D*)FHO0 Jh_#_"@;OAK0Hom 砆Jh_C_OB@;FK0HomOzp 砆NJpChF^h_hh_(%0_hO@A`h"K0 Hp@λB%1_ORhF`hOS0(phZh_B_h0 DZ`砆J@*-MF, FF1FF@FoBڐIH@$ F +ѵO F(`#VSC@ Fe`(f``;D aF@ V`a(T!h@!`i; on2@"HB?FiC?1!?FDJh?1!?DB`iD=$1+=F#i `hCE? i)(Fq$h(`ih Fs`!QC8B O   `@ciL!0@F1F ) O@T9 L .@ 0.KpaA@@CF0S9)FYF@F&!pP Y`)AqpCA`I P@a P@Xa @P@a @@ aP2D;O hC(?Rj$13$1GJJ@FFF-EFFhFx$1;$1/zpO4 h'BAF3i@FhA;E$1+ ݨhF E HO4pih0F FFJ-A FFF"!F(F`F@ ,A3Ozs1F(F%F$B HomE 1F, ( FO0oJ FF, l-MF , #?FF+H+!! H0;#CF@ F8HJO0 `"!@Fr!PFmo n 3@C0 09F+$XF $d @xK"CC pbCCc,!CC CCB *STbBbAC30OC$0AFXFHD+@3&#@HH[  {s   BoBFF!OK1`q`A 0FC CAqAHa`DH"CK"PFH@@00>HPFiIVF+ F ` C@ 4D@+H{"J (I Z`&J F4`3`H+d1FFF@F PFSDFh[h_?_hS`hh_%C _h`OBhF K0Z0 H9JoJQJJ D+A7Ozwd< 1F}@F yPFuhz BӀ# @1F+dAhh_C@_h` "hFBs0AF4Hh[h_տ_ "hZ`/#c+ ?D!?)$H(F(#&@+2 + +/K@"# #P+# !@n"@ Cf9D PFF OO0 @##JJFF,F$սO0pG-MF , F+(h#B@Ɓ#0, sx7xFG'B3z"BУ/ F<1 1GF0O0JoW%HBE@#BYB3Bطoo#9#9@#3B)h_!*xxB"*ڀ**@B!~q!  B@CS_o+`oEУ/RР/#'0 xxC# *"*)*ѡL OzpyyE%]E]FB=F4-*F!F Y L' 4D|۲+؍JR#@JVx)+~L'xxxC#`'I FJ }-JJJEJJaJvJJBlJJ}JqJJJ8F+F* !h`h`- hH8 8O0 %(JFF F@} -EF+F_hhhF $ F Fhh!FFhiaF>Ѩi!FYF *F1FF@F#tFPF.F#HͱH)FOzs JI H H%FO4JJBlJJ}JpF+F"hhhwF Kh .Ahh; FpHhO4$JJ*F hXhQHh8 O0 *FhXh;8h hH6 O0J*F hXh!P!ih8 O0 pHV&$ M> HM HJ p+hC, :!,!jhH4D5J8FJXJ}JXJFFF1F#Fر#F F"#vF((F F#BBѨU=`o oHpGJJhrBЈBpGJ7%L#!hq( H !hq 0)F+F*F!hq JJiF@ ] F`h vO0 KFh(h0"e O0J "!Fh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRFs(#` Z`l 9F9FF  ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9F[FRF(?@ FF#D3 [FRF(?("!BFXO4J0F Hhh HhP EE0O0JJ-E FFFF (QF HO0X2F F+FJphFFF+ChBуhB F)F@ F `@*F!0Fo Fo pf`` 牊F@)OhjFpG-MFFFCli@ 9FF:F!Dj 03 F\ CliO iYF 7 (ki>0FFVZFQCSDD@#F(Шi p 0 9FF(AF FjF0F4FQF|QFD0F6 FOCi 0"9F 8 -ML#hFiF 3FWBli*j^Ն #h$O i(5 3@+FO 23 B.O2mF2B XE*! 1Ih"F@F@PFuhBhEF!D@F~ H@FuoE ڭh@Fg(D2  U+$@F,OkN ZE]ۺ)!F@ F"F!`HO0O2]K`]K`pm0@B0SF"F!0VHL0BPF5O1#NJ@ `!F3`0#F"FFFH@m@03h K S+w 1YE ̀%!F@ gF"FQFT1HO2+K`+K`m0@B."F!3h 'H0BPFO1#J@ `!F3`00#F"FF@m@0LP-D!F@ F"F!P͹ HDJ8JJNJJ GJJJJJJIJO2K`K`AFF[ @0B0+F"F!D H 0B(F^O1#J@ `!F00#F"FFP-@3hS(0@00S"H3%!F@ F"FQF~тHO2K`K`(n0@B."F!3h zHܱ0BPFO1#rJ@ `!F3`0Z#F"FFF@+n@0fM-!F@ >F"FQF+]HlO2SK`SK`v3h1F H6.OJJJJJxJ-M FF``# #0F4B1F(F(FF;/+лO /!(FF0FF 3/*6+ !F0Fh` UF)F0F 7F;i+@@Jh3+`!F@F0+A @ 2Fz`F!zh-=%!F@F-+x/+0F!F*Khv1F(FqF(F'!F0FК0+{ih`;ih`( ;* (F,0+"#@F(2C(FJJ7F#% K` 0(,(  ,(J#N F1h O;`q#03 h0<` h"(1h Fq O0JJpOaF@ FOb!l FkNNSs"Bl#` #X0`#nմ0!#r F|Ax!4`p FT#3` Jp FFKEd"h`Kh`chECli  @% CC@EpJJFF FFgI+F"F h@lJpF|ElO`i(Obi#Fp@BؿLDx B\B;J0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB FJ JpF JFh FX Jh1 LJ$h&DB HO0p*F-(J JJJ{F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5Hz +ч FGCF+hS$+h3)KB# FYCNF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGZGCGFJ-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(FS DdB F*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(FF*KFhFFO4 Fi@ ?1!?F(F! (O4(FM@")F F㊻ #@!F"3`8F3h4 +O!F Hf$dB#$4 H[ #$3`"!FHQ(#JJJJ-E F FF(o8F`h>I (`bsKhb 304P6 C#`b+Н00.+Pb ,0hE%-0B)F'H%H?O2!H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa201)F @ b @D#a JJ3JMJ-M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`({hFO0 FDBF*FFF0FPEѸ0DCCDF !?#?F3F ?(?@Fr"F)F@FBF!0FX(FFF8hhŊTiiCrDh , kCi!Dy Ho8jdB(,FicC)DwJ8iF "!(F4#+pi# F8@ɿ 8`aK>@ p`E PaS`F`F#a#b F "IFS(F8(O0+\.+oOT)F0F0FOq F,!F(J-AFF%NO., ,!F Hx# Ԥa+@5B(F_$J-EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(F^"8(DB5`x +.+)%(J-MChF+FFS + +\н#@FYCF FiBOh B(F8 D0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDDCDF焊@FDCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FA!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch +1+@4OsEOs[EYF Fch +OS SC-F:FO KMLN 2B ahr8 )0Op@|)`FE-QF F:chF +!Or@q+ FREٺ@P ++OsOcSE@EFG(F*F3F )KOp@u)(FE  [b2 FFHBA3QF F BF*ch +Or@q+ FZEٻ ++OsOc[E@FEHJK 2B Aƀ  a c B x8 8, cCsЦO;h+ኢi#VOs @B u;e-@Ȁ0F0@ #DYC:F83B`E^DecD5CwM*h㊘BK2F9F(h1*h㊘B>D QhhB ` Q` CBubh *Os@q* FE &5F;O1@ 8`(UMHeO0  cBs FV⊐B:F0D ^⊐BcVDD+^7+K9Fh(Kh<CB eDDEsAOCFK~QF FkbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOuJJcu1%)F F'(5ch ++ ]-:㊦if3DcKhB+aH QF Fbh *Os@q* FB?QF F)FFQF FEFRK&iFFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@sJJi?3#?@3 N ?x"0`$?H-"F! (#O53`(FF"IpJF(" I6A("IR9(J JJmJqJiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Fd(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@FA#41CFF+#{@F#z.#>F;"0F!#{!0Fn#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF2FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0FR8o EF;/+\+ci *$I0Fȹ#hZj"[jc`#3#a+x+* I+x+o F(<XE8XF<FF0FP<1SEBFQF0Fw(iz!F F|JJpF Fv F@(F<~ ix p<1B1F(Fp(-MFO F }Q 2OC[PB_&lF5FO "! F#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "ii= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFF F)o F  " !(F.! F#x .+$A"(F0F +"_#0;I+FRF!F(f!Fi(ROBF A"@F!F+# ݸ 2$Ie EFF 0 +ZDI+FI8Fyhm(8FX|+F I3 Ft L0 ")F0Fj$JJJON-MAhF:F(o0FFziox *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(FfFZFPF F(BF(Fjh *JAF(F(F0##aO[;a*Or *@r F(ЅL#h3H$ FhaFH#hHYh h F H  "  & H@+@JJJkJJ(J0IF@ FiF*)F" F F0 F-@ 0o@FF@ IFxiF8o(F F "9F(FFiF(F("9F(FF"##ii0o @-MTFI@ FF@(K(@A"AF(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?FFXO3ZW!F(FgKgHt * *OrObBUBFF!FL0XHUXF&h  j XF1J1U!FD(F ++OsOcBҢFEv+F!F2[H2/KQFxCE[F!Fб)H(~ ++OsOcBr CFK2 Br2 [DQFh@(FQ + +OsOcBE FKo*o )@=JPJ#"#]FF@ IF!Jw8FqD)F"8F:F8H FE4`(Foo pFp FK(6Or!0F1zaىL1dيD1!X@ &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBHGJGJsFFF.*F F3FF<FpF FF$-L F!0F)`!`F(FW/B F3$!`h*F TFhB*hQh4-EFFrFF+H"8Fv(KB$! F"1F0a#bh|`5%`c``PEEO1FH 0F F ! P#S`` ``` F H`+j(b#`h'F3S/O '7FO E% /+"pFR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i ;1F#*FhF!F F?hJJ-MFFFFF0BQFAF(FFp" F#(FN!L FF[hXE"0BAF(FzF(iB%#S```D`G/ѪhB(FiQ)* J```D`-FhLF4FThBѲhB Mi#0F1~F9F?hM1FH,(F0FI%J-MO FF @!FFF@4! F0 FM(F#aOS#`K`]RFQF(FVYF`(FF*F0FITFX"F0F IMF @>`MH0F F JJܮJJ-MF#F++(i+-@)F*F|IFF(xF0wL F qF(a@x E BR!(S 8F{i GF\  E BRk( h8FG,  "F(@;F2FAFhFe@r#C @F!BR9DKBwDK`{`FFAL*F8F@I `BF8F BF@PFGF$ ZFJ#8Fh;,,(f LFbL!-?whW#8F`sJJ ̮JJJF FN0hB@q 2[O3B(jCR! F@!FRBhF\?cE hhBh"Fh1GJ8FF#*F FFF8-AF(F&ULԱ" FIU  F7FxIx+L F"CF!F8FF5a,6>FRZhj8hMLJQ ]pGQK0 FFAF@pG𵅰 FF8%T !T|T,;#0F49F5=FRZhF"-HFQ ]pGQK FFF@pGFFF"F#(FFF:F1F(FFH"F#!F(F F02KhF F1(+IF0i*k+%I#$IF{)abaPbFhKhfK`x KM`#ao)FjGFOek"Fo#FGFDJܮJJJ0F1(FFB##I(FF!#i++I-F0k{%(FkGF) F#!IܮJ#O>Kh]J-AFFF##F F&IqF%#i++ M F(FKhBѧ#ji`&!1F "j (#j2FAFhiej` + F[(F!H##bܮJJFJ8OqJ F J KD Jh MBb Jb 2bbc H(F F8TJJGJGJ(HJxJp#"IH$p !0J R02F I vF pF2F(F!F/缭JJ JFFQa!!F@i``a" FIFdF60 /١A+ء72*# (` bJshF F hF KB ;B  hTH `+`2F!hpH 0$B 0PB` 04HX"K`aJPHJKpJ8Fa44 (` 8TB  F|, l!h!H!Ku ]JPHJ-AFO FF~ha #sC JIhBXBa Hjh +pB@+x+t1+R#?J]@J@J>J@J@J>J>J>J>J>J>J>J>J>J>JY@JY@JY@JY@J>JK@J>JG@J,H(:0(s1+?nR#O@JO@JO@JO@JO@JU@JU@JU@JU@J>J>J>J>J>J>J>JY@JY@JY@JY@J>JK@J>JG@J~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3VsiHG96h2#JGJJ HJ8F F# M+x F$" IBK,ph<@% F8LLJJGJ@ pF F-@,> MNz)xA F "L FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@LJJGJ/@?H(6 "*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F3"Ixx.C#*0FIDEF0F/I=-BD0FIby#yIC#yCCyCbD#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (F!S+-)++x+++++|++3+++++++"++"yymIC#cy"y(FRayyy"yC#B"eI"dIcK cz"za{B"zzBB#{&|C#{BbCC{(FCcVI#b|.*0 ,QIQI0F|D* R,KIKI0F5Wcy"yHIw$0GI+4' './D0F/3IBDє$ >Izyayy"yfzC#$zB"(F7I&yy"y`y!zdzC#A!B"/Im"`(F+I.%*J*O#D0Fz(I5-:FDxx$IG'{D(FJ#9D(FIJJrJc6JJJJJJJtJJJJJ6JJJJJ:JOJJhJZJaJ 6JrIsH#y*FqIF!S+ՀU"")0+g+!y`yyy*gA!AAAb(0XI"AFcy"yB"yyBBMIBb(FSA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*Ixx.C#*?0F$IDEF0F/I=-BDxx A!9HFHxx!B":"3F@(FJfD0Fi!dJJfJJmJJJJrJc6JJMJpFmhF/%,&s bB#x+cx+ #phFF F mpkxxC#D!F[F})F FFO F88F F0)F FFA F8F# FVF5 FF F9( FsF!FF0"F#eHpJ0KF˄ K!Fhp I(F(FJz0H0JJ1J.J9J-AF$FB!(F%JV1F(F(F !F(F8##4O"FK1F(F CF!F(F CF!F J(F CFAF8Fi!F(FZJjJjJF} FF!OrF=]#KB-e^c+((FZF#*jh jhD@QB8F2hBL1`R F }h`F)F H L(F[)F HF(HHJYJ|JJ8 FFtmm h#c`$ F8LLpFF,m<## FpL8 FF"!ki#+iphph#qkhcq+hq8Fn F@:F F i@i-MFF#FL00*"1FhO10FpF0\+y/yhREHj1 )DF(𭀄F:@h /-LXFh/# XF(W%e F F%=FXF[n0F1FB(FFx.+0F1FB(F9.FCEF)/*(F)FB0F&  XF l( FH "#XF#)%#XFI#e$JTJWJZJJ8F(lph$d(F F8$8Fl FH8)Fh(-AFFFFp"8F/I(Xh/!8FSGQ,H2BOAA2mH0R ۲BL` FPO1@FL0nFAFO2b9F F F F0FF`BBLLLL眭J p FFFHA:m;m& hlAHp+h1F0h#L(*`1B2 HHH8 FF(FhF he`(F8MpF FF2F)F FF FpF2F)F FFN FpsFmFF[Rn ##f e ??iFHpeHpFFF2F+F FF Fp-MFFH (FhGFm #x+cx+ FWF,&'O O #x+cx+ HthGxxE%-=(FF(*F!gBFhGF@F- FFhG^J"# F#F# ` 8F Fx)F F 8FF !FF`#O2#KGa`aa ` HKdJ JhB pGBh pGHJ8F F?TH8JhBЫBћh#`H hHJ F$9H5H)Hp FFHp-,H, 8FFH8H-AFFF.3h/L, `O LKrEр0` F / iAE0E$FE+hij HJ-MFF;C>T@FOEFH @<RE-=5B  0F^F"h< HJ-EFFFM3+'_H\@<SENH"AFFXc|"|B"3B2: Hh8FG/(FHJpF%iBp#S```E`{pF%hBp#S``hh`E`S````cF& ,jB F# FS``&`f`M-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! F(׀"!F0ia#`Ocz%z'GE%z'DEEzEe%DB:! F(AF ha(_Д,0- .C#+j`(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1@5=F0+++ji FB+jiR+ O1F @   O 2Lhthi n(FkV*L*L ;P+'L FHO`@```by#y C#Esj ubC B* (F8(F(F0LRFYF0h J`;`x``PhS````#  HJpF FZ)FFF0F 8(];((  p FFFq F H;h#z HT_BrH0Fh(-h -EFFF A0F R$HhBظFHFZ_UE8FhxhB+iB٧9FhiF+H*ihi?!8Dna@FF(kiD -h -AFFF F0 HT_B@Fh+iBjiC;R#P-(F3hFB0`vHF)F4`l -h-E FFFE F VH+h#MHF&XE+hB .`?H 6D%i;&FEp4FBsachg`<`{`` c6 FVO3c8(F9H$h1BB?/(F1H,=O 2O3YBRBUEAE*ѥhhB&jjjjBBLje#S``#`C`FhXEM,hB jH" I j F $hHJHJsJ pJ\J7@u RCOC BR o j0-MFCKFB}.{(O^O2@(f(qO<9HhB8Hh)E-EU$AE| .NMQ(F'-)F F"HKF`HKF`GK9F`FB.*@DE-;FOE4#B_F:hD*k%@@:i@Dh8Ka=X6J7KFb6Kb9F Fh3(2)Di;1 FG$hBiBR$dH "Hh!OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33JJJpJJxJJJJJ(xCK`O0HJ;M,h,nvF(fF(a3N#2J3I3HF(QF-I.H,-KB/"###%J%I#(HF(8FFF`F@GF FFF;!0F p H #" IC HF( H ,` FHJJJJJ(JJFO1FFFP0@O2!F+F!J IO2p JFF&%DB? (.(I`_#&;+0Fp))H W(JJ$FFF KB 8](@83%0#%0@4J Fh<4@x pFFW>=65OCe FpF(B$O4 F9<4@I @x7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFF#(F"F;F1FF#h#`(FFFFF,#"F1F;F(FF FLpF FF2F)F F_F Fp FFFFq &L F!F3F*F8FFx#%1J 0p 000+J+F+I,H PF(F $J+F$I%HF(9ѝ 0NC 2F+F"IHF  0C IC 2F+F"HFh 2F+FI H~F Fp H JJVJlJJJJJ-AMFF$FO20F)hUX"8Fih 0( #h4,  8J-AOFFBFFFKB(hFh+FBF9F0F( F#+`$ FDF8M,h4+hiDBch[  3+*"h2D# F8@J0 "! F M!FO2(`6"+ha!#FE@ J F@F!J HF F0UbEfiVaJ%JJ`L#h3 H H#z ! Jch h{"(HHJJJJ#-M`O1 7F(qFDF'; EJ٫:F 0F"F 1F)JFB0@(FAF0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 𵋰"kF :F LH v"#)Fv H(#BB(F F @J3J-E2CFF0H /H.I.KBB"i)F :fiQB#iDB  O18FFF+hS "9FPFs##QF28F[9FH  QF8F@"PF I <kh+h3D&aJUbEfiVa}JdJO1 F(H fHO2#!F#H"#F(#*s H H F iBBH FQ(J 3JJaJ-MFD0FFF GL F*)л+S**#*"9FPF@F$@ѻиv QF8F[FUsih)3)L&& !- 2K,++hBFQF8FF"[FLLNih1CЍAE .(F1,z?vxrpFF++(#J##J# FpLLJKFcKScKcKd:xJJJJJ/0@5H 6#FFF@JFKh)K#!"#JK!#JH(FH FJ%JJF FFFK*F$! F0$":`(hgO FL-M, L @ FiB;؄iB6ؼ7'#\E2"C h  `24 B73DP@P@@@ @+HH 0#F Fm++i+% %#i FbiFF F0%LL-MFFFLX **  *@݁.ҁ#' .ɁV&RF[F@FAF( F &&E@𥁭:B B  B w \ B #%F\3FB0/DDM@n:Bi Bb  BZO w \`cEP %F<CS0CN;B  /DDM@*:B% B  BO w \`cE  K%F<O[C#0C.;B  /DD&@P:B܀ YBՀ BЀYDBˀ.ƀs# \BKC #& && ."J  C   37BD3+D.R0#@C#@#@c#B0OK o#o#@;!-6Ъkѭ :Bc B] BY)U O \ wSELGC! !!%F )ђVxxFpp20E  DD) h 6SO0O  _LLLJ$F.R&KJWJJmJ.R&{J_JuJuJ-M (_h FF3+Kx! F8(H (KF F%Ix("H !J(a JeaJ$!"bPbb". "eeh'cѺ#OccK@<sO@Chd#bc#OxAccOc##d J ̭JJJJJ?  8ooQ(F F8@k-MFFv! F#F(1F(F/zEF(nXFRImF(h#F#FF(]AFPFE g@F_{h;;lBK#" fg;K"o$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?c F!F0FB8F $/`s FIFFYO3F*F FUpnJ-AF FF8#x/+6BF/! F (FF!F8FF88F(DFFBBРF04/+/!@F (F4F)FBF8FL(F%o8FF F !FF(F8@8FF F !FF(F8@-MFFFFۻoF$%F&F{TE;2F=I]/):BۚBȿ"DB!F@FF(Ы[Ex/"6]TTE B"-ȿ5zU!F@F^ao#"Fo -AF FFF0,O8@F!o BoBFB3`B8F&J Fo "(]o pF F)F Fp@#:pK3pFF"O1(F(F Fp!F(FzB"!Fo-AFF FF FB BF!F8F Ah*F! F u 4-D s9FF%B(Fp F1 0DB5o-EFF8F z%FDEO5 F 0 EذBTF52F9F F ((FoFF0 +`$ FDB-O3 F1 fC#DB-o-(`F?FJ "FUF JpF FF (!F"(F(F2F!F(FC( Fp-A#)F Fo FF(shB0F+('F%F0FAFs+C' (o 8(<S JJJ7JױJױJױJױJJ-o 5"-AF0Fx++睱= kFAF0F(Fo o  @*B*F D#Fpo-AFFFF B(F W"F9F*F0FF Fo#F CF FLF(  K@BS K(FpGHpGHpGHpGJJJJi'+لhD$Bh"DB jBh XB   8F(ei++ bj! FH_OSca8o o Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤ 8 oopFFF`hh  ``ppFFFPkjDjbhD`p-A FiF (D(F O S#ah2F )D6? `fbh*j )D `+j#b-M(FFFG [@Fh N6!j&DBFF 0FF&-Jۡh QD!D#" F 3FPV@F *#j;#bFkh%j -)D F!D8F("jD"bpFAFc&O@q0-`0?`0_`RF*F-MF FFFع(F3.i"F6#(F#FXQ#?O` F-AFFiF(F B 6#F(F)DA"O4 F-AF FFF8)F@FF  F0F 2F)F@F#"F(1F(Fz-AFFFFz`BF9F0FF-CЈ0F#" ($l` 3 `BF#F9F0FF3FF(&2F)F FpsF FF2)F2F FeF9"# F 2{p-MF FFF(;CFRF)F F(6C1)F F FYF8(٥h-]Df'"1F FGOscQ4F:F FBFQF F4OsXF>Ds`opFFFF "FF1F(Fp@pFF1F Fo( ۣh F!Dp@#p-MF FF/0Fsi +O tj$"FYF0Fr:F)F0FFOSka?kbo` #0F (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(F K?+`OSkaOSo`ai$a 8F3F FwcjB!F Fh"jDc`(F88+ h+o F]o JC o JJC 6J𵅰FFFF{+hbo :F1F(F$aFFopFFJF FC+3F!F(FJC+!F(F(F p2F!F(F(!F(F|JvJ-MFFFFd(F F(FP!)F F  Fo  F1F Fh HF Z(0"   :D F K# 1FF FF( CE)F F")F F1FF FCF(;F*F FF()F Fu-AFF$FFAF8FJ`+ohZЫkFAF8FJFXF0F6( 3o0F-,`J J-AFFFFFF(F AF(F(F !F(F#FA1(9F0Ff(!F(F"!F(F9FFF0FBF9F0F\C(F#F*F0F(!F(Fo -MF Fs3(Fl,0F 4F(DF (F(@(FI +g2(FIF`1!(F(Fր!(FJ!0FJCF!0FJbF/РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGKHJ(ܠa+ 8pGBpG3Z*pGKHJpF$B 5`104.pO1P0@91?"?+pGpF8FF,F Fp2F!F}-AFFFF*O1F8F$BDEd`O@9FEDF]#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@Bр3`3+?#`o0$H5B0 ]C@#Oh@@; 4 F0M\B0K$5@`@JF FF @" F F +h$ FphF F"!0F7#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#``;a3h 33`-AK xF*FF'h1F F,a0F#Z`8F1F F,a F0D7fJFhUF F@¿"hFF"!F F##p#pcp&p``#(FI+a q (F I q#cqcrrr#shh3bx;hD;`nJfJhFF"!F F"#bpp'#pp I``+a(FlI q(F`q@*i (FI]o|rC t!#"r#u!# r!sbsss"tbtauuuhh Dbx3hD3`(FI7`q(JJ{JtJhFF"!F F.##p#pcp'p``#(FI+aN q (FI q(FIB`q (FI`q"(FI(Iq(F0#cr # rcshh3bx3hD3`nJfJJJJJ-AF0HFF$4h"!F F##p#pcp'p``#(F$I+a q (F!I q(F I`q (FI`q"(FIqAF(F"qAF8(FII`v(Fvhh3bx3hD3`(F IqGJnJfJJJJJJNJhFF2"F F!d##p0#pcp'p``#+a#cq#(FqIAIq(F<##v#cvO3vv#wcwwwy t(0#)0hh3bx3hD3`fJ-MO6v {#*IlF%FF"4$! F .3#0F)F[;GoEF/D$" FI:%#"0FIeq-!a0F)F`u F q=FJJJJp KF[m$0FfFU?dӱ#јG&F熱0F 2FF IE"FH` FpFI8JJJsF p%.F F(.x.+@%#x46.( FsFNM| F#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PFch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FHFT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3F J-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N8>DD@k@3DNjsc N>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ-EFia(CiF$3CaCiTsFCa@ TE"FEqRFn9F(Fs@8"!(F#i)F#eci Fce1!F"0F# Fp@X"!!7-AFK3)Cc3#FF3EBiF8F.FE(FF!F2FhFW4D#Eg#`C` K`3`)Cca3CaKapG#Eg-M";3xRxC#xCCxCcRyyC#yCCyCc RzzC#zCCzCcR{{C#{CC{CcR||C#|CC|Cc R}}C#}CC}CcR~~C#~CC~CcRC#CCCc! 0C#" CC# Cc% $0C#& CC' Cc ) (0C#* CC+ Cc,0- C#. CC/ Cc1 00C#2 CC3 Cc 5 40C#6 CC7 Cc9 80C#: CC; Cc= <0C#> CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@NIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3ܿ-EhF?`(ChF(3F(C`@ ERFf@<"AF(FLL=Ll;<L,:LL9Ll78L,6LL5Ll34L,2LL1Ll/0 L,.LL-Ll+,L,*LL)Ll'( L,&LL%Ll#$ L,"LL!Ll L,LLLlL,LLLlL,LLLlL,LLLlL,LL Ll  BjL, LL LlL,LLLlL,LLLliO,slKDDjiiDDCih hOs>C^ih H iiDD   KjDDO(ivhD hO~8C h  hX iJ D    JN BD DDO(uhhDbDhOs8  J XD JbD(C DDO,rlDO{<   J h\DDBD<DDDO*rjDK O|>   J ^DL  DDDO(uhDOv8 J XDsD DDDO(shDF Ou8  J XD LDDDO(rhD  E O{<  H\D   D DDO.znDfDKOr> H^D    B  DDDO.snDOv>H^D eDh   D DDO.unDFOs>  /BD7q۵[V9Y?^[1$H ^D    C  DDDO.wnDO{>  H^D  4 D DDO.znDfDKOr> H^D    B  DDDO.unDOv>H^D cDŠD DDO.snD FOu> H ^D DDDO,wlDDE O{<  H\D OLDtL,DON  DO,DzlDDvDKOr< H\D OLwL ,DDON ` DDDO,slDBOv<  H\ D OL FDONsN. DD DO,wlDOu<   H  \DDON(DDOHwH( d  D DDO(whDE O|8  } Ut]rހܛtiGƝ̡ $J XrDD ONL DDOHsH($`    J DD DO(whDOr8XvDD 3F ON B DOHvH(( D   D DO(whDOs8uDJ XD ON  DOHuH( d  D D DO(uhD C O{< H \D OL ONDvN.D 0 K    D H D DO.wnDOu>bD^D OL  DE D ONrN. 4` D   DDO.wnFDgDOz> H^D ;FJOL DDONwN.  8    D DDO.wnDOs>   H ^D OL ONDrN.D  <h C     D DDO.wnDeDO{> H^D o,-tJܩ\ڈvRQ>m1'  OL DD ONuN. @\ D   DDO.wnD  Ow>K^   H D OL D DONwN.  D    DDDO.wnFDgD Oz>G   H^D OL  DONuN.D HX    DDDO.wnD  Ow>J^   H D OL DD ONtN. < DDDO,wl DwD O{   H ^DDOL D8DONxN.D<@D < dD4DDDDO,xlD,D4O|< \C H DDONDDOHvH( D䁆  DD DO(vhD O|8F    J XD ONDDOHzH(DD4@<  DHBIH.DD< H^D OL( DDONxN.D(D<  D( D@DD< H^D 00OL DDD ONuN. <@  DDD@@O.xnD DFOs> H ^D 88OL 0(D,D(ONxN.D0@<0 D  < |DDDDDO.xnDC O{>  H^D OL8 DDONuN.D4D@4 @  D H^D OL D@D ONtN. D8  D tDDD88O.xnDcDBOv> H^D OL D 迢KfpK£Ql$օ5DD ONwN. 8<  DDD< H ^D OL D$DONtN.D<8 @  8 TDDD@@O.xnDC O{>  H^D OL D(DONwN.DD@ H^D OL DDONxN.D8@  @8 4D
 H^D OL DD0DDONxN.D<  <  D@DDO.xnD FOs> H ^D ,,OL 8D4D8ONxN.D     DDDO.xnDC O{>  H^D OL , H^D  OL pjl7LwH'4 9JN DDONxN.D   DDD O.xnDcDBOv> H^D OL ,DD,ONxN.D   L DDDO.xnD FOs> H ^D $$OL DDDONxN.D@ @    DDDO.xnDC O{> H ^bDD ((OL $ D8D ONxN.       DDDO.xnDfDKOr> H^D OL( D<@D@ONxN.D$ $   tDDD O.xnDcDBOv> H^D 00OL DONzND.   D  F DDO.unDOs>H^D D44OL 0$D,D$ONxN.D   \DDDO.{nDbDCOu>H^D OL Oʜ[o.htocxxȄnj4 DDONzN.      pDDDO.xnDfDOr>EH^D OL,D DDBONtN.DD DO.tnDOv> H^DDOLD DOHDzH(DDDO(thDF O~8   hXJ DDhDDi CiiiD j Cj  $ElPxq-EhF?`(ChF(3F(C`@ E(RF@<"AF(F& !p@@BWxqEtF>Dx242O7@&d@gDGE@  aE0ҀIa!O1U`]`BR2B`@B)s&43a8<@ >eEADqD6ٞFED AEcD'aE< QDADeEqDUDED FQEcDB mDϋBqFF-;F =Ox-_p x3pBB{eEADqDٞFED AEѭKx={pxp??ё=13/>OU 9FcF;G '* <LL31IxYp3</#G#FgF?(?LO&aD IMO5&9DI !@J^JtJ-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0JJ<JJi۱$"aBcOBDa`aZab`\``bbbcccfedt Fo8F F*<x1*9<+7o8#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#aoo J J8FiCjkk3"cjikjGj"cjiG a8o-M*FFOD xDOsBE=,DB٤DY!d ЗB#iQFitaDe 0p0jccK#h+{0BuPhk(@U"ij 0(Ghc(@H##`o/;?@D5!/;?@D5,/;?@D5A"i ,`aCJJJJ"j*?9a6"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiaDf##`#i- "BгKh"j*Sb/?R+?@D5%.F"j*@#b"#jc"FFa4 #/?4;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`y+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=~vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZF  D[D#l #d1/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?c+?@D5-Zf7J=2083$ nB 0JC+cfd#ce##`%' J-M FFFFO F4khB"K`#F +h S 0+ :F@FIhG0 F+hSD33`4 J-MFFL E6ah)8!'OC#hFY-hIЩB(%ah0F97FKBchB##h S 0YP-=F-XFQh(+7Ѹ4h h"8DAF0GP# gJ`` F#hBFYFh####h;Dh#h@F`#h;Dh ##h;D30F`B>XFQh(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDhG#h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03` h8D01 hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4 J-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(F J-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% t}iD 8?C[E \+ 5aD}h{a5#Fhh"F!0FZ!O= O\;iB # F3p!F hF`(яChh:sцP/Rh:oFFF1F^E\.уCFxk-JKJ J-MF;mFO # FF` "K` :PNF "K1F"F?#+U;m.#RFymh5l:m`C0s@0(OpAFP(Fo@F0+<(Fc (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(FBh+ѻhh:mBTPAFl`!h(KHWh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HX0Fh9m(?QHk JJ{JJFF$'khB *hX+40G(FFKJKF(F)F0FJaFGB);F J0WDBؿ$p)J0DK0FJJJjJJF F!ǿ"iF iFH_ 3] 6J-M F'<"   $+C C$ C  2K]fF1HM1 : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H!FH1FHJ;J*J.JFJ-MFF@+FFFF@ F$)F F3XRF0F-IB('FO Dj  E #D0B2#.&}C!LB."P3kDH,Ie-0K*00FIVDD  - 00۲ +0 0;xg\ p32o6JJ?JNJ-M=kF@+FFFF@ xF%1F rF3O {`-kFzh УF`h2FQF@F#FF8`hR 3;hDD8o 7F , F-A FFFB(F7GE(GF!F:F(FjзB!eE!F pPB=D5ӬE4  3eEO 7003 ` A0þO00#0`F6lF&`kBp`k6l4DE(O2RE  *F!F( #*FG0$ F "p@Bdp FFF 2F)FH, FpJ#FF F "czh DB hD2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`xJJJJJ7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpFJO2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0FB#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80F,F F8!FGF0F+BLB_-F08hF=(F#; `(F8BFًB F FDBF9DB xO3FDBFx3B-AFFFQF FLFB$2F9F F=( FDɲB FKBF"FFB\2زMOzrF33&hF.Ozs!pF%% JA*FF LbBOr4 !D @0 p4ׂCpFN/B%F(5F(Fdp0X#"LM\+$* 0* %-9KBKA2c\D;#J! pG-MF FF(n  .I1F(F"  F1FXF"@ PF1F@F@" 8F!"@ "! "  !(F"  F!XF" PF!@F}o-MF"F FhFIj0F"IeKnFOOFO*zO- s] F 9F*J44-$J4J5Jc6JFF=(D@nF%65-F ѽ0"[ CC[00iF?C F0 p0 FFhF*F!FhF0FhC3SCC`pGHWJK`pGWJ #FFFQ 7F &3  % 01p9D9D[P 3F03SpTѐ #KC 0pXC 303p 01Pq-MFO '6M7N FEO | ӽM(FF  O O @  'HA A" OC O8 < "O,"02,ZD ZDbDO,"02, " @   " 0 0002  F,#GGŧ-M!F@ F O  &>+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p3 J-AF*K*FFF  F'B<"pB "B0Bp;2B+Bȿ#D#F !!F$(CD? B B"p7B8p<3JF%KF*FFF0FoF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2J-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p|$L-+G0+gУ0 *M FO F;0 .[ x.+kKxN0 *_1F# F+0 O#s1xz)]g)^L)W62xx*b*j%*X*WE<%#;p3x|+E{pDFsxq++Э +#+*+UDDDD@D30O8"0*+U;FO3#Z)O1HhҲ l)pxl(L!6Fc:*P"VJYJUJUJUJUJYJUJUJUJUJoYJYJwWJUJUJWWJUJYJUJUJYJBF;F !SE8p3:*ܸ3ؿODؿ#DWE8U;8;p !#FGD* ܸ3ؿ#D'F6SE8p3l)U+QF48FCFFl)FQ+qxFU)I)M)RD) и? OD D! i)tm)@a)O hDa#QF8F#B4QFCF8FFFF(FQFCF8FF(FB_JIsx\3FRFD@"@ OF    I* O:2p2*"$@ p4 CFND@x$@4)w; F F <9)E"*T  FO.xl* B*L*""(F s*(FHF"4CFQF8FS"J~J"0I do  F+h t)ѫF[+5%Fih[+8F FQF]FFF![+F[[*E1J FbB ` F S+S]pGF FoAHR]pGmF FhFOaFhFH F mQ ]pG#F M Oku5 F !#F$01 +.FO0FJ" Kt J]Fs] sJ~JK\D C9(Կ08W8pGOppGJpx0+CxL\D۲x+"0F%&F0xB `(Fp*"* "J"ѿ "ο#`FFFFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`JxF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1AJ8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8JpFF)KB J \@Fl;]v `!p@)B!`O0pJ"տ!xFF#Fy"?'_xe!F#x FI&0F -FpF%@ F0D5BFh0 F@+-EFo9K5b2$d!@F8F)Oq@F0!Կ''@mD K :S*0!DhD a'O0QȵJ-EF&O8 jD# uB ci+#kHh#CЩh@F!Dl #BB!@Dj(??1!?g6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? 66i)D -AyF+ѽA&iDFBܠi*i "ih@F!D(ijiB!@Dii(??1!?6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? 6+Bۨi!i)D&('KhFBH/ +H ELFJJ#J`J`J`J`KJ#?`pGxJJ|JtJeJhJ-M KFhFF0F@I"42TO &F! apppqqRFIfq c2F ZRFAFT 2FLKhMҿhJJJp N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`JJJ|JJFJJKhP A1JhB  L#h3+#` H#"#`K``JpJlJpJJ-M*F FF")FOHMR xJxC#(ыxxC#+"ёOy/ 0 :FQF B ѣyyC#г6@0F[#q#qFBFF4:F!FPFBFF&I:FYF F|F51F*Ft)F8FMO;h+"cKhSEN0h"AFT#MFFRF FLG"AF(hD!h(h#;`#`3`JJJJ|JxJPJtJKh8 pGJ-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H(b"!9Hc(\^##p#'cp#5Hpp'qF(Z(Ra#cq#qq:F0F4)H)K'F(FF@Fg<#;FFAF`p8F7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH4;J`JJJJ-AFFB!x)ѽ)ex3C)[2))@5,D3+R#eJfJdJ fJ3fJ3fJ3fJdJdJ3fJ3fJ3fJ3fJ3fJ3fJdJfJ)zS!;fJeJ3fJeJ3fJ3fJeJ3fJ3fJ3fJ3fJ3fJeJ3fJ3fJdJ3fJeJ)"+H")H"(H- #*F%I&Hp':F$H#"JU/F?-@#*FIH\?':FH#J/F"HxKpi"HK_O*F8FUH2QO5NJJJJJJJJJJJJJJ"sF1F KB#MEq+p+x1Fl+xl,p@pcScJ-MD)F8C+Ѹx+Cx+уx+ F"EKh#JBR[Bk3:F/zKBx*5*Kћx+ F")F#")FnH"mKmHhD lKx l4 F@hKx+Ob!FfHeI xdH;QF"cH#3`aKh^IF_H_!F)M 3Zx2DWHM"TIF( "QF+?yLN7h/?}/?q/ FAFO FjA0BI@)F@R FC=IOb F#D#wcw#0JwFwh25J R$ "% 4BFo#&IF8h"IBF \BFQFW!J9Fhp-D# FC"O1i)D$J(JcScJJJJJJJJJIJuJJJPJ}kJJMbJ K`K`"K`K`$J JJJ-M$cOcH<`(!F_K`_K`Hh%1``@@R! FYIOb F\O #VJDwwFhvQJ R$ "% ("","0"4#FAF8":IK+F*FQFpf 0FC# (FCC Cc#*K-h*1 "@F$Kh;H#P " WC" FD#O1sKIh#H;`)DF`PIH"P2`JJJPJ JJJJMbJJ(J$JJ}kJfJKhKhBH@Ƽ J Ih@oOcFF`@@JJJJ}kJ( (] 8FF#h FkiG"!(w 88Fj !F`hP0ahH3o8+y+ F8@IuJJFCl hki㱀l1 FyByCyCyCzCBzC#h FkiG&ah@H(ah@H J2JFF(F#3`3qFIF"lF(MBI"lF(E+hki+SO Fp $oos( D,#H Fp!H F(4F(/$[lH}HZhlw.BHpK[lD&+H^ o%JJbgJJJ#` "FF(opFF FF)F jhBi}+}}C#}8A! H[IhGJJJWJWJJdJdJKOsB @s@ B   pG pGWJpKFOsBdO @tFf"Ia@s rBӲ" +sjspo~)s!ds$ iss+tjtWJJ8F"F:"I5b{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuJE"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! FNr rJFFB"w"JFh!4{rd+uu#",v$kuulvvvJ-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F 4$K`K`K`K`(K`7 F O0oPJJJJxJtJlJpJ$$) x"+219:*K? "+#ppG;:!H8 J(()) + #@J?O( KhcH Kh#HKh H"IH(CF(H^ H H JJJJJJDJJJJJ H<" K` (H."K @:WJJ=J("`K-M`#"t]O0;`p\KF`%VN#3`0(FWp(o F#;`IK`-3+; #CL3`[?( >K`";Ko`~8H#3` "4K`G"0K`)"hb&Jh)JhB"h#`G0+0++!+0L="hbFHu!hHKHh --R$h!o?JJJJLJHJJ\JXJJ[JJTJcJJ JqJ-AHF FF:!@FDF@Fop8`*Fq F# ,D<(*FIJFCF#IҲ]Jhx0; +!z@@pOpFK WJFK WJ"K`J$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fh%!J!ueu[v#vuu%vevyK6`uK u(F` K`@JJ~JPJJJJJtJlJpJ-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! Fr r%uuuu uFFD9F2F1F(FMJJJ LhFp RhF!h8K"h` K`dO0 JJJKKKNh2h:*S]jSSwOrRAI F?H0D F=I=I}K?HhY>H=K F`"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0xGBMvl BGRshCdEiDeFfFgGhHiIjJkK dJhNfKhLcNjP lRePdM!mRhSbR!iTcS"jUdT#kV`U)lW mX!cX,iY(dW5kZ*`Y2l\+m\,n^.c[<p_/k_4_\Ala6a_Cnb7oc8caE_aHqe:mg@bcQ]cTnhAoiBpjB`fVqkDagXmkHomI^i[^hapmQ`jcroS\kfsqTnqX_nipsY[nqru[sv\_ruux^Zswqya\s~rzbs{cYut|du}f[wv}mr}o]ysqYytrus[{wurw]}Y}ywtyYuz[Ww}xy~zZuVvWwxXyZz{UvXxy^YUz{VX}yTzU{l|W}XSyTU{V|}Q~SnTZZUV{WX}YX~^Z[\b|h}]~^d_`fagh~hci~jukdllqmnopqrstuvwxyxzz{|}~GGAA<'<9-:6373930?0.C.,H,*J*(O('R'&U%$X$"Z"!^!a%W~zR:C>1 %\g4 Tr> *k~W%#Q u1Hw6 8f 6 B f1禠f(akfff4ypfBfm6GurR  N fmOL4% %  %%fm%ttH; 8Q*fm> Z*YO #BmGfm U1WW #CQ1f]]i@rk%GJ #Cf YG #0#C f *fNC #C foopJ#kZY\UTooo:#C fmE   #C fm; ( #C fm* EܕE 4UtL#C fmk'#C f(*>~'#C f #' #C c 5(LQ6 g% %ȵGH       Ae|xe=.   < d j 8Ogz ԼygL50M F;]#༂Z8* j_Ew/r@& eb U9ԋO" MD>zAt6 ;G; eX5Mz* WSQ =Wp _\ s`k cH>%g s jEoB[ m3 o  q ;Xs L#u \4<w kBSy\ ]5Py N%9{ ;:  ͺ Ӻ % ᶶǩʤΫج׻ z    ө׫  ͫ  rE8׫ڬ %.^ƯVS 㺞 ڭΥ H K     ס  ` K ڞ     k  ?}}  c  Z1c L  u>*      6   HU*  Y0/   i@9  #  c8"     p  Q%      BDʬ ׷ é ׫׬#  ) שᶻ﬽ ͫͫ ج# RS ӫӺ 㺩ʬΩз ( l   kC} ig *g*xd]e`F\X#x{gSo+ HMBe^ QHW  | RAL# 4p:g*& sn *Z1ʬ(9 = 0Q%Ƭ(7db3 s ö '  S '=F2}'=)2X'=1+&=A0x'=n.'= s,&'>K)j(? s*KQ&)N(aԻ2*~|zxvutqomjhfc a!^!"["$X$%V%'R'(P(*L*,H,.C.0>13936369-9<%<AAI II`JYJ[JbJ]JmYJ-cJA^JU\J^J_JbJ]J1YJJJJJJJJJJJJJJJJJJ JJJ!J(J/J6J=JDJKJRJYJaJiJqJ1JdJlJ?JR~JJKJR1=C.)DJJJJJgJVJ5JVJVJJVJVJVJVJVJVJVJVJVJVJVJ\JVJcJVJVJVJVJVJVJsJJJ J9JNJaJqJ{JJJJ,lJyhJ5lJyhJ>lJ<JC<J<JC<JC<JC<J<JIJJJJJJJJ8.J.JαJӱJJӱJJӱJJӱJJӱJJӱJJӱJϱJӱJJӱJ-J=JMJ]JmJ}JJJJJ GJJ}JQ*JJ)+J)J*Ji)J)J(JJ @ @@"J+JfJJJnJJ)JJNJJJJOJJ6J JyJJ/J'J'J+JJ(", *$.)#-!+%/`%(JJ$JDJDJJJJJ![NYd9ir; VJUJWJVJVJVJVJVJoVJOVJ5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +ީB#8JzЀQjNYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣyk!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcImJmJmnJeJaeJ-eJeJ!fJfJdJdJqkJ)lJjJlJUjJ'hUh=OtUR1hJ2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bJJ˂JmJ-JJpJJ8(HJ@ @ "JWJ'@BJJJJJJJ+J=JNJaJvJJJJJJJJ,J,J,J,JJ,J,J,J-JPJYJJ]JJJ1ZJAZJJYJYJYJYJ@x}uu@x}e TJJJR JsJ~JoJVJvJJOJJJ @J,J)J?JAJJAJAJ AJAJAJJJ}AJ5\JͅJ7J@Jq@JAJJEJAJu@J AJ Ju@Ju@Ju@JCJ@JJ@JAJ-@JY@JAJCBJ BJAJAJAJCJ@JeBJu@JCJAJu@J@JAJAJ@JAJJJJ#JJ J JJ,JJ J 'J .J6JJAJOJVJbJuJJJJ1JJAJJRJJdJQJJݙJĸJ UDJJjDJ\J~DJhJDJJ DJJ DJ JDJ <JEJJ/J.J,JJ`ppp@@@@@@@@@;Zx0NJJJՠJJ1J JJJJJJJJJJJJJJJJJFJQJhJ~JJJJˤJޤJJJJ"JUJ]JfJzJJ_J^J3_J^Ji_J]JJy7Jx7J'J|7J m7J t7J e7J 7J i7J~7JJfJM3JfJ$JJe7J'Ji7J|7Jm7Jq7Jt7Jx7J{7J~7J7J7J7J3Dh&'J J2JNJHJ HJ HJ HJ HJ IJdJIJ?EJ+EJEEJ `EJ yEJ EJ EJ EJEJFJGJ GJ GJ  HJ &HJ BHJ^HJEJnHJHJ{FJHJHJHJHJxGJ ?xGJ ?GJGJ`FJEJ {FJ EJ GJ #GJ FJ0GJFJLGJhGJ GJ`FJoFJ {FJ EJ FJ FJ FJFJFJFJFJGJ EJ EJ FJ 3FJ EJEJEFJEJ<)\b( ` X<l@H<<P,3/*( P`<.dE@ P<#0<4 "n(P<-M@p8<NDX$,<^YP0  @ @`00P]`FC=݋#JJJJ J0J<JNJ^JpJpJpJ1--'?MJJ9JWQJJJiJJ%JJJJ @@??>= ; 98631/,)!'#$&!)+.03579 ; >>@@AB\J@JxJJJJJXJ̭JtJJJJJ!JJ<JJXJJtJJJpJJJɮJJJJ@@??>=; 9 7631/,)'!$$!'),/1367 9 ;=>??@JJJǚJߚJJJ&J@JBJJZJJJm8J18J9J6JJJJϧJJJJ2JLJdJ}JJ3J3J0JJ\JRJmRJcRJQRJRJJSJQJQJŰJҰJJJ TJdJlJLJJ4JMJ3JJՈJ(s*K>;;Jk"J}JHJ'J5WJN,JO1J'2J&8JBJ]IJQJfXJJJJJaJJJ JJJ J$J)J4J?JDJIJPJ\JbJjJrJzJrJ~JJ fJJ JJ JJJJJJJJJJJJJJJJJJJ!J(J.JJJOJvJ2JJ8JJ=JJBJJFJJJJJJJJJ)J>J,JSJYJ`JgJkJtJzJJJJJXJJJJJJJJ2JJJJOJTJXJ_JJlJJJ JJ!JJ5JJJJ'J/JJEJRJ`J JJ JJ&JJ%JJJJ JJ $J.JEJNJgJoJvJ}JJJ#JJJJ JJJJ8JCJXJbJpJ}JJJJJJJJJJJ%J1JJJTJsJxJJJ JJ!JJ"JJ$-J7J'WJ]J(oJzJ)JJ*JJ+JJ,J JJJ JօJJ߇J^J]J JUJ J]J JMJ JJJL@ #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.BootCurrentBootNext1234567PlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      'hUh=OtUR1h ) @u-boot*EHCI Host Controller  * +,;=[]__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_devicessunxi_set_gatephy_device_createsunxi_set_reset_ehci_create_int_queuefs_devreadefi_free_poolefi_runtime_relocateefi_free_pagesfdt_find_or_add_subnode(((((AAAAAABBBBBB(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32CACHE: Misaligned operation at range [%08lx, %08lx] eGON.BT0TOC0.GLHUnknown boot source %d CPU: Allwinner A10 (SUN4I) SPLsunxi SPL version mismatch: expected %u, got %u ethernet%dethaddreth%daddrserial#%08x%08xfel_bootedfel_scriptaddrmmc_bootdevfdtfileRamdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Loadable(s) is corrupt or invalid verify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) ## Failed to initialize UEFI sub-system: r = %lu ## Failed to install device tree: r = %lu ## Transferring control to EFI (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./bootmlocalcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rsocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%spxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... loadablesThe given image format is not supported (corrupt?) %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkdhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-stdextlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe%s/%sboardver%s/%s%s%s%s.dtbefi/boot/bootarm.efiPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootefi %lxbootefi %lx %lx/dtb/dtb/currentbootmeth_efiu-boot,distro-efi#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2024.01+dfsg-5+b2u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernetlocal-mac-addressdisabledrangesokayfailInvalid fdt status: %x framebuffer@%llxheightstrideformat/__symbols__failed on fdt_overlay_apply(): %s base fdt does not have a /__symbols__ node make sure you've compiled with -@ The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Unsupported %s address size descriptiondatadata-offsetdata-positiondata-sizealgo%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable hashHashsignatureSign%s Description: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Corrupted or truncated treeCan't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash valueCan't get hash algo propertyuboot-ignore-skipped + error! %s for '%s' hash node in '%s' image node Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): unknown## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Could not find configuration node Using '%s' configuration Could not find subimage node type '%s' Trying '%s' %s subimage Verifying Hash Integrity ... No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into vbecompatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s aslr-moveaslr-randefi-runtime-randrandom-randarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetVersion: %s Vernum: %x/%xvbe_simplefwupd,vbe-simplecur-versioncur-vernumU-Boot bootloader-versionfwupd## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX poweroffPerform POWEROFF of the devicePerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order bootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 14.2.0-4) 14.2.0 GNU ld (GNU Binutils for Debian) 2.43.1 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizeVideo%-12s= %s %sactive FB baseFB copy copy sizeFB size%-12s= %dx%dx%d devicetree = %s serial addr width shift clockbdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureERROR: Failed to set watchdog timer ## Application failed, r = %lu ## %ls Failed to remove loadfile2 for initrd ERROR: need device tree ERROR: invalid $fdt_addr or $fdtcontroladdr ERROR: invalid device tree ERROR: Failed to reserve space for FDT ERROR: out of memory ERROR: failed to process device tree ERROR: failed to install device tree Booting %pD Loading image failed Error: Cannot initialize UEFI sub-system, r = %lu bootmgrEFI boot manager: Cannot load any image No UEFI binary known at %s bootefiBoots an EFI payload from memorybootzboot Linux zImage image from memoryclsclear screenList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticuclassfunction: %s, cpu-time: %lld us, frequency: %lld.%02d times/s cyclic_demoRegistering of cyclic_demo failed Registered function "%s" to be executed all %dms cyclicCyclic-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quit## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected readingError %s the chip: %d Content isn't valid EDID. Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32edidloopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %0lx %04xZero length ??? byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l, .q] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmemory write (fill)[.b, .w, .l, .q] address value [count]memory modify (constant address)[.b, .w, .l, .q] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsreth%d : %s %pM %s ping failed; host %s is not alive host %s is alive Could not find device %s Driver does not implement stats dump! %s: %llu rootpathdnsipdomainautoloadNET sub-systemlist - list available devices stats - dump statistics for specified device statspingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocol-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part type : - set environment variable to partition type part set type - set partition type for a device part types - list supported partition table types| %-*.*s| %-*.*s| %s ParentDriverOps get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] -ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-sunxi-sunxidefault-arm-sunxidefault-arm## error: substitution buffer overflow Error compiling regex: %s ## error: pattern buffer overflow: have %d, need %d ## Error: variable "%s" not defined ## error: subst buffer overflow: have %d, need %d fmtgsubCould not set var invalid op setexprset environment variable as the result of eval expression[.b, .w, .l, .s] name [*]value1 [*]value2 - set environment variable 'name' to the result of the evaluated expression specified by . can be &, |, ^, +, -, *, /, % (for strings only + is supported) size argument is only meaningful if value1 and/or value2 are memory addresses (*) setexpr[.b, .w, .l] name [*]value - load a value into a variable setexpr name gsub r s [t] - For each substring matching the regular expression in the string , substitute the string . The result is assigned to . If is not supplied, use the old value of setexpr name sub r s [t] - Just like gsub(), but replace only the first matching substring-pext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr'truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneKeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** Fit image detected... ** Unknown image type ** Bad FIT image format lcdputsprint string on video framebuffer setcursset cursor position within screen in character## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part ## Copying '%s' subimage from FIT image at %08lx ... Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image${Failed to get partition driver count Error insufficient memory gpt_partition_listuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d '%s' is not a number %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: setenvgpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname %s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storageprebootNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! binman_init failed:%d modelModel: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storagedigital signal, analog signal, , blank to black, separate sync, composite sync, sync on green, serration vnon-RGBno Not a valid EDID EDID version: %d.%d Product ID code: %04x Manufacturer: %s MAGOQIVSCSerial number: %08x Manufactured in week: %d year: %d Video input definition: %svoltage level %d%s%s%s%s%s Monitor is %s Maximum visible display size: %d cm x %d cm active offPower management features: %s%s, %s%s, %s%s standbyEstabilished timings: 720x400 70 Hz (VGA 640x400, IBM) 720x400 88 Hz (XGA2) 640x480 60 Hz (VGA) 640x480 67 Hz (Mac II, Apple) 640x480 72 Hz (VESA) 640x480 75 Hz (VESA) 800x600 56 Hz (VESA) 800x600 60 Hz (VESA) 800x600 72 Hz (VESA) 800x600 75 Hz (VESA) 832x624 75 Hz (Mac II) 1024x768 87 Hz Interlaced (8514A) 1024x768 60 Hz (VESA) 1024x768 70 Hz (VESA) 1024x768 75 Hz (VESA) 1280x1024 75 (VESA) 1152x870 75 (Mac II) Standard timings: %dx%d%c %d Hz Monitor serial number: %s Monitor ID: %s Monitor name: %s Monitor range limits, horizontal sync: %d-%d kHz, vertical refresh: %d-%d Hz, max pixel clock: %d MHz %dx%d%c %d Hz (detailed) None Enter choice: usbkbdnulldev%s: warning, ret=%dUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusb_kbdusb-keyboard%.*s%*s stdoutstderrNo input devices available!No output devices available!No error devices available!In: Out: Err: pre-reloc realloc() is not supportedalloc space exhausted cyclic function %s took too long: %lldus vs %dus max (unknown)Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> md5sha1sha256crc16-ccittvidconsole%s: Failed to probe keyboard '%s' (ret=%d) bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBHOSTNVMePV BLOCKRKMTDVirtIOBLKMAPUNKNOWN(%d) device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** bootdevice** No device specified ** ** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOu-boot,efi-partition-entries-offsetPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! %s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtd#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesclock-frequencyfixed_rate_raw_clockfixed_clockclock-divclock-multfixed_factor_clockfixed-factor-clock%s: (CLK#%ld) unhandled sunxi_clkallwinner,sun4i-a10-ccuallwinner,sun7i-a20-ccuclk_sun6i_rtcallwinner,sun6i-a31-rtcallwinner,sun8i-a23-rtcallwinner,sun8i-h3-rtcallwinner,sun8i-r40-rtcallwinner,sun8i-v3-rtcallwinner,sun50i-h5-rtcallwinner,sun50i-h6-rtcallwinner,sun50i-h616-rtcallwinner,sun50i-r329-rtcreg-names/clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Index Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p bootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kx%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%sunusedfuncgpio_sunxiSystem reset not supported on this platform resetting ... poweroff ... unable to find wdt device wdt_rebootwdt-rebootu-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvu-boot,i2c-offset-leni2c-chipi2c_genericcell-indexu-boot,i2c-slave-addri2c_mvtwsimarvell,mv64xxx-i2cmarvell,mv78230-i2callwinner,sun4i-a10-i2callwinner,sun6i-a31-i2cError enabling VMMC supply : %d Unknown modeStatus Error: 0x%08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%u > %u) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode : %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)bus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! udevice *)(NULLcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobenon-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found eMMC%s: %d (%s)mmc_blku-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed mmc %u error cannot set clock to %u ahbcd-gpiossunxi_mmcallwinner,sun4i-a10-mmcallwinner,sun5i-a13-mmcallwinner,sun7i-a20-mmcallwinner,sun8i-a83t-emmcallwinner,sun9i-a80-mmcallwinner,sun20i-d1-mmcallwinner,sun50i-a64-mmcallwinner,sun50i-a64-emmcallwinner,sun50i-h6-mmcallwinner,sun50i-h6-emmcallwinner,sun50i-a100-mmcallwinner,sun50i-a100-emmc%s %s: failed to get PHY node phy-supply%s %s: failed to get PHY supply node %s %s: failed to get PHY regulator node %s %s: failed to get emac clock %s %s: failed to enable emac clock Failed to allocate MDIO bus FULLHALFCould not initialize PHY %s ENET Speed is %d Mbps - %s duplex connection Received packet is too big (len=%d) eth_sunxi_emacallwinner,sun4i-a10-emac(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHY%s %s: failed to disable usb_%ldphy clock %s %s: failed to assert usb_%ldreset reset phy_ctrlusb0_vbus_power-supplyusb_vbususb_vbus_detusb_id_detusb%d_phy%s %s: failed to get usb%d_phy clock phandle pmu%d_clk%s %s: failed to get pmu%d_clk clock phandle usb%d_reset%s %s: failed to get usb%d_reset reset phandle pmu%d%s %s: failed to enable usb_%ldphy clock %s %s: failed to deassert usb_%ldreset reset %s %s: failed to enable aux clock %s %s: failed to deassert aux reset %s %s: failed to enable PHY2 clock sun4i_usb_phyallwinner,sun4i-a10-usb-phyallwinner,sun5i-a13-usb-phyallwinner,sun6i-a31-usb-phyallwinner,sun7i-a20-usb-phyallwinner,sun8i-a23-usb-phyallwinner,sun8i-a33-usb-phyallwinner,sun8i-a83t-usb-phyallwinner,sun8i-h3-usb-phyallwinner,sun8i-r40-usb-phyallwinner,sun8i-v3s-usb-phyallwinner,sun20i-d1-usb-phyallwinner,sun50i-a64-usb-phyallwinner,sun50i-h6-usb-phyallwinner,sun50i-h616-usb-phyallwinner,suniv-f1c100s-usb-phy#phy-cells%s %s: PHY: Failed to init %s: %d. %s %s: PHY: Failed to exit %s: %d. %s %s: PHY: Failed to enable regulator %s: %d. %s %s: PHY: Failed to power on %s: %d. %s %s: PHY: Failed to power off %s: %d. %s %s: PHY: Failed to disable regulator %s: %d. gpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: could not find pctldev groupsfunctiongpio inputgpio outputfunction %dP%c%dapbsunxi-pinctrlallwinner,sun4i-a10-pinctrlbias-disablebias-pull-downbias-pull-updrive-strengthregulator-nameregulatorsaxp_sysresetaxp_pmicx-powers,axp152x-powers,axp202x-powers,axp209x-powers,axp221x-powers,axp223x-powers,axp313ax-powers,axp803x-powers,axp806x-powers,axp809x-powers,axp813aldoaxp_regulatorbldocldodcdldoeldofldoswregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-always-onregulator-boot-onregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltenable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartbacklightvidconsole0no such font: %s, make sure it's name has x format 8x16Video device '%s' cannot allocate frame buffer memory - ensure the device is set up before relocation %s.vidconsole%dvideoError: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel enable-gpiossimple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51panasonic,vvx10f004b00DDC: timeout reading EDID , retryingEDID block %d: checksum error%s EDID: invalid EDID data EDID: unsupported version %d.%d EDID: no usable detailed timing found hpdhpd_delayoverscan_xoverscan_ymonitordviUnknown monitor: '%s', falling back to '%s' HDMI connected: Unknown monitor LCD not supported on this board VGA not supported on this board Composite video not supported on this board Setting up a %dx%d%s %s console (overscan %dx%d) lcd_backlight_enablelcd_backlight_pwmlcd_resetlcd_powerde_fe0-de_be0-lcd0-hdmide_fe0-de_be0-lcd0de_fe0-de_be0-lcd0-tve0sunxi_deDE not present DE is present but not probed Cannot setup simplefb: node not found Cannot setup simplefb: Error reserving memory x8r8g8b8Cannot setup simplefb: Error setting properties lcdvgacomposite-palcomposite-ntsccomposite-pal-mcomposite-pal-ncallwinner,simple-framebufferallwinner,pipelinevideo-modevideo-mode %dx%d-%d@%d not available, falling back to %dx%d-%d@%d timeout-sechw_margin_msu-boot,noautostartu-boot,autostartcyclic_register for %s failed every %ldmsWDT: Started %s with%s servicing %s (%ds timeout) WDT: Failed to register %s for sysreset WDT: Not starting %s WDT: Failed to start %s watchdogsunxi_wdtallwinner,sun4i-a10-wdtallwinner,sun6i-a31-wdtallwinner,sun20i-d1-wdt#reset-cellsresetsreset-names%s: (RST#%ld) unhandled sunxi_resetusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No working controllers found usb_dev_genericu-boot,bootdev-usbERROR: USB HC TakeOver failed! ERROR: USB HC reset timed out! ohci: Error out of ohci_devs for interrupt endpoints ERROR: index > length ERROR: %s device removed! ERROR: OHCI Unrecoverable Error, controller usb-%s disabled ERROR: USB-error: %s (%x) ERROR: USB-error: %s (%x) ERROR: sohci_submit_job: EPIPE ERROR: ep_add_ed: pending delete ERROR: sohci_submit_job: ENOMEM ERROR: need %d TDs, only have %d ERROR: sohci_submit_job: EINVAL ohci: Error out of memory allocating int queue ohci: Error out of memory allocating urb ohci: Error submitting int queue job ERROR: submit_common_message: pipesize for pipe %lx is zero ERROR: sohci_submit_job failed ERROR: CTL:TIMEOUT ERROR: submit_control_message: pipesize for pipe %lx is zero USB OHCI %x.%x No ErrorCRC: Last data packet from endpoint contained a CRC error.BITSTUFFING: Last data packet from endpoint contained a bit stuffing violationDATATOGGLEMISMATCH: Last packet from endpoint had data toggle PID that did not match the expected value.STALL: TD was moved to the Done Queue because the endpoint returned a STALL PIDDEVICENOTRESPONDING: Device did not respond to token (IN) or did not provide a handshake (OUT)PIDCHECKFAILURE: Check bits on PID from endpoint failed on data PID (IN) or handshake (OUT)UNEXPECTEDPID: Receive PID was not valid when encountered or PID value is not defined.DATAOVERRUN: The amount of data returned by the endpoint exceeded either the size of the maximum data packet allowed from the endpoint (found in MaximumPacketSize field of ED) or the remaining buffer size.DATAUNDERRUN: The endpoint returned less than MaximumPacketSize and that amount was not sufficient to fill the specified bufferreserved1reserved2BUFFEROVERRUN: During an IN, HC received data from endpoint faster than it could be written to system memoryBUFFERUNDERRUN: During an OUT, HC could not retrieve data from system memory fast enough to keep up with data USB data rate.NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(1)NOT ACCESSED: This code is set by software before the TD is placedon a list to be processed by the HC.(2)%s %s: Failed to get clocks (ret=%d) %s %s: Failed to enable clocks (err=%d) %s %s: failed to get resets (err=%d) %s %s: failed to deassert resets (err=%d) %s %s: failed to shutdown usb phy %s %s: failed to release resets (ret=%d) %s %s: failed to release clocks (ret=%d) ohci_genericgeneric-ohciEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x %s %s: Failed to get resets (err=%d) %s %s: Failed to get deassert resets (err=%d) vbus-supply%s %s: Error enabling VBUS supply (ret=%d) %s %s: failed to shutdown usb phy (ret=%d) %s %s: failed to disable VBUS supply (ret=%d) ehci_genericgeneric-ehcienv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s *** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$eth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacks0:autoUnable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... Unable to read "%s" from %s%d:%d... ** Reading file would overwrite reserved memory ** ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsext4unsupported** Can not find directory. ** ** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s error: overflow occurs Invalid FAT entry: %#08x FAT32 FAT12 FAT16 FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driver/EFI/BOOT/BOOTARM.EFILoading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed 1234567Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exited[?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting kaslr-seed ///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx out of memory%s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed No EFI system partition Cannot read EFI system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event ERROR: Failure adding GOP protocol Disk %s not ready Adding disk for %s failed (err=%ld/%#lx) Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### Failed to install ECPT linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellstargettarget-path/__local_fixups__/__fixups__/__overlay__//__overlay__/binmanmultiple-imagesUnknownmanufacturer01/01/2024productUnknown Productasset-tagskufamilysmbios_SM__DMI_baseboardchassisevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d No valid device tree binary found at %p display-timingshback-porchhfront-porchhactivehsync-lenvback-porchvfront-porchvactivevsync-lenvsync-activehsync-activede-activepixelclk-activeinterlaceddoublescandoubleclkseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotatenoethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead demo - register cyclic demo function cyclic list - list cyclic functions bootcmd=run distro_bootcmdbootdelay=2baudrate=115200preboot=usb startloadaddr=0x42000000arch=armcpu=armv7board=sunxiboard_name=sunxisoc=sunxistdin=serial,usbkbdstdout=serial,vidconsolestderr=serial,vidconsolebootm_size=0xa000000kernel_addr_r=0x42000000fdt_addr_r=0x43000000scriptaddr=0x43100000pxefile_addr_r=0x43200000fdtoverlay_addr_r=0x43300000ramdisk_addr_r=0x43400000dfu_alt_info_ram=kernel ram 0x42000000 0x1000000;fdt ram 0x43000000 0x100000;ramdisk ram 0x43400000 0x4000000fdtfile=sun4i-a10-pcduino.dtbconsole=ttyS0,115200uuid_gpt_esp=c12a7328-f81f-11d2-ba4b-00a0c93ec93buuid_gpt_system=69dad710-2ce4-4e3c-b16c-21a1d49abed3partitions=name=loader1,start=8k,size=32k,uuid=${uuid_gpt_loader1};name=loader2,size=984k,uuid=${uuid_gpt_loader2};name=esp,size=128M,bootable,uuid=${uuid_gpt_esp};name=system,size=-,uuid=${uuid_gpt_system};mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=fel mmc0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_fel=if test -n ${fel_booted} && test -n ${fel_scriptaddr}; then echo '(FEL boot)'; source ${fel_scriptaddr}; fibootcmd_mmc0=devnum=0; run mmc_bootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=for target in ${boot_targets}; do run bootcmd_${target}; done0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1harocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c edid chip - print EDID configuration information i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to #(-27][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used.emacgpio_ingpio_outi2c0i2c1mmc0mmc1mmc2mmc3nand0spi0uart0 ( w /*-+ 1234567890.=1234567890  -=[]\#;'`,./!@#$%^&*()  _+{}|~:"~<>?2H53F6CDBAU-Boot 2024.01+dfsg-5+b2 (Sep 14 2024 - 07:56:09 +0000) Allwinner Technology BUJ WJ=VJSJUJXJXJWJWJYJ\JSJ5\JaJeJkJJJJJwJJJJgJJJJJJ JJ~JJ@JJJJJJJJJJJJJJ^JJJJAJJJJJ/JJJJJ4JJJJJRJJaJJJYJJJJJ`JJWJJJhJJMJJJJJJJJoJJJJJJJJJJarJJJJJwJեJJJJݙJJ /JJAJJJ6JJEJJJJJuJJJ6JJJJJ6JJ}JJJ]JJJJJ6JJqJJJ6JJJJJ6JJwJJJ6JJJJJHJJJJJ#JJJJJ-JJJJJ6JJJJJNJJJJJJJ}JJJ@!QJJJJJHJJJJJsVJJ-JJJ#JJJJJvVJJJJJ+LJJJJJolJJJJJJJJJJarJJUJJJ|VJJJJJVJJEJJJarJJJJJWJJUJJJJJJJJarJJJJJgHJJJJJJJJJJZJJyJJJ`J`JaJJJJ%JJJ|JJ"JJJ|JJ'JJJ|JJq(JJJ|JJ)$JJJ|JJ#JJJzJJ JJJ6/JJ"JJJJJ(JJJ|JJ5&JJJQJ~J8~J~J 3J~J~J J 7WJ бJ  J DJDJJyEJAEJEJ%EJ DJEJEJEJ J|JDJEJJ]JEJDJAJu@JEJu@Ju@JEJu@J5JDJMDJu@J DJ u@JJ=*JJ !Ju@JJ!Ju@J9DJu@J )DJ)J)J()J()J0)J0)J8)J8)J@)J@)JH)JH)JP)JP)JX)JX)J`)J`)Jh)Jh)Jp)Jp)Jx)Jx)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J)J*J*J*J*J*J*J*J*J *J *J(*J(*J0*J0*J8*J8*J@*J@*JH*JH*JP*JP*JX*JX*J`*J`*Jh*Jh*Jp*Jp*Jx*Jx*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J*J+J+J+J+J+J+J+J+J +J +J(+J(+J0+J0+J8+J8+J@+J@+JH+JH+JP+JP+JX+JX+J`+J`+Jh+Jh+Jp+Jp+Jx+Jx+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J+J,J,J,J,J,J,J,J,J ,J ,J(,J(,J0,J0,J8,J8,J@,J@,JH,JH,JP,JP,JX,JX,J`,J`,Jh,Jh,Jp,Jp,Jx,Jx,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J,J-J-J-J-J-J-J-J-J -J -JnJJrJJJJJwJ Q JwJgJEJ~JAJJ1JٔJ6J:J JJJJJ&J -J-JJJ`````````` ``` `@`dh lllllllllll l@l@{J J5CJEFJCJeHJkCJJJJJJJUJsJUJUJaJwaJaJ1dJdJEdJ`JJ$5J~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@-rJ VJ(eJrJHgJ}lJJJJJ}=J=JJJJJJJJJJJZJJJ2JJ,JJJ2JJAJJ-JIJJJJJJJ JJJJJqJQJJJTJJrXJJJxXJXJJJJJJjJJIJpJJJJJJJ^>JJ%Jb>Jq>JJJJJJ.JJJ>J>J6JJJ>J>JJJJJJŗJ,JJJWJXJ1JmJJ4J JJY8JJJ'J<J_|JJ'Jg|J|JJJJ JJJJJ#J|J{JlJJJqJJx!JJJ!J!JN"JJJY J J}JJJJJR JJJY J J JJٶJ J!JofJJ JufJJ$JJIJR$Ju$J<%JJ-JD%Jk%J$JJ;JY J$J"JJJ"J"J#JJJ%#J3#J'JJJ J!J#JJJ#J#JJJIJy,JJ?-JJJF-J`-J-JJJ-JJ^JJņJt J J3JJJ34JO4JBtJJJFtJ[tJJJJJJѠJJAJ6JJ! JJJ( JW JqJJMJqJJ7JJJ7J;7J.pJJJ6pJXpJ-JJyJ-J.J|!JJOJ0J0J;JJJ;J:JO;JJJU;Jy;JZ9JJJ:J:J8JJJX:J:J6JJJ3=JR=JNJJkJY J.J]JJJd?Js?JIJJJIJIJJJJEJAJAJ6JJ!J:?J!?JJJJOQJ^QJ QJJJQJ&QJ6JJEJ>J>J|JJUJCWJRWJ6JJ3J?J!?J,JJ1J2JNJolJJ!J=YJ]YJWJJ JWJWJ^JJJ^J_J JJJ JJ{JJ#J{J{JJgJJ=J8`JT`J?JJJJJ<JJJ<J<JNJJJ J+ JzJJ JzJzJJ6/JJ]J;/JU/J|JJ"J|JJepJJJmpJpJsJJ(J{J{JJbJJJ bJFbJT~JJ=,J\~J|~JJJAJ J2JKJJ9JKJKJ>JJuJEJJZeJJq JbeJeJ7JJ JfJfJ?XJJJHXJXJQfJJ JVfJJJJtlJlJElJJJMlJblJJJEJJJ$J[JUJ4JJw4J_JSDJJJ)VJ JJJXJ4 JJJJXJ JJȪJ+TJ=TJ!TJ0JXJJ(hJÙJJrJJJGJ4JJ&$JJ}JiJUJEJ J<J rJWJJ(TJ17Jy6JdJؙJJeJ(J{J2J@J)J8JJ6J{JJJ JJm)JdJrJtJy.JJFJl̶JW`J]J JJ} J9JJ JrJMrJ·JB0JeJ8J@JG JJ-JJ L JJ dJ4JJwpJ1J@4JJJ]JJJ4JyJ5J%nJ-JQJ#JmtJJUtJJ?J-JtJJ~JJtJJ~JmJJEJJ J eJ J8=JaJ5J^JJ!JYJJ@JJJ4J?JI>Ji:JJR(JJJFJKJ JJ!JJJk?J! 2J& JJwJ(lJnJlJkJ3J2JJJѠJ6iJ%J- Je J]J8 J> J JHJLJQcJS JXHJHJJYLJJZMJ(J[SJױJc%WJUJ8NJevJNJl9[J![JJmJ JwJ}!J}JJ@ $J~J΅J!JXJJD@ $·JBJgJgJtJdJfJ4AJJlJhJlJJ$mJJJJJJJJJJJJJJJJ(JHJpJtJTJ\J`JJ(J,JJJJJJJ J J$J(J,J0J4J8JJJJJJlJpJtJxJ|JJJJJJ<J@JDJJJJJJJJJTJXJJJJJJJJJ(JdJhJlJpJtJxJ|JJJJJJJJJJJJJJDJlJJJJtJxJ|JJ|JJD JH JL JP JT J!J!J!J!J!J!J!J!J!J"J"J"J"J"J"J"J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J%J(J(J(J(J(J(J(J(J(J(J(J(J(J()J,)J0)J)J)J)J)JL*J*J*J*J$+J`,Jd,Jh,Jl,Jp,Jt,Jx,J|,J,J,J,J-J-J-J /J/JD/J/J/J0J0J 0JL2JP2JT2JX2J\2J`2Jd2Jh2Jl2Jp2Jt2Jx2J|2J2J2J2J2J2J2Jp5Jt5Jx5J|5J5J5J5J5J5J5J5J5J5J5J5J5J5J5J5J5J5J5JP6JT6Jd7Jh7Jl7Jp7Jt7Jx7J|7J7J7J7J7J7J7J7J7J7J7J7J7J7J7J7J9J9J 9J9J9J9J9J 9J$9J(9J,9J09J49J89J<9J@9JD9JH9JL9JP9JT9JX9J\9J`9J9J:J:J :J;J;J;J;J;J<<Jx<JX=J\=Jl=Jp=J=J=J>J>J>J >J$>J4>J8>J ?J$?J(?J,?J0?J4?J8?JJx>J>J>J>J>J>J>JJ`?Jd?Jh?Jl?Jp?Jt?Jx?J|?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J?J@J@J@J @J@J@J@J@J @J$@J(@J,@J0@J4@J8@J<@J@J@J@J@J8AJJ\>J`>Jd>J?JH@JBJBJEJEJ`FJFJGJGJGJGJ GJ$GJ(GJ,GJ0GJ4GJ8GJHJHJHJIJIJJJMJ$OJ(OJ,OJ0OJOJOJSJHTJTJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJVJLYJPYJZJZJ[J [JH[J[JT\J\J]Jh]J^JT`JX`J|`J`J`J`J`J`JaJ aJ$aJ`aJdaJhaJlaJpaJtaJxaJaJaJaJaJaJ,cJ0cJ4cJ8cJ disabledframebuffer-fe0-lcd0-hdmi02allwinner,simple-framebuffersimple-framebuffergde_fe0-de_be0-lcd0-hdmiPz8<>@ disabledframebuffer-fe0-lcd002allwinner,simple-framebuffersimple-framebuffergde_fe0-de_be0-lcd0@z8>@ disabledframebuffer-fe0-lcd0-tve002allwinner,simple-framebuffersimple-framebuffergde_fe0-de_be0-lcd0-tve0Pz68>@ disabledcpuscpu@0cpu2arm,cortex-a8z a\ p / thermal-zonescpu-thermalcooling-mapsmap0  tripscpu-alert0!L-passivecpu-crit!- critical1clocksTclk-24M8 2fixed-clockEn6Uosc24Mclk-32k8 2fixed-clockEUosc32kdisplay-engine#2allwinner,sun4i-a10-display-engineh disabled2pmu2arm,cortex-a8-pmu|reserved-memoryTdefault-pool2shared-dma-pool@soc 2simple-busTsystem-control@1c00000#2allwinner,sun4i-a10-system-control0Tsram@0 2mmio-sram T3sram-section@80002allwinner,sun4i-a10-sram-a3-a4@okay sram@10000 2mmio-sram T4sram-section@02allwinner,sun4i-a10-sram-dokaysram@1d00000 2mmio-sram  T 5sram-section@02allwinner,sun4i-a10-sram-c1dma-controller@1c020002allwinner,sun4i-a10-dma |z  nand-controller@1c030002allwinner,sun4i-a10-nand0|%z'`ahbmod  rxtx disabled6spi@1c050002allwinner,sun4i-a10-spiP| z,pahbmod  rxtx disabled7spi@1c060002allwinner,sun4i-a10-spi`| z-qahbmod  rxtxdefault  disabled8ethernet@1c0b0002allwinner,sun4i-a10-emac|7z* default okay9mdio@1c0b0802allwinner,sun4i-a10-mdiookay:ethernet-phy@1lcd-controller@1c0c0002allwinner,sun4i-a10-tcon|,  lcdz8ahbtcon-ch0tcon-ch1Utcon0-pixel-clock8  ;portsport@0<endpoint@0.endpoint@1*port@1=endpoint@1/lcd-controller@1c0d0002allwinner,sun4i-a10-tcon|-  lcdz9ahbtcon-ch0tcon-ch1Utcon1-pixel-clock8  >portsport@0?endpoint@0/endpoint@1+port@1@endpoint@1/video-codec@1c0e000!2allwinner,sun4i-a10-video-enginez4 ahbmodram |5mmc@1c0f0002allwinner,sun4i-a10-mmcz"bahbmmc| defaultokayFR\Ammc@1c100002allwinner,sun4i-a10-mmcz#eahbmmc|! disabledBmmc@1c110002allwinner,sun4i-a10-mmcz$hahbmmc|" disabledCmmc@1c120002allwinner,sun4i-a10-mmc z%kahbmmc|# disabledDusb@1c130002allwinner,sun4i-a10-musb0z|&emcuzusbotgokayEphy@1c134002allwinner,sun4i-a10-usb-phy4Hphy_ctrlpmu1pmu2z}usb_phy !usb0_resetusb1_resetusb2_resetokayusb@1c14000&2allwinner,sun4i-a10-ehcigeneric-ehci@|'zuzusbokayFusb@1c14400&2allwinner,sun4i-a10-ohcigeneric-ohciD|@z{uzusbokayGcrypto-engine@1c150002allwinner,sun4i-a10-cryptoP|VzoahbmodHhdmi@1c160002allwinner,sun4i-a10-hdmi`|: z< ahbmodpll-0pll-1$   ddc-txddc-rxaudio-tx disabledIportsport@0Jendpoint@0endpoint@1port@1Kspi@1c170002allwinner,sun4i-a10-spip| z.rahbmod  rxtx disabledLsata@1c180002allwinner,sun4i-a10-ahci|8z1z disabledMusb@1c1c000&2allwinner,sun4i-a10-ehcigeneric-ehci|(zuzusbokayNusb@1c1c400&2allwinner,sun4i-a10-ohcigeneric-ohci|Az|uzusbokayOcsi@1c1d0002allwinner,sun4i-a10-csi1|+z;busram  disabledPspi@1c1f0002allwinner,sun4i-a10-spi|2z/ahbmod  rxtx disabledQclock@1c200002allwinner,sun4i-a10-ccuz hosclosc8interrupt-controller@1c204002allwinner,sun4i-a10-icpinctrl@1c208002allwinner,sun4i-a10-pinctrl|zJapbhosclosccan0-ph-pins +PH20PH210canRemac0-pinsK+PA0PA1PA2PA3PA4PA5PA6PA7PA8PA9PA10PA11PA12PA13PA14PA15PA160emac i2c0-pins+PB0PB10i2c0!i2c1-pins +PB18PB190i2c1"i2c2-pins +PB20PB210i2c2#ir0-rx-pin+PB40ir0Sir0-tx-pin+PB30ir0Tir1-rx-pin+PB230ir1Uir1-tx-pin+PB220ir1Vmmc0-pins+PF0PF1PF2PF3PF4PF50mmc09Hps2-ch0-pins +PI20PI210ps2Wps2-ch1-ph-pins +PH12PH130ps2Xpwm0-pin+PB20pwmYpwm1-pin+PI30pwmZspdif-tx-pin+PB130spdifH[spi0-pi-pins+PI11PI12PI130spi0\spi0-cs0-pi-pin+PI100spi0]spi1-pins+PI17PI18PI190spi1 spi1-cs0-pin+PI160spi1 spi2-pb-pins+PB15PB16PB170spi2^spi2-pc-pins+PC20PC21PC220spi2_spi2-cs0-pb-pin+PB140spi2`spi2-cs0-pc-pin+PC190spi2auart0-pb-pins +PB22PB230uart0 uart0-pf-pins+PF2PF40uart0buart1-pins +PA10PA110uart1ctimer@1c20c002allwinner,sun4i-a10-timer |CDzwatchdog@1c20c902allwinner,sun4i-a10-wdt |zdrtc@1c20d002allwinner,sun4i-a10-rtc |epwm@1c20e002allwinner,sun4i-a10-pwm zU disabledfspdif@1c21000`2allwinner,sun4i-a10-spdif| zFx apbspdif  rxtx disabledgir@1c218002allwinner,sun4i-a10-irzKtapbir|@ disabledhir@1c21c002allwinner,sun4i-a10-irzLuapbir|@ disabledii2s@1c22400`2allwinner,sun4i-a10-i2s$|zGvapbmod  rxtx disabledjlradc@1c228002allwinner,sun4i-a10-lradc-keys(| disabledkcodec@1c22c00`2allwinner,sun4i-a10-codec,@|zE apbcodec  rxtx disabledleeprom@1c238002allwinner,sun4i-a10-sid8mrtp@1c250002allwinner,sun4i-a10-tsP|qserial@1c280002snps,dw-apb-uart€|zXokaydefault nserial@1c284002snps,dw-apb-uart„|zY disabledoserial@1c288002snps,dw-apb-uartˆ|zZ disabledpserial@1c28c002snps,dw-apb-uartŒ|z[ disabledqserial@1c290002snps,dw-apb-uart|z\ disabledrserial@1c294002snps,dw-apb-uart”|z] disabledsserial@1c298002snps,dw-apb-uart˜|z^ disabledtserial@1c29c002snps,dw-apb-uartœ|z_ disabledups2@1c2a0002allwinner,sun4i-a10-ps2 |>zU disabledvps2@1c2a4002allwinner,sun4i-a10-ps2¤|?zV disabledwi2c@1c2ac002allwinner,sun4i-a10-i2c¬|zOdefault!okayxpmic@344|2x-powers,axp209yac-power 2x-powers,axp202-ac-power-supply disabledzadc2x-powers,axp209-adc0gpio2x-powers,axp209-gpio{battery-power%2x-powers,axp209-battery-power-supply disabled|regulatorsdcdc2vdd-cpuB@\dcdc3 vdd-int-dllB@\}ldo1  vdd-rtc~ldo2avcc--ldo3ldo3ldo4ldo4ldo5ldo5 disabledusb-power!2x-powers,axp202-usb-power-supply disabledi2c@1c2b0002allwinner,sun4i-a10-i2c°|zPdefault" disabledi2c@1c2b4002allwinner,sun4i-a10-i2c´| zQdefault# disabledcan@1c2bc002allwinner,sun4i-a10-can¼|zS disabledgpu@1c40000&2allwinner,sun4i-a10-maliarm,mali-400|EFGHIegpgpmmupp0ppmmu0pmuzD buscore &`display-frontend@1e00000%2allwinner,sun4i-a10-display-frontend|/z@ ahbmodram portsport@1endpoint@0$,endpoint@1%(display-frontend@1e20000%2allwinner,sun4i-a10-display-frontend|0zA ahbmodram portsport@1endpoint@0&-endpoint@1')display-backend@1e40000$2allwinner,sun4i-a10-display-backend|0z? ahbmodram portsport@0endpoint@0(%endpoint@1)'port@1endpoint@0*endpoint@1+display-backend@1e60000$2allwinner,sun4i-a10-display-backend|/z> ahbmodram portsport@0endpoint@0,$endpoint@1-&port@1endpoint@0.endpoint@1/ahci-5v2regulator-fixedahci-5vLK@LK@;M` disabledusb0-vbus2regulator-fixed usb0-vbusLK@LK@M`  disabledusb1-vbus2regulator-fixed usb1-vbusLK@LK@;M` disabledusb2-vbus2regulator-fixed usb2-vbusLK@LK@;M` disabledvcc3v02regulator-fixedvcc3v0--vcc3v32regulator-fixedvcc3v32Z2Zvcc5v02regulator-fixedvcc5v0LK@LK@leds 2gpio-ledsled-0epcduino:green:tx_led-1epcduino:green:rx_gpio-keys 2gpio-keyskey-back eKey Backk_key-home eKey Homekf_key-menu eKey Menuk_pmic-temp 2iio-hwmonv0binmanu-boot-sunxi-with-splu-boot-sunxi-with-spl.binblobspl/sunxi-spl.binu-boot-img__symbols__ /cpus/cpu@0,/thermal-zones/cpu-thermal/trips/cpu-alert0*/thermal-zones/cpu-thermal/trips/cpu-crit/clocks/clk-24M/clocks/clk-32k/display-engine#/soc/system-control@1c00000/sram@05/soc/system-control@1c00000/sram@0/sram-section@8000'/soc/system-control@1c00000/sram@100006/soc/system-control@1c00000/sram@10000/sram-section@0)/soc/system-control@1c00000/sram@1d000008/soc/system-control@1c00000/sram@1d00000/sram-section@0/soc/dma-controller@1c02000/soc/nand-controller@1c03000 /soc/spi@1c05000/soc/spi@1c06000/soc/ethernet@1c0b000/soc/mdio@1c0b080! /soc/mdio@1c0b080/ethernet-phy@1%/soc/lcd-controller@1c0c000)+/soc/lcd-controller@1c0c000/ports/port@044/soc/lcd-controller@1c0c000/ports/port@0/endpoint@04A/soc/lcd-controller@1c0c000/ports/port@0/endpoint@1)N/soc/lcd-controller@1c0c000/ports/port@14X/soc/lcd-controller@1c0c000/ports/port@1/endpoint@1g/soc/lcd-controller@1c0d000)m/soc/lcd-controller@1c0d000/ports/port@04v/soc/lcd-controller@1c0d000/ports/port@0/endpoint@04/soc/lcd-controller@1c0d000/ports/port@0/endpoint@1)/soc/lcd-controller@1c0d000/ports/port@14/soc/lcd-controller@1c0d000/ports/port@1/endpoint@1O/soc/mmc@1c0f000/soc/mmc@1c10000/soc/mmc@1c11000/soc/mmc@1c12000/soc/usb@1c13000/soc/phy@1c13400/soc/usb@1c14000/soc/usb@1c14400/soc/crypto-engine@1c15000b/soc/hdmi@1c16000/soc/hdmi@1c16000/ports/port@0*/soc/hdmi@1c16000/ports/port@0/endpoint@0*/soc/hdmi@1c16000/ports/port@0/endpoint@1/soc/hdmi@1c16000/ports/port@1/soc/spi@1c17000 /soc/sata@1c18000/soc/usb@1c1c000/soc/usb@1c1c400/soc/csi@1c1d000"/soc/spi@1c1f000'/soc/clock@1c20000"+/soc/interrupt-controller@1c20400a/soc/pinctrl@1c20800"0/soc/pinctrl@1c20800/can0-ph-pins =/soc/pinctrl@1c20800/emac0-pinsG/soc/pinctrl@1c20800/i2c0-pinsQ/soc/pinctrl@1c20800/i2c1-pins[/soc/pinctrl@1c20800/i2c2-pins e/soc/pinctrl@1c20800/ir0-rx-pin q/soc/pinctrl@1c20800/ir0-tx-pin }/soc/pinctrl@1c20800/ir1-rx-pin /soc/pinctrl@1c20800/ir1-tx-pin/soc/pinctrl@1c20800/mmc0-pins"/soc/pinctrl@1c20800/ps2-ch0-pins%/soc/pinctrl@1c20800/ps2-ch1-ph-pins/soc/pinctrl@1c20800/pwm0-pin/soc/pinctrl@1c20800/pwm1-pin"/soc/pinctrl@1c20800/spdif-tx-pin"/soc/pinctrl@1c20800/spi0-pi-pins%/soc/pinctrl@1c20800/spi0-cs0-pi-pin/soc/pinctrl@1c20800/spi1-pins"/soc/pinctrl@1c20800/spi1-cs0-pin"/soc/pinctrl@1c20800/spi2-pb-pins"/soc/pinctrl@1c20800/spi2-pc-pins%)/soc/pinctrl@1c20800/spi2-cs0-pb-pin%9/soc/pinctrl@1c20800/spi2-cs0-pc-pin#J/soc/pinctrl@1c20800/uart0-pb-pins#X/soc/pinctrl@1c20800/uart0-pf-pins f/soc/pinctrl@1c20800/uart1-pinsq/soc/watchdog@1c20c90u/soc/rtc@1c20d00y/soc/pwm@1c20e00}/soc/spdif@1c21000/soc/ir@1c21800/soc/ir@1c21c00/soc/i2s@1c22400/soc/lradc@1c22800/soc/codec@1c22c00/soc/eeprom@1c23800/soc/rtp@1c25000/soc/serial@1c28000/soc/serial@1c28400/soc/serial@1c28800/soc/serial@1c28c00/soc/serial@1c29000/soc/serial@1c29400/soc/serial@1c29800/soc/serial@1c29c00/soc/ps2@1c2a000/soc/ps2@1c2a400/soc/i2c@1c2ac00/soc/i2c@1c2ac00/pmic@34"/soc/i2c@1c2ac00/pmic@34/ac-power/soc/i2c@1c2ac00/pmic@34/adc/soc/i2c@1c2ac00/pmic@34/gpio' /soc/i2c@1c2ac00/pmic@34/battery-power* /soc/i2c@1c2ac00/pmic@34/regulators/dcdc2**/soc/i2c@1c2ac00/pmic@34/regulators/dcdc3)4/soc/i2c@1c2ac00/pmic@34/regulators/ldo1)=/soc/i2c@1c2ac00/pmic@34/regulators/ldo2)F/soc/i2c@1c2ac00/pmic@34/regulators/ldo3)O/soc/i2c@1c2ac00/pmic@34/regulators/ldo4)X/soc/i2c@1c2ac00/pmic@34/regulators/ldo5#a/soc/i2c@1c2ac00/pmic@34/usb-powerr/soc/i2c@1c2b000w/soc/i2c@1c2b400|/soc/can@1c2bc00/soc/gpu@1c40000/soc/display-frontend@1e00000+/soc/display-frontend@1e00000/ports/port@16/soc/display-frontend@1e00000/ports/port@1/endpoint@06/soc/display-frontend@1e00000/ports/port@1/endpoint@1/soc/display-frontend@1e20000+/soc/display-frontend@1e20000/ports/port@16/soc/display-frontend@1e20000/ports/port@1/endpoint@06/soc/display-frontend@1e20000/ports/port@1/endpoint@1J/soc/display-backend@1e40000*/soc/display-backend@1e40000/ports/port@05/soc/display-backend@1e40000/ports/port@0/endpoint@05/soc/display-backend@1e40000/ports/port@0/endpoint@1*/soc/display-backend@1e40000/ports/port@15/soc/display-backend@1e40000/ports/port@1/endpoint@05 /soc/display-backend@1e40000/ports/port@1/endpoint@1=/soc/display-backend@1e60000* /soc/display-backend@1e60000/ports/port@05 /soc/display-backend@1e60000/ports/port@0/endpoint@05 !/soc/display-backend@1e60000/ports/port@0/endpoint@1* ,/soc/display-backend@1e60000/ports/port@15 4/soc/display-backend@1e60000/ports/port@1/endpoint@05 B/soc/display-backend@1e60000/ports/port@1/endpoint@1 P/ahci-5v \/usb0-vbus j/usb1-vbus x/usb2-vbus /vcc3v0 /vcc3v3 /vcc5v0 /binman #address-cells#size-cellsinterrupt-parentmodelcompatibleethernet0serial0mmc0rangesstdout-pathallwinner,pipelineclocksstatusdevice_typeregclock-latencyoperating-points#cooling-cellscpu-supplyphandlepolling-delay-passivepolling-delaythermal-sensorstripcooling-devicetemperaturehysteresis#clock-cellsclock-frequencyclock-output-namesallwinner,pipelinesinterruptssizealloc-rangesreusablelinux,cma-default#dma-cellsclock-namesdmasdma-namespinctrl-namespinctrl-0allwinner,sramphy-handleresetsreset-namesremote-endpointallwinner,tcon-channelvmmc-supplybus-widthcd-gpiosinterrupt-namesphysphy-namesextcondr_mode#phy-cellsreg-namesusb0_id_det-gpiosusb1_vbus-supplyusb2_vbus-supply#reset-cellsinterrupt-controller#interrupt-cellsgpio-controller#gpio-cellspinsfunctiondrive-strengthbias-pull-up#pwm-cells#sound-dai-cells#thermal-sensor-cellsreg-shiftreg-io-width#io-channel-cellsx-powers,dcdc-freqregulator-nameregulator-always-onregulator-min-microvoltregulator-max-microvoltassigned-clocksassigned-clock-ratesregulator-boot-onenable-active-highgpiolabellinux,codeio-channelsmultiple-imagesfilenamepad-bytemin-sizecpu0cpu_alert0cpu_critosc24Mosc32ksram_aemac_sramsram_dotg_sramsram_cve_sramdmanfcspi0spi1emacmdiophy1tcon0tcon0_intcon0_in_be0tcon0_in_be1tcon0_outtcon0_out_hdmitcon1tcon1_intcon1_in_be0tcon1_in_be1tcon1_outtcon1_out_hdmimmc1mmc2mmc3usb_otgusbphyehci0ohci0cryptohdmi_inhdmi_in_tcon0hdmi_in_tcon1hdmi_outspi2ahciehci1ohci1csi1spi3ccuintccan0_ph_pinsemac_pinsi2c0_pinsi2c1_pinsi2c2_pinsir0_rx_pinsir0_tx_pinsir1_rx_pinsir1_tx_pinsmmc0_pinsps2_ch0_pinsps2_ch1_ph_pinspwm0_pinpwm1_pinspdif_tx_pinspi0_pi_pinsspi0_cs0_pi_pinspi1_pinsspi1_cs0_pinspi2_pb_pinsspi2_pc_pinsspi2_cs0_pb_pinspi2_cs0_pc_pinsuart0_pb_pinsuart0_pf_pinsuart1_pinswdtrtcpwmspdifir0ir1i2s0lradccodecsidrtpuart0uart1uart2uart3uart4uart5uart6uart7ps20ps21i2c0axp209ac_power_supplyaxp_adcaxp_gpiobattery_power_supplyreg_dcdc2reg_dcdc3reg_ldo1reg_ldo2reg_ldo3reg_ldo4reg_ldo5usb_power_supplyi2c1i2c2can0malife0fe0_outfe0_out_be0fe0_out_be1fe1fe1_outfe1_out_be0fe1_out_be1be1_inbe1_in_fe0be1_in_fe1be1_outbe1_out_tcon0be1_out_tcon1be0_inbe0_in_fe0be0_in_fe1be0_outbe0_out_tcon0be0_out_tcon1reg_ahci_5vreg_usb0_vbusreg_usb1_vbusreg_usb2_vbusreg_vcc3v0reg_vcc3v3reg_vcc5v0binman