@̐  9U @w,w www@ST0SX0@S`0Sd0@Sh0@Sp0St0Sx0S|0@S0@S0S0S0@S0S0SSSS0S0S 0S$S(0S,0c5455cMDLDc|78c;->P w////////00S+ Q \& /A-P@ ` pV: \ : "& \*000C0@0//www@-@ @ Q/00 0@00000wwwwM-`@qQ4G1U:1`M0"ÌŌT 0 W030#X0S0 CRS  R 0 0T0F0 C 0??0ttCP S :!  Q *  CwÆwĆwwwwww@-@PT00Ѝ00@- @P @oRPPU P @@oT RS   P000w@- 0 4w0w@-@P  @@)@0M-p`@P000PU :T R  Ѝ0 00 PT Q   0R B   w4wE-P@0 `R` T 0S0:00P긠pP  0^P T 0S0#0%P ЍPPV0 H0S%P T00PUT4w0wRQM-@00P0S,`pPᨀ$P"  P0SX  ᲠZ B R  T 00 AЍ:AA @SQM-p  P  R ` Pg@P% [ 00 W00Z hPM 0 R X @TF:2wP/p@-p0p@Q#% PU00C B0&@  Bp0w4wM-ࠟ`P@0040p C@Q&"       04 8 P    B  BЍ4w 00 0S `2#>2/4w/@-KЍ0RQp@- PSP @0 S P0SP 0`, 0 pA A  //0@AR/\/\/ B0@P/ R/0@- R 0 R0#s01 # @0 PUS0A00X "r !\ "0 p .~. p .~. Hw@-%s: Unknown relocation type %llx %s: Relocation at %p is out of range (%lx) VarToFile0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdHw% wDas U-BootwwRUNTSERVdPPAw?0/p@-@Po0P  0``&UOp@6?0_00;0 0Q@o0  CA_ov^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovVY@T S@No/N-N//@-@j `fwVrQYOi@-0//tРFРF T8Р <0((0 S}S}S 0 Ćw,wjw _/_ РP/0 /0Od@P TP  Q:< 80QR:/e0- $M<0 @ 0DH ! 0 $Ѝ/s@-0`40P@0TP  g?P`>LT0TPP>6|p0S 00 8 T6/Ѝp wwnww6w/@-@4)0S 8P@;ɅwOwdwp@-``P @ p  @-@P ('PڠP a@#ꋗww0/@-%$0 4& 8' <|S S@@ ha)(0 4* 8+ <0-,0 4. 8/ <0 y>(oboxwɗw0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l  0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0<4N#4K#,4H#$8E#@);=ww www8 4 8  B8 /40 00/@w//@-Y97wp@-@M p8 <`@P= b <8< <0 @C0=,00 4 = 0$ (<000 <00 0 <VnNz Z c0C0vV<@0 @01 0x<tcTBT>s@3?sx0PPg lL 0LWDЍ0_ _@ -ظl$00 0_  0 /܊ww6nP P 0P0w@-4@0_P 0$0_!0!L܊wp@-d0 _0$0_P P PEIR RSXS[!~Lp R ܊w$0 0550$0==$0/܊wP0 p02>p0/܊wQ  000!lP  l //܊w0 030/܊wP0 x0;5x0/܊wP0 x0:6x0/܊w@-$00@_02'L܊wwd0  _T0 00_S6S S S 00H/܊ww@-d@00_ @e00_ 500_S#!0!K܊w@-0000_SK@ K܊w` 00_S5S S @-S0@ _TK_܊wp@-P@!#9!9!9 |!9t9l@h! 9X!9H!88!8pwC圅ww w!wwMb5wIw]wqw0P Em@-d0 _08@_Pw/p@-@P`+6/0 TP@p0/ jw0 R R/00 R H2UwA-p0@/SP"M 0S00,,k,`h,` V l)2#"ލ,H 2 @2P0 5/PW00]wxwws@-@P`᫯P  f2P0 Ѝp@-@V VVVVV V$V(V@VM-0P`00@ S S #S@0S S S0 S00@@R,  0p SS GLWP0 X 000@0002 R0p RG.WP0|pp燡Q +P00 " 0X000@0pݕw0sws@- P @`P00  A_1Ѝp荤w@-` Ppt@T  8AL1 ЍP 1GVꬤw@-QMl81Ѝ@A L CP 0 00 00 00001äwow㤅wM-P@MMh6  l<0@PDPHPLPD 00040S 80S堮PP P -,8-&+ [MލQ % P0$0`Sp0 +P+PPaV0P0<000(%00`QOpWR,0 P 0 0,0 ly*XP0l0͵,0PU] ,xU*P*Pl*PP U4Q*@*Pl*,0  i0 t*Pp# ->PPRv002*埭0p#PP$0PLUjQ ,%*+*l(*,-7-H(-00 | HQ 6*PH`{ H0Sx [P\$0SH0p f0P0Ca^0"SxRRPPh P$$ ;*Q|2$ $$0 Qd/\($, +*$(*($*!*( (*, (( * pUP( /!P0 0$0P 0$0!/ P0 \! TX 0H0 0S L/e$Q 8/WP0D0H0@@S@`H$H0PS @D0S0D0 0Q <0 =P ϬHH0S 1ѢwwɅww.w$eP; @[8 0S@DZ@@G00U- PP (ЍM[PQ <l'P0S <d'P @p GOP p(E-t (ЍgfffLwۧww=wwA-@`p P0U 0 00$0p`0 \' P1:P'P U0 /d'0P 0C0 nwp@-P`"@P0-pV00Bp#w@-@M@@ '@ W03?@o@Ѝ@-@ @82/$ 03?@o<0 R/p@-`@PP @1<3?A0<@Tp03?00 0S/S/ @-@P@ wTw w~w wwM-0pPs`@U $,0Vv,s,U U l,%tg,V ( Z3 :8  (0&p (000 ww(w҅wEw1w hww@-@M 0 dd;,X\8,`Pp0 ',$, 0 2/, 2/,0 R#>` ,PUЍ 0 7 t+ t0U0C?o20S  <\+P S @12/*B@AЍ@+CQw|wwwwéw٩w海ww w$w@-5,0/w@- P  p,蒲wp@-X P  d,p,P@ @T(@P  V,PDp蜲ww@- P@ G,觲wP/A-`@P@PVVp1p!TT@DPE O&T@0P0`FP +0/wM  Ѝ $0R @-o/'V/M-(`PP pd% P000 R0 00%D0S "0SX@+ 0o +@P80+ 1RP4PgNЍU ^N8P WN0wS0P PS0S o+T @00 03?0:$%P T+@00N?w$ww'VҾw羅w|wwwwwA-@P`p'P 7+T 000'T R PpNp0@0   (*8  Mlwxwww/7@-P0@0  P0S   Ѝ0@-@*@ wwp@-P4`P& 0@RwP V Pt 0Sh@ @0R2PMp@T 00$M@Cw'V̳w޳www ww@-geA-p`m$@j$TPD9$P@@-@p`2hPP0,037V %hL* 0S ,07,0 Ѝ3/00 PLws@-`PPhO@P P h 0  00  P e0@ @Ѝpp@-0M @\ `P0)<$ P @  07f@P ze 000Ѝp^wM-@M P`dpd0Sk@=0S"  |!)0<l!y) $P @$' 0 0@P  X t[0Sp _pk@ b#0@(0 pp'TppW 0S0@0Ѝ0000S (] @R R 0S@S 0@P(00(0dw^wlw7@-P @dP p 0W Ѝ0{wp@-@@M` 0  2 p (d Pd@P t  # P @ 0~e@Pd@Ѝp致w{wrw@-DM@pdPdPt `0ZdP 02D 0 0( idPcP00DЍzwwM-PXM$ )$ppW@ `fp@ t"Pp  \"Pp _@XЍ~PpB@ Tp(@UfP0P @v H0S ,P0,PE, 0R cP!  _P d dPp Ch 0  2 $P O( $cP 00v0pX0@pꌴwww{wrw@-`0 aEa(PP00`P00S@-.a5a(P@-%a,aP0<00S //0<00S /%/0<00S /%/-<^ /%p@-0<`0S P@ Z0p@/%pM-MPpP0`Vxe`PpЍ]L0P p0 @ 0000+ 0 ydP U` 0 R 0!@T0X [t@T Z t0Tsp0000l@|00Q/堨p@-@MR0`|00p $0IdP0  ըPPU Ѝp0@00(0nwkw0@-@Q0@0傫P0(00<0ЍA- MXp@`8P _P➨P0 R0P 0 00 ᕨP00 Ѝ@-_@-_000p@-_@IIPPp@p@-`_@Dˡ0PP0 0S %%Ppp\w@-_0Pjw7@-Pd@P_ Ѝ07@-P@P Ѝ0@fPA- 0P耟@Ѝ b 0S `bpW@DDA2d48BT0S pDPh h 0`P H.0P 0 0 `L^P PwPwXwiwqw}w/p@-@P_`d@PTP0 @P0 ,#$#@0p娅w%wFwwwp@-P@XM  ^<`P@^0T 00000 00<00 P XЍp<P 00@0/0 0 0P1<`@] U0H0   ! 0(H/(YP00]BPx ]X<00 X00TpX0  @*PЍQp.wPwDw0w%/@-@-@\0S 0(0ЍcP uP Fkw4w#@-\0000uw0@-P @\*  0S*0P*SP: S*S0@ 2/ <Ͽ03?0M-@p `i P p !!\1U3?00>^D@^H.SS#<@0P 013? 0A@4OT @>T$L@^D@^H.@M-@ pP0 `0S* @ `X P6o4O`@`@4OA-PR`p@  T0 w P003?0誶wM-HMPp`0 @P(0$ $ 0BS(0S R  HЍ!8 0P0 $08 0S:000, ,0HS00S 0 (00 40$# `P 4@T08 0@4OZ*!806 08g 0@$(0@pp0  10Gq[4p 08qp@ pG0` ! 8D[wwM- P`p$R @PZ 0  M]  0 P@A-`pPp  P@  0  N ŕwѶw7@-P@P \A T匝@P@ Ѝ0o0 ! @P  ݶw붅wwwM-Q M@ Ѝp`x!P@Pe X 0 @ SR 0F 0 Pq  @ P7 0p pP W @p 0p pP6o`H 0 P@< ,6o`装w+w;wNw}wwɅws@-P(@P$  A@P`P 0p `P \@ЍpH400 u @P@껷w装wɅw˷www w7@-@PP  0 Ѝ0@d Ѝ04wE-SpLM0 00W@LЍP`@P H @P000 + P0H 1 @\  ! \ 0 D 0 @P( @rw]wնw0ƅwww޸w@- 0 ЍA-p(M@PUPT`V:QH0 % p P+ P-"P `P -0S`V0` 0`0C00h `0;P` p P $(Ѝ⸅w븅ww www@-@PM$ P`pV 0  ST*  A <Ͽ2/ PT0PPPPE5?P0Ѝ`0 P0P0Uwp@-@TXpP`PhM v1Q HD03?S ,1;$900pwJwhwww@-@nAlA@iA꘹wwA-@(P `pPp YA 0 ЍŹww@-$MP@PV`T  Pp@pT$Ѝ0 %P00!@0 pk `P P \  P00  B00 ` `F@/#w޸wwM-0MS P-@P Ѝ00P) p UU@R @Px@P 0-?  T P<8@?p`0 10 001 00Q0: 0Q 1010 zP 0V0 5 0pQ 0 0S@ @8?00-? @ =@0@"w*w3wSwwֺwwwA-@0 p$`PQ00 PP+ Pl \@8PD0S0 "0S- 0 90S" @`uPL0 3?R@ 4(-@P  PЍ@0S0S@HPU @4OTU 2/0S00U0#St`@03?0D@ƻw$wbwww溅w|ww7wwLw`wuwwww/@-PM@pEP8P$P`?[PH`V 000 o B`PP 0 PT0S0  EPP hSW 1PPW ]Ѝ蛼ww7wݼww磅ww0/Rp@-@@`P0'|? F@P@p]ww@-@ c@Fꏾw@-@ Pt pH? h0Rd PP=?<7?P, (0?藾w ww'VϾw侅w|wwwR@0A-Pp`@7@U`w@-`BV@,Mp>P$0 R:R00#R00S/ FP `V  00V,ЍhPEU 0U0 0U 000|0@000 P$@PV 0V00V 0 00bHwĆw$wѢws@-@P9P `(0(`f 0 ЍpwNw@-@ (0$$LL FЍ…wYgw…w…w@- 0 @uFЍDwp@-M `@PP#V 00-SZP܍p@ 0`@0`x TpxTDP 8>PT0Sxtx@w…w!WwA-`0B>SpP@X XEP 0 DRU(0^p0A/Dw ́wR@-rDf@ @G3Åw0 oÅw@-   ЍÅwp@-@8(MP`@0S 0< 0@ 0S`P|tlhL`0X< LL[*@P;  8  (+@+T0  0S , P P /(Ѝp W lsÅwÅwÅwÅwÅwÅwÅwÅwÅwÅwąwąwąwow!ąw3ąwåwQąwcąwląw~ąwąwąwwąwwEąwRA-@PD`B pDP 0 A//`wR p@-@u Pp@^R (p/ąw-$M eR0 000$ЍąwRs@-ЍpR@` h`PP 7PP :P  ,@P  $ t0S@  ꢶwŅw@-4MPB@U 0U00U0 00IU0 p `P 4Ѝ0 AUь0 U   0 0C00P00U 0U00U0 000$0wĆwעwM-BP;뀀@|TH0h`  XX0@D0PpjHD 0 R4b00Vp@[ƅwnw.wHwvƅwwwƅwTw/@- 0 @QDЍ䘌wRp@-@P@JPU@[pƅwA-`P@pU y[0-SD*Pp 4$P  `PE@ƅwƅwƅw@-\@-[@-[A-`0B>SpP@X %CP 0 DRU(0^p0A/蘌w ́w@- 0 @CЍ@wE-M@@T< `P0@DT7 $0嘦0p喃(0@   D*0 5S 00 3# ᐬZ!3,0d"#-`#3 !$W0@GЍ ףp= ף!Džw@A-`0B>SpP@X BP 0 DRU(0^p0A/@w ́wRs@-H`<@PlRЍp  P/4`@0$`%@ 9Pw`DžwwlDžwRA-`p`9@PP @P0S :a:0PUT w:Džws@-@PBU`-P sQpQpAoPR@`  `pPE``000彔P @D: 0PPP 00SЍpwwȅwA-R2ՀMpP@0Up dP=!P @<:8 P,ЍPPJ`P Pi  ` R@_ @ P y`ܓP@R ד0/l@xϓ P hd@`Ǔ P P\@H忓 P 8T@0巓`P CP ! 3P!3 OEP pE9V7/9<!xpu9w wȅwOȅw}ȅwȅwɅw{wCwȅwåwȅwݥwȅwʥwȅwӥwɅwɅwɅwɅw"ɅwiɅw>wȅwȅwylwCɅwR @-N` ` /@-͚ Ѝ@-ߚ Ѝ@-嬛 Ѝ@-Ӛ Ѝ@-堛 Ѝ@-寚 Ѝ@- Ѝ@-厛 Ѝp@-RMlЍp@00 0 HPP `P 0 Y_ͅwͅw@-力 Ѝ@- Ѝ@- Ѝ0QS -lQ  Q0 S 00S0\0S /ݕwA-PX@ÒPp pT$ `P 8`TA8V88``PW* AHFT00`CA᐀pDVA:Vt t 13`W:X-@pTL0DV0  4"`҅w҅w҅w҅w҅wylwޅwnw҅w҅wdw҅w@-@0@ @@҅wlɆwӅwM-RHM@Fp P@PkpGPW 0-S NX`1P Z65cS qS0SPpGZ 0@>00S0@gP Z   +  HЍ.PZ= `  W  2/P*X (PX T  H@P.WP  W`03? 0 2/Q* f P  \D@\l0Sp 7 dePWE @P,  P  J@PW* PW@c 0  R ŻQ 000<SpG-Ph;P>QE WP Q@QP  08 0?R 0      0BQ  P Q [S0Z0Z*0]Q 0 Q Q@10 0D0]Q0 0 ,:P]. U0*00W 0   0 @ WP 0gS0W0W0sS  _@P >n[ s[W4p 0@nSP0 RS PnR U j 0@P 00sSvhDx0@PP QN0vSBQ0 WP nPpW P`W  `'UW!O2/U H ``D PE@W;W P T`W<aS'sSbl@C@lS W覟 W@ @ PPT  05PP kUPtQ ?\]Tv 0@SS00 X P& 5Q A@TM@DXPAT tP* KP10 3PXLXAnX0@AgQ $`A[X l P)PW LPP0hSSW00gSc@hd7 P @ TX 1-01P0  5O2/010 1 0101T01U 0 1T0$16p&h PW:00z 4 @PW t p n 0O  PG00pSPXN0 @Pt000 0X0aS  8 p@2 0 P%dSv P  P@G@aWP@ PPE +P f PHW U`=t]…wlɆwӅwӅwӅw1Ӆw@ӅwnӅwiDžwӅwӅw-ԅw0ԅwVԅwwtԅwlņwԅwԅwݕwԅwԅwnwՅwmwՅw(Յwwt!wuՅwwwӅw/ӅwwBՅwJՅwfՅwlՅwsՅwpՅw{ՅwՅwawՅwՅwnwՅwՅwՅw օw$օw;օwIօw`օwwօwօwօwօwiwDžwօw^$wօwօwׅw2ׅw߅wwޅw@-ĕ Ѝ@-֕ Ѝ@-Ȗ Ѝ@-坖 Ѝ@-X Ѝg@- @*R 4T T (T0t@A0*S$S/0{S  /S 0}S00M-Pp` PAh  PE XAVP @ 0U90 oPPP @0U0 DoTTTTT@ TM@xw疅w햅wޅwR@-@=P0Pp0 0y3P  /1ޅw 0 0 0 /ɆwɆwɆw,0 (0 $0 0 0 0 /ɆwɆwɆwɆwɆwɆw,0 (0 $0 0 0 0 /ɆwɆwɆwɆwɆwɆw@-3P @,3@-AM M`P F0?@Pp@ @P*@p ? P`V x[@X@h 0`@pLO@L@??k ,$Aލ Ѝޅw,րwnwޅwޅwYw 00S/ 0/ɆwɆw0  RS?/0Ɇwp@-404P@T(@Pp22@DɆwɆwɆwM-pP`2MȡF@[] 20Q p 02 0 SR OS[ SY 00d1Q 3P OP P 0Spd>"Q.2@P@@D 0 @9j+@0@FP   $ 0U0C0P!V`1 S0HS0 #=P2ލ蜍ww-߅wYwޅwp@-@PGP01@oU@ o@lid@P2P 2K @Tu0p 0Pp߅ww߅w߅w߅wwM- `PPrD !@VL V@pPpX P  1LpdxP  1 P`P  lp@P6P`@X 8P 1LAxP 1PЍPP  p|p@d5Pd5%@5 5%P 0# 㠥0555 5#-5% 1P PPz1` v1 0@s0S0''l1 0p v0 `FpPv0S `C1_1`P0d0#000 00N00w0 0}C1 ?1 vP{PU30?0 0P_0 `F Kv`{憳P$V*1 U30?0 0P!1 P 0SSS0#0#0# 3 #0S0C00CS`I~ S` D ! S` ?  Hß Br S` 5  `@P  ?P@ S @ ` & S ` B -   "S# `  N S `  1S ` S `  "0 0 00~0`0000 00Y00000 0`0P 00E pDRsP`F!0Q !`@Q 0 ?Q@02/ 1 Z10S00T X103/P SRM 0\1Q 1 E00#0`0Y00`0 0` 0BS1P00PEd`0P V0`VU d0   >t  0@@rCw߅w/w5wwtwgwwwwwɆwhՀwɆwɆwp׀wɆwɆwɆwɆwɆwpɆwtɆwɆwɆwɆwɆwBwޅwYw߅wRM-ڸ`p 0P0@0 p0PPh0p@Ѝ+:@P ,0[0P  pꠍwɆwɆwɆwR@-$@  ɆwwR@-0 B0 0 K6 ЍwA-P0BS0p ` W@ Pq 0PPS@pWTc P @}0y@wᆳBwA-p0BS"9PP p0 @ X` 0P*U` U``0ɆwR1p@-`9PP,v @r P U0U00U0 R  BU0 R  B0P  /p@-p` 1@1P  U U P- Pp0-SV0e'@19PP 00@ 0SH0@D0P ЍU UV@V 0@ɆwɆwewlwrwxw~wwɆwR /R /R M-@8`P \P p P  P,. 0/ɆwwM-R@ M;@8PPA0ES!􀟅 p0` 0 @pJ[ @ U0  U0 0 S `D` 0 ` P`" @ H  Ѝw0S@4p@hhwwɆwwwp@-P @Q( 0 Up@  wwwM-RXMXP7` 0p=07< 00|7x7@t7p703h70$060<0 P0ӅV=+ @, p0@00-S@! pV @ p@@0-S@ pV  V  p0$0Z  t<P d PXЍ <0rS iS; mSP`  <Pm [ TPPcz PwSP` V p 0T0 RP `  Vqp5< =  `5 X5#P5@L5H5 D5$ VpP pP4UP;00:0@ P":0@ (0;0, 0 `!P40 0 ğ,P  0 000, (0` PuP0 3>02 P  L Ppwp W0S ( `v`X    p " P   Ppwp W3`v`h0 4@0P4$ $0# 0 4P L D < Ppwp W`v` VOp0G 0P   0P,0pwp W,0S  00s000 S.p@`ꄂ0 00S 3 # S R X 0C0aS  0 @|  00C?o2000(0( 0R:o 2S 0( pr' 0q"^  0 S#R@Q!V3  Q!  I HG (00R%40\V3T1P7  0QV2R40 40S !S 0RQ000,0| D<(PuVPɆwɆwɆwɆwɆwɆwɆw맅wFwtwwwkPw@wwwswwwwww5w[wPwwtwwXuwwIw w wwww,ww-wBws@-P`@ \  R 0-Q  R  L ЍpQ0RM-`0hMP4p000404040@040D0408040<040 04@PP00xSP 8000400S ( RwU $0SrU0@(+hЍ0rU0pH wU'W Hpp0 0W .P, J HBh00D @H 0KuP< 8nPpGW 0GSW@P 4 0\PlU0D0@0+P 80@4000T4 0BP,0p$0S(`0SZ 0 000;/0S   0iPk(0Xp 0 ( 0 80`,0p0SO80`$0S-pZ0 ,;/0S   {iP P.0 $0 V { (0X` /T} `v00rU0400@00D0$080 0<0(0 wU t0 PL0 H0 @0 80$ 00 (0( 0 Cʆwʆw ʆwʆwʆwʆwʆwʆwpwwwwwwwp@-@`T)P?.0P d 0xRQ@P :p0Aq ^1#!0*PdppM-p`@ d2PP 0@DSV l0Rd0ST]P00DY* 0 M/褍w ́w؎wSwRp@-@ _h`@]PPP@pt|[80@P44T @X@P@؎w}wlwww@-pMPp@`P*?`?`TP0 48 P0   5b 00 4;0A0 Rߍ Q 00C?w @-]E-@0MlWd0TS!qHX @r00R40TR8",~{^S v(V,VtmŸPP4 P(dQ _]0"SV) "0S" I)d" t20p"SkfPdP`g`O`w)"z8p) 2V(" rh0?d d)V `) !e[)!`V) 1Ua` WM)  R`㸠Ugp0 `Wvpp0 <1WT! =h0S62 </)VS@PP(0S S S  0S@%QߍqTX _00r00R40TR8",? ) )wwww ww%w7wIw/ww[whwwwwlwwnwwww?wwwwwwwww www,wwCwwp@-`P[@PH@pvZPPU0 0VP[>}wR@-@0oR0؎wM-@M , `40P0 0St(@@Ѝ0S{@p0TJ@}(0S 0x((${q( $t0 3 `P 0@S` @01$0S 3# V@0A$0T t3t# xVP 6T@PWH5(@PQA0@P CPn Z 1 0P  Z7  P [@{ Z 1 P P 8P   @i (PYPU01Kz0SO0 0 00C00 0@SP@@0⋱ P  @0!$R@$B0T 0@.<yP0 S@0$ Q $ A iP  cP@0∁$ X@!$ HTTP@ NPp@ GPqp@hu'`/"X؎wawwwwwK:wÅwwwwDwawwwww_w_www0wwA-Pd1 BRT  L1@`PU)  H\;1pP! W0@i0S/M@G@CP`p_P3@/P` )1Y (pw؎wwwwwww@-L@6P H:0P 0S Q5 &؎w"w@-@0BS|MpP`P UP@0 {cXP xu|ЍY 6PP@Y ';P,0T$ $ \T؎w7wfwwwwR1A-@p` 딀@PP 0 p8 XP\2lY0 :P40T, , "T/؎wwfwwwwp@-Pt0`@P 0SP @pV eRP@ R؎wwwR)A-@NpJP F|@j`P 0 XY0 :P80T0 0 T/؎wwwwAw@-H@PXP(%9P ؎wSwR/@-@<0P  P,ww wE-@24Mp `P P 1UT Ud UPl+ PPa1P   q1P   phl0S `b\0S P\L1P {  4S01P r  J1P i  A0S ;U! 4ЍE ~PP0PS\0 0+0l00+00P4Ѝ'w'wCwwCw ,wӥw,wݥwwɅwww+wåw+wʥw,w(w w.w]ZW@-@DM0`p $0 `0VP~P @DЍV  ` lT  `$ 0+u@ 00U$~PT@ꐴw5wDžw5bwwA-p`P@d ,P 0 DS U40Q 0A/܎w ́wp@-M P(%?P 0d`@,@D 0, 0RЍpH 4CT,00H 00],@,@Dnwow:wAwRE-@ ( P@@P H@ Ѝ0<0$ R (Q ,0S62/~ppPP `P+&0<0F(03/0<0,03/W&&  Twnww@-+PRA-@PD`B p-,P 0 A//wQ 0}/00@-PP,M 0 0  0P  (0@T \@,Ѝ0 <PPP0@P#%@\w wwRA-@P0 -R0aS@DP p`V@ TP /8@Pp`7wXwM-P` (MPPEU=@-QG R hUpK lPF [@V0U #00`0C `0 X00 0# 0 0  `APV1;NdQ bQ cQ FrQ tQRG RB Q`R9 [% 0R0S [ @ P $@D0 0`$0P P.#(Ѝ 00 0(tw?w\ww6wwwwwwgwM-@ p P@M` BR'-Q. #U  GW`F@A P `t@0 P0`1`@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍM* @P  b |pX0@O0 0`P P@ 0`PX U  Eͽ | \wwwwYwwR+0@-@ 0Mߍ0|0PP0 l  `a P0L P 0 {0 P /w6w=wA-pR`-P @P{`FV fSp 0S 0 B PPP\w@- L\@-T .\^  |@T aT fT @D* Q |DwR-0,M00< 0  00 (0o,Ѝ/\w//RM-!p@`0ܲPB"Z  P0 P"  Z0oЍB Q ?o2V?o2W000 `v0P0xtp?kP00  00C?o2  00S0  0S00  0S00Ӥ  0S  0S000؃0R R R `&} PU Al pQW~XS00y w@ww P0l S0 X/T SP/H/D/@/</8/4//(/ᚊwowwnw}wwwwwwwPp@-@P P P p@T T U U Up@0@DT@ U| PUt Ul d`\XT owww wwwwwww!wwawwnw&w8wGwKwTw1S/A-@Q!p 0 #4pSPH`(% 0 H1S& C!~=10! S0#!4 !C0 BO#4X)Ѝ]PYP!0wwwwwwwE-@MPC`, 8p, 8BP, B8 PB,98~PD , 8VX 0 Cx W | 0 0`0!00CS8!8!!100Pp(H` 0 `, 8 PЍO8Ppp 7 PPD0 7@P 58P 18P -8P }00 7w=wAwThw5wEwUwJwylw@-@ M   e Ѝ@-@ ~:PЍD0 :7P D0 74/Q/@-M?@?@< PLݍdwM-@D1@!  1001051S l0\+Pp1S@ЍM"0 !$ #!"!T$1S $ `ذ%1SpP*0  +1J0S S S0+10S.d( `wqwwnwww&wwwww$www,wiwOwӅwCwYwgw@-@]w, 7PЍD0 N7P J7P F7P 6P 67@-P K9P0@ Ѝ0D0,@0,@D, 0R60S 6P D0660SDw@-1pP0,w$wR/p@-$P M@sP 30SRЍp cPFn YPU "8n|20Ss  FPtlh <PUL~@4p@P$h  "P`UӳfP\`P Z 9PP0SSESF0Cf0Cs Rx! S0 d@U, PdU0h  0TuP#0$  p@@@@T PЍp@~ 0Ѝp@[Åwwvw3wwwwwwwww&ww wPޅw+ wF w wws wD w w w w w w wf w w,wR[M-RpP`rDӐMU@ 0 ,PP0D00$0 00Q0  2 P  FЍP"HP  0?3?   @p0 1 P Խ00@]/2wvwwwwM-`@2p8@wW&fW@ `WP Z`Pq  1RPЍP`00S20[0W0S`)Z TPD @U0%* 0W ??evv[ [ p@TTP1X#" [p@Dl 0P LwCwDww'VҾw羅www|www4wwYwEwew}ww @@/@- @@@@-$HvP $/ >$P H$S c$ww/ /?@- @0h!h  ` X P  H @ 80!  $(,048<@DHLPT X \ ` d h l  p |t tx l|0d 0wwtwȤwwwhww0w(wwww46wH wd www wHwDwdww0w@w O0Q R R  / /np R  / P Pa R |BQ- OP[P P/ .81@Q [Q0P ~P 1AQ 2Q0@Q     /~P /  /  /  /  /  /  / /vwvw wwM-MPp@n0 PUPUiPDh\RS`@V \VQ [@V \ `S S$ \ R 'V00S0'`$V  R`PE( 0{V(V000 U$ P `@PE@  p}V)V  0HCR S0 <0 "C*uP@0 0PE0S U'VQ`PE 00܍A-`0PS0Q@ SpA"0XW 00C0t00C00 S0000P00C0Yw偆wA-pQP; W@0ЍW%0GS900 0S2Q `A`F , H Y V`F800C00S 0 000 S*000S 00C0AP*`F`V   \  }{`V*00C00S*$A k0 0CS00S 0A0*0 00# 0Q`A 0 S" V 0F R p B0A0 ``X`X`pGpW.``F`&` "`00C00SQj "0 0CS0^ 0S[ x"W0S CqXXPH20aESS 00S00S !aV 0SQRP# @la00C0d!d_0 0CS00S 0 S:  0 00000"P 0 000C! `R0S00CV`R` `FV F0p H 000`V s0p  ʆwwnw w0www$ʆwA-@Pp3 `Ⴗ0V 0Pp`0 S GSCX  000wM- 0p0P@Mp 0S xxß0S `3 \3 X3T3 00W ,(@06003 PT!00U?o 0c p0C" ?L1cs0敧10 C `c2,# / 2#&<. R 0QP 0$ nwgfffaw)w r//"p@-, ,P媴PPH @ 0 p@800C080, 00@- # Љ,P Ѝ8rw/// 0<0 0/@-@- nw@-@0P i0@,fh hivwwЦwCw@-b?w@- (8.,( 0  Ѝwwww=q(@-0 @ @ @-4404 0C0<(  ( Ϗ0嵦w~ww@-̯///////////@- 08< 0 08 0N븐w0@- P @δ wwp@-PP<`@ 4@pP @Tww 0000 /ww@-%@P @@p@-@P ,0S 00S PP 8qp,0 @00 @ R@p0wwwP 0 0 00Q0/wA-tp@ThIP4`V 0 @? 0S ,9P U@2w\wawiww@-@{P 0 wswp@-@P@P !PpP pw0/wA-`ppPU`@40S 0S P@@ TPww 0P/wA-P`@P0 ,p7/Ps@-@P`P `0 0`6/Ѝpp@-LPL @T < 80Qp,p@@wwwwwwA-`P 0pP Ѝ?@T  0P0!50Q20 07@- 0@PP 0   0P df`d 0P < 0 0 d Ѝ0 wwww7@- 0@PgP0   0\P` 0TP @p <+0 0 , Ѝ0 w!w/wAw/0!-!" *,-+!0 10|0 R|0S|$\0@-M@T: G? )0 ) !) P \P0DЍ0R@C D0s)R SmM-M`80S*p@P IdDt@0h 80s0 000`0@ P00np0SP0S <XЍ@-MGP?P`0 pPP@<ߍ $|@  9@eww@- @R@00RQ1h|00  @P1 S|00 S S0 44K@S0h000ꗔwwE-@`pPXM0h d0080s0 00 -PPUЍ@-r` qP  p@P0 00P0 00P Ѝ R0S P    R0 PS s R0  ݕwSp@-ɀ@9[PPp8U 9PES)0  Pp/7|/@-@0wh`K?M0000 0 ```PP C @t07t0l07l0Ѝp@- `MG@?@q 0`PPP ~Ѝpxw w@-@00q P40Ѝp@-0PGAMTʄ^ `V &1S00hqČ}?00r 00 0 GЍp>wQRA-P  pS00S M  ݍ0(?@R`?@ 0P0S08090 0PpG@ QP10#0%*Q?@ M- M@`PPQ 1B`᳀=dPP 0S &0S .dxHEPP9?@?2`P6 0 UPP1 1   :RP 0U *R0U0  ,RRZP*XP ЍR P`P PPPQPg R@bJ Q PpE? 0RQ 0S8 0SW S( Q50SY0 S" QU ڬ h P1U[`S010 G  0%! &!0pu 0E#&! &!0A 9R!u 0%Z( %! J1Q0Ruz|T   n `0VP0hd000 000! PP )PElPpPQ(p kH` f bQ 0 Q 0 Q! 0 ]wlwwwww=wcw}wwwww3wZwxw0A-pM0P`Y@P Ѝ*@PXYd0p00wp  000p@P@V ЍA|@P ww/A-@p`,Y 0S00$9 P $\000 P@w@-d0h00Čqr 00 #0 HЍd0@-M\*)@h00Čr 0 0/Ѝ@-d0h00Čqr 00 #0 Ѝ/@- Pp@-0hMČd0 0@0 q 0 0P`P, P 1S 0 $ 0< <0#40ЍpM-M??`p P@P@ j@܍@S@p㿀? h@P$ $ P@pWȰ@ S@  S@@  , 0}X@P nt ( c< S@NwM-P.M, @P `?` P6Pp W p -P *0 0    01 S 0 0 0R 0 000 90 t1S P0<0`0@S\ S451S2 @0`Sh: 0h d000 00` &P^W&00?X, `P0,980p3 ` p刀 9VKTaP X14dXd` 9VC`Ds 9VC8#0S003@TL0 #0 7p`P 8`1SV0hv`d000 000 0`P.ލ1`S a ]` P PP0  p0` 0 0C!0 0S 0P':_0?` vP 0P:0 0 0갰Რ 000 0P:   00h0@ 0  1  1S (j    P X     q   R !fwxwwvww@-K@9 R  /@-@M0h}?00 00  0 !0P09h` 0h028T 0h0' IЍIp@-(MP@ \410hP}?0 0P 00 0!0PX( 0h0<` 0h0(Ѝp`M-!0!0@R3P0MhD% 0G@A@000h }?00 000 !0`PI 0h0I0Ѝ 0G@ApW  200 S0 0}?0,00 0$ u`$ 9S  00 9,0Z`9 00S0,0Z [0K ,0Z  0pWtw0s@-00@0%0 0$0` _0S {PU0S dP 0S 0SS P`Ѝp1S S wE-@PpQMG`?`> 0Smp 1#4L01M01SPF Z 09,03/Qߍ 0S3 I00020000@0060S 000 0SZ09 B0S$R W "M  L @ 0SSS S X M D L @ x$  pP1wwp@-h@P `00020000@0060S0 00003/`pwM-pRJ `@ns`TTT0A 000`S 0 U{P&0  `岢* " (, (( / %$ 6 R   0 P2/P    00S 0 pGT"TЍ [`wM-pRJ `@{TS0A 000`S 0 U{P&0  `Z( " (, (( / %$ 6 R   0 P2/P    E 00S 0 pGSSЍ [`w@-}? h00Č 00 0ЍM-<"0@ᣁ 0RMX'0 pwh0tp`1?`000003 00 0 P(}?0 00q0 PGX0O? `0gd0h 00`aS ` X}/  YP 9 X  Pp} 00 0 Cp' 9 wPpP P0R0 0CS 0S Q03ލtwwUSBCUSBS7@-~PPU8 Ѝ0@Ppwbw 0 /wP@-($@$P`wwwA-XF`&!1PSp?"10CS;@8 ;pP"1 0#1S 0'PS(!1W!,000 !R" *P 0S 0S 0S 0S 0S! Q" ~!1 xЍ+! R*   +! R*!  .!% 0 Q060 Q %0S0%00 h0 T0$9RP0 S47:03IܓwЉwwXwwwwM-`PpMB忀?㈀0 0 00 ᮠ00020$00060S0 00003/P pWX B0S L0:S M0L B  0S p ܍a[p1 320 S0 0ŵ ⦠ Iࢠ   ^✠(Yb p^0儀2060S0 0000<3/P0??00 ሀD @%000200060S 0 00003/P Z- 000 02/  3?|    d0!QS030#!20 p|wwFw w̪E-MPQ,  `P@QЍ0h_@}?00?@ 0@000 KpPܠ0  0 000<000, ~0 3@PS0 0 p0S000@PH@P nP@j@PpXwwwwA-PP p`$@TV P@P@T @QPM-ppM\ ,0@S 0`S$0S0GM 3/P0SH  tP;$0 S# Pp0pSP 0S 3/$0PS  R 0P2/P 0 PCoUP 00pt܍ 3/P $0S P 0 PC|0U0P0S wwwM-PP/ @p$`V @P PU W P `QPV  (0 ( ` 0 ,00,0A-P0p`@P 0 U  0  $ p` ,0 P@P$0$0(0A-@PP$0` pCP 0`SP -@-M? "0@Fߍ@Ѝ/040/Hwp@-@0P<03/P p@@0/4Hw / 0 rF0Y/ / 0 UF080S//Hw0Y/ / 0 OF0Y/ / 0 000//FHw(0S @-3//Pp@-@PPph0TQ Tp P  H @08  p ,0$  p/HwwwhwwwȤwP0<0//Hw / 0 FP00S / 0 @-P rP0ww 0 /w0/w 0 /w@-@iP0p@-@PS0PP p@0pA-p@P`P | P hP 0 U 0Pw wwGw 0 # 0/p@-      0! Y` YP|Y@PM`PV@,`U|PT6vU@  T V 0`P@V``UPPT@@vpqp\l 00 0p@PU輂wwwww\w wwwHw.wwYw6w>wp@-P`P0@0PS <00S:P `̜PppPU0 SR 0W 0 00 0 `VQPAo0 (0 8xx\$0 l0P\ 00$0@ HW SR !w!w"wnw6"w<"wB"w@-@ 4 0 kЍh"wp@-`P@PT@pH0S@P xp@-MP:@0S+ 3`P$@0 P@ 0p c` 0`P x 0@䬋 P ? @TЍp"w!w0( \/0S/0~w"w@-Pp@`P0avP Ѝ@T~VB`^P0@0,@D, 0R 0PS8PUP ,@4~w0~w0E-p0`8P@0P,PE0, 0RT 0S 0S+P Ѝ@,P,PE@-@`P p P p0S U@ PT Ѝ@- @P 0S@ Ѝs@-P@ p P` 0S ,@Ѝp"w7@- P@P Ѝ0"w7@-@P\ xpp<@ Ѝ0P@P 0S@"w"w0<0S 0S /%//|p@-@P8p@p@-@P<p@A-`p|PP0@ Ѝ0S0S@ ,@0,@D, 0RP@-@P@h@- P Ѝ Ѝ@-@ PЍ@ЍE-@p`0<0S% 0P0 0P0 :/V@0 000 ЍA-@pP`0<0S m0 A/%A-@P`x0 00p@0P09c`P_P1 Y@P P+ 0Q QP) 0 00` 0 0(0S 3/PP 00S 000 0 000@P PA-`pPP@ ЍLnV@ ,@,@D,0SP@-P00 Ѝ/A-p`@PP@T@ PV07@-@0PoP0 0R,0C,0A,0C, R Q0 Ѝ00@-0@SP 0S,0C0Ѝ0 0,0  S,0C0/7@-P@T DP@ Ѝ0E-0`Q@0 p%@PP  Ѝ 冻@P塻WP ,P,PE,0 S@p@-P`@ᑻ0 p@@-0@D   R 廭0 , B,QH, P0q7@-0 Ѝ0@PP 0,0C,Q HQ0 ,007@-@Q0 Ѝ0PP0,0C, R L R0 ,007@-@Q0 Ѝ0PP0,0C, R L R0 ,0p@-@0P0L ?P p@pQp@-P@PPp/0@-@0  Ѝ@0@-@0 \ Ѝ@0@-@0 w Ѝ@0@-@0  Ѝ@0@-@0  Ѝ@0@-@0  Ѝ@@-@000 Ѝ@@-@Ѝ@@-00 Ѝ0@-0@P0S@@-@P0S@-P@ P/000C\/00C 0, 0,00 0S 000S @-@3/P00, 0 0,000/ 00 0S //0 ,0 ,0/@- 0@00S P 00 0S @/3/P @-0@S 000S  00$0S 3/P @/ 000S //@-{P 0 ,0,0C,Q ЍQ00P0Sp@-` @P0S0P P @` 0 0pQ Q 0/p pQ00P0S  0 S/0 S/-^ ^00Q  P R  0P / P/@-^ ^@ 0 @@U/Bo/M-pP@`TX 0S03/ 0 5@`@-@⽲PP/@-0@@T 0b T@DwT#wp@-0`AV@P 0l 44CD0P@ 0S300`@ 0`pDwT#wM-`pTPP U0S W@ 7/PP@-P 0@ 0 0@-P  Pz Pwp@-P@P pw0@-$ $P0@I/  wwDwk#wp@-@PH D0E@C 00S:>PP8uPP4D0 ED0 @D0 |5^PP0S @0< 0 @$wPwXwn$wPw$wwwnw$wE-0ppGoԀl`̠0V: ЍPP0 000U0@ TD`0SU ``XP,@0,@D, 0RU,$wPwXwT$wPw$w%wwnw+%w4%w>%wp@-88 80PC)0',@PTp ܻF%wXwXwm$wXwi%w7@-@LP`0P 4 P 0S0T0 Ѝ0v%w7@-@P  0P  Q1 0%J3#3?&0% Ѝ00 @- 0  Ѝ@-@ 0 PT0ЍT 007@- @P@ Ѝ0PܵU@- P Ѝ@-0 '@-00 p pJ Ѝ@-vP@-ġ@-̡@-_P 堢/@-0 wp P<0@-\MhlP@0 @P0@ ?000|\Ѝ0@-0 n @-P0 x0 ݦE-@R0M0`Pp0 p0Ѝ޸w0@-@PPP PP 06 0\PLP<P,P%w%w%w%w%w%w%w%w&wp@-P$@zP p@p&w@-@mP@&wp@-XP@PD@P P4`wPpP Up&w&wxw@-@0<003/0o/@-`2PPp0@,@D0, 0R ЍD0T00S b0pp,@,@Dp@-`YP@0S )'p@0P P@-D@-P %P  @20/s@-@P `  P P 0(0  S0 ߹Ѝp'wnw 1  @  /p@-@P0Sp00 S*0Sp M-P0@<p P@`P @ 0S  3/@P 0 !031 0@a-@-@4M@0< (0O4Ѝ@ Ѝ/@-@yP@.'wp@-@PnPp Oo0B<0 ^ 0T  p@/T \@ Tp@0/`0 0 8'wA-`pAPP%@@@p0<`0S! = S `0`S 0 S 0  $S 3/PP  0R"@03/PB'w M-P ,@p80P(040  S` 0<00S    2HP Ѝ 3/P@Z<0 LPЍM^wP'wE-@dMPX 0Lp`Lw0T000 000 0dЍX'w/@-@00_ 4p@-@P 0_T_p@-@0 _2$_0@-@ 0__p@-P@npH00pp@-MP`@ P8 >0P0 0 000Ѝp~'wp@-@Pq _0T 00_0 0_0_0p0<00S /%/0<00S /%/7@-P%@U00st0S Ѝ0wPPsp@ @-spm 0 0덫렆'w@-R@- 0 -R@w@T@ T@/'w@-@T#Pr\@-@0 C@P Ʒ>w'w0@-@ ^Q1\ b01130\*0@-0P<`p0@SM0S%3/&p Ѝ0B@p@0 0 03/7@-@00PL0*P@ Ѝ0( P0 R05(wM-(M@p`P0<0S% 0( yP0<T(Ѝ 0 P0 0 0000 00$003/PP 0bP  T 000200X  B 0B"3/M-`MP@0`0<0S%p 0' "@`0<Up`Ѝ0 'P$0 $ `0 0T C0 3/pP@p@Upj@P p@  00 00x 0 3/ Tp A-(M` @pP0 }PP @  0@P @L@T  0 0R;@P00(Ѝ 1(w<(ws@-@P 6`P  P0 Ѝpp@-@00P`Pp0p@ A-0@P-Xp0 038s0.PX{0pwp0W0 0P  0S 0 S0 @ 0 @P @ ?*w*w*w +wB+wo+w+w+w,wR0 0 Q !Q1 z/E- P$MU@ `r n010P0cP @P&p ,0>>,0RPP $ЍsP}EP{PPp0Pl00Q0; PP0 P00 10S10 00 0AP0Sh10sXX70 000 /P%)00000 0 R0 0 1 0P0SpW/ ㈪00S?00 6Q(B PnpP>pUtP00S2PddP00mV^Pn0,w<,wI,w@-@002,0P $خz1P00w,wM-@bM@ PPZ0SG P0PST030800 4<0~PP< @Tnp036 8<00480PP+0 S@0#86ı 03080648<0PP @0DPHL`RD0HPLP`;S-@ BR4  PP 1S 1+000Qbߍ00PSᕩ`PP00SኩPd㼩S?!00 6h* d! \01 p0l00US!  VkUR8| 8?8.8 P0`N%n&3.5"1 0 0 *++,,-<Qtt0P|0\ 40s  # 84<08 036 848<0PP{p`pi`2PPs" PP, R7056(8 PTX0P3050` 00?` PTXP`pp!P03/< 0S081 S$8  800(0 2(07@R! pQo`?`0p07t0@0000$ l⼆$`,0(0P03? pW 03?(00(0(,0 Tw>P7WHsDW0<''8'%4'#0'!?1.?< 03pP0 a0 0 V VFo038 70B/00&(!B 17 PHoB?0㨂ሀB 1(PV` VbFoo`b` 5R0S1p l0e7086 8⌀0P 08@0x00Qo`t0p00?`l ⌀l`XP0F< 2/S Q6 S%P%1q0 `&  ?70V  fVh`1 10S<t0|000 0t 4 4000x`1QR 3 #1200 10t3106 05W ~X0_  s  S$ S( T #P P0 P Ut"ppӪp0100200 20<L4LP0$00LP0  00LP0 00LP0@00LP000LP0<0LP0<0LP0|00LP0d00LP0L;0LyP04;0LrP0;0LkP0;0LdP0:0L]P0;0LVP09 LOP080LHP 090L@Pp020P.w)w)wy.wZ.wh.w.w.w.w.w.w.w.w/w /w/w+/w:/wI/wc/wp/w~/w/w/wD00 @-L/A-@P0 @he P: 4wM-`p P@@P唢 P0$0_ 0__0  }PZ00_0_ 0 00_ 00_0_ 0qQ?@Zb0s0_  P 0 R0C R%@/b_$0 00 s? ?00bR 070s0_S_PuP_?pPE??&b c ?S ji_`_0Aw[4wy4wp@-P`@Pl @p\0v,0T0T00P0 (PwP ,*4w ww4w4w4wM-PMp  @`P@:P `PЍ@0P ,Vc@&PQ 忡00PEu, Q 0@0^PP  V`}ቜPNt 㶜 0AS000000 L PP LPP,H0 $0P , (0 P0PP  H,xPᶶ` `깔w4w 5w4w4w3&wv%w޸w/A-`PpP@PV @P ~b0 000 $ 40 0 C8p0DPH` S00 ( , 0 0S 3/P ppΠ! 80L L0UUPPWPPUpA5w5wwww(wɔw6wZZA-@,0P`p8/P Ƞ0 ,8/P0p00M-`(MpP U0@! 0TPU0V' 6//ob5??oPS4o 0P P 2s 00 N pAP (Ѝbwp@-40@SP 3/ 㯛p@00S //00S //P -,^ 0 8//p@-@ 0S 740S- P+ 0 P H00pQVmPpP Q`h PP V P @00 p'6wc6wW6wonwt6wp@-@ 40S<,0`00  _1     /  00p } Px  d0 00`kk0 V g  ? 0@ [ 0@0P40?  d00p@-P^@Pp@-P 0@T 00 84/Ѝ@- @00P;<@ s0A-4P@U 0<0@00S = dS"<< AR< s0(`,0 `(`P >2@00< ; ;@0 0P*  s0P P  pP",00   x0PWPU AP P  Pp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0gpp@-L@@ p9 P:P  {a@  `V,p m@P{6wE-QPMp LPZ`P :@P  t倞0` r@P 00 PV 0008 h `$Ѝ6wZZ6wp@-P`@q0 v0 9p@ s0 QRp@-,PU 0p@/P@0 ^ p@ p QRA-`0pW A/P2`@0 0S0 A0 p@-@PP   d0 0 00P0pL00L0/0 @ <   0000//A-PpU 0MLPU$ 2`P 0 dP ` ǝЍ VdV 9VV'00V00S 崝I@P   6_X@` \TH 000 000wv%wQ7w{7w7whw7wp@-@PP Pp-P@P)@-PL `PMЍ`P@V  S 0SpYpP p P 0@pP  P#w7w7w0<0S /p@-@L(MP! P0P⋝ 0 R   L  `P%(ЍpP0#100U Y1tP @00P T0 D DDP   ZR0<0403/W)w7w)w)w7wM-M`@ PLp 0S3??o00  P T0"ĜpЍZ  ᭯Q T0 D0"0) `P p 0 C18pP T0 !嗜0 G0 p R! 0  0 prT0 !( ^0' ! P Q _Q@q_ Z      _\ P_ _8w)w)w8wD8wq8w8wA-P@XMDUL T0   0`p` XЍL )p P  PM P 00 0d`P T0 0 0<8 p P)w)w8w8w8w8w޸w@-@-@V@p@-P@PP < @L < 0L< L < L< L L L&L%PP020ĵ  24 P 040 0=s  0C?o=r20S,00,00=s  0C?o=r20S,00,0ppL9wd9w|9w9w9w9w9w9w:w:wA-@,`LT$LP%LPP(LPP(3 z pc0 P2SD09D0#0S0T0S R(^W(/PT(00< 4080 0 Ѝ::wN:w`:w)w)wo:w@-@0P 0S @/%p@-`@PP 0S  0=sS 0=sS=t 0p@/%ppp@-`@mPP 0S 0=sS 0=sS=t 0p@/%pp@-@P0P 0S @/%M-P@BP. 0S+  0p=sS&0=sS"=t `V `03/PP  Q VX@DT@dA%PPA-P @P* 0S' Up$0S @ `V `03/@P 0S VPPU HP 0Aݬ붕%@@-@&p p p00rp  @$0 p@-@P0P 0S p@/%p0 cp@-PD,0>2@&pP20S&0S $0S%0S{ 0S,00,0p4=q P&p p,0  7Q2P,0 Pqp@-P|p00 &Prp@-@PL`PL pppr0 p``  PL  @LP  ЍL:wN:w:w:w:w0S /A-0`SR%P PRp@0 S00 PP  puS0CP0SqPVP є00C P ʔ000:wp@-P@w p@@-@o@@-o0P 0S@-d0P  0Sp@-@RPU0P  ,L#$0Pp@  Rps)w'w@-CP@-=%00p@-P`5@)0U00C00 P hpp@-P@ p@^@-@@Pp@-`@0S%P ,0S$@ 00SP (@@T@ePP  ͘p:wp@-P0S @ 0RC$0S,0p%ppp@-MP@P& 0` `00|L$PP0 1\L `)PV 0V,0 0$00000(0 Ѝps)w@;wG;w R@-v/r;w@-@㉿@P,,h 808 0<0۔w;w蕆wp@-P8`@8@D80S@p[P 8@蕆wRA-ЍppPKPXbX{@PR8@D80S0! 0 %8@8@DW @PW '`P0V:R P I`PW U PP H- <0`PW =p9 sܑPW (0Sė} ͑P( 0003/ ‘Px寗$0S 3/(00St 3/qNbw蕆w;wcw;w҅w;ww;ww߅w0>w0Q L0<0 0S ///@-@0_T @-@0__@@ @-0 _ _p p@-P@kp $ L+PppP>w0_/p@-@0_^p0_pPUp㵐A-pgP}\@P`U: =_0_00ŧ__'000_0_0_00p@-D@P_00_00_ U_470_70_90_+00__p@-* 0R$  _ _ _ p@-P@}U0@}3!03h}+q0}3 X030.#4 0S4s0R70?0_0_U50_00pn;Op@-P@P Lpp>w@-0_U% _ 說A- @|L.ppLP`\`LPFa@LP` >w>w?w?wM-M<Q%PC 8`p1/PP; U0S g @0 / 0D0 10 00Q!3á0  P!32@4;0( $07Ѝ(Ƃw,?wn;Onw8?w@- Po 0@,@D 0, 0RЍpPPE0S8  0PP ,@,@Dm?w?w0<00S /%/0D /0SS/@- < R Ѝ/ 0_Pr Ѝp@-@` 0P0"! #! !R0S/ 0S, 0S) @`!P$ PPPp+! R* ^ +! R*!  .! 0 Q p p/@-0S@P0ǠČh0`}?0 000 㤫@P 0yЍp 0S@S @0 @?w 0Q0 0 S/00/0P/  0@//A-@peMt0OP?P8#0 0U U0h0 `3 0`0Xeލp@-@PW p@@-p`NP @P  Ѝ~ p @T T0#8 S0SP@DP000@-@@-hMČ$B @ 0 @TЍ-MG0?00000 Ѝ@-hMČB$ @ @ @0©TЍ0@- 0 0p@ ЍIA-@M@@Pp0 0G`?`0`x0w @@0 ЍA-@MG`?`0@@Pp0 0`0w x0@@0 ЍM-M`Pp0@0+w`P``0 㷍x5 0G?0 0Rp J/o 0""fp Htp op Z hp C 0 IpЍMv40?0 0 p9 t1 o J  < d 06#p 0 p 0P0? 0 p  zSZPЍ p rS0@-MG@?@P iS000@ Ѝ0p@-P@0p@%p@-@P@@@`0 pp" Pp  PTXkP ֌2@3TU U T (^ɌX Ѝ?w?w?w/A-eMO@?@`p S0h0 P? 00P_eލp@-@P_ p@ @-`WP0h0 ?0 00;@@P HPЍp  Q( @Q @A0 S @w#@w@-@MW`?`pPR0h ?000@0 P`pUЍp@-P@ 0Pp@-ph0@Č?MW`?`BP0 0 @ɧU ~RЍ@-@ C7@-,,  0PP @ 0P0@@T  Ѝ0m7@-P  0@P  Ѝ07@-dP@ @P  0P0P ҋPUm Ѝ0@-`@Pz 0%p 8 P $L ЍP*P,P> 02P >*P 0 N0P 0 0㈋ 0 か 0 8P  Q+ Ѝ@$@@wX@wv@w/5A-ReMM"WP?P:p@  0Q Q Q0h0 `3 0`0eލЍp@-@P p@@-p` Pa@P  Ѝ # p R@T pQ0  S8@DS0 C 0@-@'-MW0?0 h0Č#0  q 0 @0ㄦPЍp@-0`@d0P4 8,BP p AP0(0pp@-@Py` p@30@-MhP 00 00ČW@q?@0 0@?P00Ѝ07@-Pd@E 0 ZP:m Ѝ0s@-@`PP mЍp#E%|PF @-@. ,@A-P`@pP F^#%E XAE-@P@` q0 0S'(A P: XP  4u`0V00 0 0 0 0 0 Ѝ`\0!܉p0 Q0S (Ή P:@BA-`@P0p (00`P ,P0` dVm`ЍdV  `P Pzʉ0` dVdV (0S@咱b` Pb080S <!= !  0PU 8PO*lPI lPC P= ," P5 P/ }P) P$$"rP GlP!, eP$ P ,YP P `q ( I`P$0 :$09=  P0    <  hfP h) `P$  $  $  $ p wWP名P 2p3WX X W 働倍@w0?w?w?wp@-P@LP @p0 00 $Lp0 00p@w@w00@-  P@TN P@TF P@T> P@T6: @T0  @T*@ @T$0 SP  0 0^0  0P   0P  0@o000A-P@,@D,0SD0,@p4<`<`F<0S D0D<0<`C0 0<0(0S /%/0?o 20/w@-0 <@T% @0 4/ЍM-0y `< 0@ 0[% 0P0 0@;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-~ @Ptp0P0,PE, 0R t~d0 00 Ѝ>0P0T0S` `~P@,P0P0V0S@ w@-@T ~P@M-p`'MM@?@pP%-0M0 9,i000$YP . GPTG?$ 0 <0 2$P&09LH00000PG0 졟 !Jq WQ0!"0 0嫋 < P *  07P$ z]$ Dpp \P 0@0000 gP 0 0 0W0C0 'ݍЍ U D0Pp 0P$ 0R 9P Rp  0P0P 0 P0$0$0 0pÆwpÆwpÆwAwAw޸w7@-@PLV 03P0Q Ѝ0@G Ѝ0@C1AwAwQAwfAw@- 1 ~ @P&OPp0`,`F ,0S@,@D,0 S>0S@Q @P U8410S@ Ѝ pEP,`,`FP~ 0oP!00 0P q q D0 0S|,@D0 0S p,@,@D,0 SwAww~AwAwAwAwAwp@-P@`Q,Y0 00p@譣%-kL,Yp@-0000SY/wQ / h0_00_h0/00_0S/00/P A-`pP@_t @T PU@--!R @00_  0_00p@N꠆Bw@-@tT00-1@A- PpU0 0E2`@@+J0# al w''l  0?`0 0P?JP諪0@-0000CS @ ⑤0 ;((50 00Ѝp@-@?`?PI P0@J @D^ * 0RPCىpp>Bw@-0_0_ 0 0Lpʼnm蠆gBw@-0_0_)0(08p屉m蠆Bwp@-0`_0P_p@00_ 0 0P` tp@Ҭ0 1 _ _00 V1P_*0P}=Pp꠆Bw@-F@M- M, Pp  ᥡP00]@ Ѝ U``'?S`V@P `0 @0奱PN 0 `0C03@0嗱P>  J J301l0'320 03<@00S.@0??H0??H0H$1SqP 0 000HH:P$10$1 `@V 0` #   0 \Lo   W0  AQ00# 0 p   0  P 0`0# 0vP 攅wBw@ M-`P@P$10C$1岃}0@ p0W 000UH$1S @ꛃZ *,`@ca_4CwA-P@0p  0`P $O{T3?@P@pT*,5m@W, PЍaCw0, M-M 0, ?0`S000 1o0媢 0 0 0S0S 10S03@0\PP\R`  ~I zI3 010l0w,07 0@0000$00S@  @@4X$8t0|,!0=1R(9  R B/o "601@0  1@S@/,0'320 A 0p7400<,0S *b 0pp R ,4<  802P80<  冇ኬ3  @@0Pp 0pSP @8000(p0 00 0# 0J80Z@0@ 1S  3# " @ 00@00p2G0 (0-G00 0'G00_?0_ 000_   0_ 0)@2p4 Z(?S㈃CD,CG (G G0倠0 ,CP:$0@@0F00_@0_ 0 7yph00_  _ 0 X_0 R00S 0??FZ ԆiPI!0@S0 S S0 S @"0 0 PS0 l   l TH90C0 ᮫0 P܍CwCwCwCwCwDw!Ϡ\ 0e/M-@, p04`$?S T4S:S0, 0 0@4/r P S P 0_ R 0*0D  1;1Kl_*0 0 $R R R R.   0R R 1;10 000_ 0:0 0 0 0`ЍMwDcw4w8DwM-$P@p`[UVW00P0S@0U0  F2012412812<10001S20141S24181S281<1S Xp`DAP0_00_ 0 82hpu @1Sx00_x@`` bF0@0 :pD0@0PPpTpX0D_0` `$MFpppD 1SP T 0P !P0 S D !_0 0_$1    $  "$   $  "$ 00_00_ 0 00@0_0_ @000_0_lQ(!nx\kPns3/PP _ 0 PwwwwwbDwNDw@-}0S P p@-PiL@0H lPPp4H~P00 A~P ptDw|Dwew 1P   8<< <<88@ 448/ @8<<88@0@0  0 08l08` 11 11@008408( 11 11@008܉wSA-p`@P`IIJJ&J<AH01aa/P P VF`P |Ѝl_10121101~100x 00k`DwDwuwM-`Q5 p0S1 } P0S( 0 @D T#@ 0R }P0=S P@D R !/ET: HdЍ@Dw0/Xw 000/XwE-`p,MVP0-S =s}@PL%V0S $Ss0,Ѝ`F0S fS9p _} V@ṨP 0   BQPZCd0P00000 p(0r 0S$0 Dw\w-EwwGEw@-P0 0 0 Q 0S< < ~Ѝ=w@-@ւ@@-@M 婂Ѝ迥wR0P ( ww0@- 0,M@ Pᴫ0T 0  00P (0qP,Ѝ0 TPT\w7@-P@P 0S Ѝ0@-@]0  0 0 0 0 00@-MP@P HrЍ0sEwp@-P@PRpwEwp@-P@P  p@ㅂp@-P 0YPTP1S@-@o"?w0 ww @-TPT@-@P p0K%`` 000@ sPD0DЍ@F ) ЍEwww\ww6w@-0P +  %0 rЍww\wp@-QPM`  C/F@0P x)Ѝp@P0/P @@@rPP 00 0$0$币Ew\wwEwEw@-@M`P T@@p0`qP404噁Ѝ @\wwwRhEwM- MD`[@p 0$SV0{S` SP`P[00@P 01 EpPP 0{00CS   0/oU(01 Ѝ 00S0[p@0  { pH0 B [0H 00H {00p0 [,00 @0@\wd΄w Fw FwFwwQ/@- P 0000C,0PR긺wкwwp@-P@`P 0Ot@`S@5 2 <03/`P(uPSPpt*v@PFww@-S@P `π 0ST %!<Ā@3/@P 廀帀LFwiFw.Fw?FwwA-p@`PP W@ tp @(  R 0S 3/@P51s05t51s05R0pS@wwM-Mp`@z 00M  _ #KyP4 (010 P pMz 0 #KyP fV zP 4zYzPP (zРKIP Р  :wFw|FwM-PPP p,Yz`P$`zP+ ⽥@P Py:GzPP sPsHzP  7/PP  V ⚥@P y @VPPRP0@-00@M PH 0@P 0S@ y ߤݤЍ0wP@- 0\ X\@@0P D QRݕw0 /@-@,,q $$r n\w4w\wFwp@-@yP ,PyP @p pwFwp@-@yP ,PyP @p {pwGwp@-P@0pmw00@-| ,M  0 00 (0@en0S T 0 ,Ѝ0yP P \w7@-@P0 l0S  S 0R XR U  :RPU@ Ѝ0RA-P㌀@0`S|pPP pdPPT P Ѝ P:yP  lwwXGwFwM-`R0d2Q@@VPp% <"0HS0 0 00S ,0  0 R# S00S00XS 0V@ VF V[ 01SyS tSXS0S F0Cs0S! D1 08~ЍY0C$!s023 00  0S Z  .RZR8P 0 y~ 0  t@ FP@@@  Lf~ qxP 0$ nwzww_Gw GwGwGwGw0/A-pPD D00C`Q,@UKxP`XwwXw@-@,,+p $$ \wwwHw0@- (M  0 0 00 (0@m0S T 0 (Ѝ=xP P  0\w@-pAMP@, ~?0`S :0000P XP Aߍ P xP P00pwwIwHw@-@ H@P !Iw/E-MP@`+P6 m0! } ⢯P*p  ⃯P" wP pS0p ?!,\ @XUTPx}@?sp(n}ЍMIw=w/w>IwnwfIwIwIw@-@PL ,P8 ,0  PЍIw JwwJwM-MMPg`P <}@ݍЍGp?p@P$ s@P '}Pb| j?  ௏PE P`  ੏0 ҴV P@0?Ywnw5Jw SwwM-MM"p`PP/ :P1 P-t a? zPEPp tO@?@0 ᙴW\|+PP 0@(@80U ݍЍ `P[JwwNJw///// /$0 P D PD//tw//////0/w0A-P0 0pP`|@pU 0SSP0S 0<3/P40 ,0pЍ`VD@|wwtwwxwA-`QPt FP@dpP`P 0P3/P @D0 <0`3@TDP@w|wtwwxw@-@$03/00w@-$0~03/@w@-$0q03/@w@-$0@d03/@wA-PD0@Ub00`0 0`6/@ЍwM-@p0P?04p8``p0 ;/@P SR {@ЍwtJw7@-l0P@,0@3/PU 40PeP Ѝ0$0 0 000ww|wxw@-@H<0003/@gT0@d@Ѝww@-@P00403/@Pw@-PP`p 0` Ѝ0Sd}{`@P <r{ S(l{p f{wJwJwJwJw@-$0803/@w@-$0<03/@ wp@-@0P@0`3/@P 7{@pwJwR7@-@ P@P @ Ѝ0  PRYwM-P0BS8M@8ЍRX s@P {@X $_{$0 `R 0SX 0Xp0L L{XpEE{0(,Prd ;{` $0P0p00v!0 2/ P04 0Z0(000 p07/m  u pRDz Q W 00W00S3ppP z X  X (000*"pwzW 嶝,0(40000?04d !l\夝X墝P(HE0mKwCwCwKwwhKw4Kwnw}KwKw w)wwwYwp@-@0BSRP PU Pppp/Ӆw@-@ P@E-P0BS@$M@ @P @$Ѝ oz`jzZpPczP5u0 00p@` (uVP!pyU d)000 q?, !!l$ /mKwKw w)wwp@-P0BS@` *@P@00V tpywYwR @- @P @P/R@- @P ;P y/KwR @- @P 2P/p@-d岜`@XP`VTH婜D姜p0S T:, Yy@DPKwtwKwwKw@-R@`@Mp᧡PP @ 0000 0`,@P <Ѝ!TV@@P/w00_?SP/(wA-PpP`fP4@P sP PЍP0 _P@ PP _w@-@P@07@-@P0 8P 0_8@P _ Ѝ0w@-MP,0P @-ht/w F:@-@弝@M-`PXM0x0@0|0($0x3D00 00 0 b0000 0L00c0 $0 T000T000$00S$0000V0S LXЍ0 $0 0/0S D  @032@0 @k@0@P400D00053@0 @k@ ?,00 005"8 4 Rs 0 pP 0 L $  }00 s(0L @P00C40 C R0`  R  B  @PD 8 @  @<0sk<0D @,P[ pE Bp T& s  R@   Q  0pF0 00,00,00 0 }Pg 0 X3p0@s 0 lpPU 00C 0B FS V9@w0M- rM0`0P0 _Pw0@ R 0!0R:@  P@P _tЍ- 9!0R*$000 p 2SE *!P; !*00 0  p@ 0 $, 0 P 3: S0 S9C?o 021@08H .y<$ *yl @&y1"@0140001@@wHP <P 0@-M(B@ uЍ0/wwE-M@`P8OwM-M?`pP@% ?0?0F011JР ??R РT'K10  0 P 0 Р!`P@DQሂ P1`P@D !?0?0F011HР?p?pg1 1 PРР @-\1-  \  P(o L\! hOwp@-P@ 21000Sp@p0@- 0207400>0020@q00 0@-PM `A1i@PЍ0.SpE @TKiTiP OwA-pP`A@.TT T <}iP a0DS@@PU_@TwM-@p`0P RU10\R/R   \Q/Q  QP 0Ti@X T@0@@00P S@ .S0S .S0S 7i @UP0 S .S @/ӅwM-0PS`G S SAtpAH0!āp@0S  0 S C0p  Pp000S$ S S !P0v`) P5 P :00V` ``A0@p@H0a0@`S00 060 0Vb000s00 040 0Vd00000 020A-P@T 0 S2 S0>T*`PAq b@p@-P`@P@ RpM-XMQ Q4 !@P`800400800 0 00U Uj 0 Sn Sq?U?S_0 S0 1 1TU0 o P4S8H0L %* P P[* ,0 S" S/  R [+ S2 S?> S# H0 P0L  P P [*0SH0 0 L /@ o@H L  Q  !* 0 RP0 R RQU R" R/.R @ 4H LP8p3`1:4pP8` P,  0 , X0  ,5, 05 R 0    ! 嶡R     ##00?(00p `x' 0ĦS(0 `0S 00 `'1P x/ 21P0pS 0`0N x00000W(0010PpT`tP?P0$0T0<0 0(0$   <0咣*$0"$0  $0<Ã>#/R PK0pW0 ` 00` Le 1P: . 1P/x0 H0x0 00 L` 000,0 00H`0L`P 00;* R2 R?0UO*0@0P0NDlXЍP `D04 i.4 !D00P pW( `   $ Z<   P R2 R?0Su 0 S_ SRS_ ~e00S0 00 00 ~L`H[-`P `H_0 S &810aV1pps'0P0 0T00&-PP0Q0pd20W 0P3l q R2 R?0Sr ` ,PPy_0ï p S  :0!x PQ00 0  0 0 S_ SRS_ |0 @RP0) x !P0)     R x p0U px00 S2 S 0>S p`0 P R" R .R 0p2U2#*U?#:wOwwOwH-0?0?0@0M`?@x ?@S- kP 0P0K H\fPP 46VfP  RPfP twwOw!w!wA-0S ` pQ 0Q@%  Q"  0BUP!m -P0100 S 0 S  1 S:00sP 00 S2 S?>P@-0@SP 020C00SЍ0C0 M-0P<1@P(@Ѝ0 00$ (0Q %  R@ @ p @p,pWO*0SS00  ,0D #0 s0Qs0/o"X R,0<1K ,0410p  0 Gk0 .0`0 s, 0 [00p0` ,1S,! S0,1<1S< ` 0P `VQ ` VQ  Q ` ` [o ?e  2,H@Pd M-@PK0`SpP \S/S dPP0S /S\S0S  ERZdP0$  $0000000SR E P <_dZp1 p! <cP <1 S  cP0 0 0Sonwwp@-@PKoP <cP0Spp<1S cP M-p MB 30s0Qs` @P ^+0D Q0  S 0@S` Q0   C0R02 0*` R R 0 S 0 `00?o2 PuPS P @00U$` 0 C0R0 0  /+0PES @DuP ?0S ݍP 7@-P P@P=0020C0 Ѝ0M-@Q0M@0Ѝ` p *.c0P.S P   0 S_0 S000 4P h "cP@  bP7Ac@$A * X*_o ePE0%  h ,cP` U P *0 S  00\0 h P P X 0 hOwONOwwM-M@h`PpY `Ѝ R RW 0  0pS 0 SF00 00py0S60PS 0 S/0!01 P  *P  R" R/ R/}p 0020C00S`P @-@pM0S txMh0pIh3 0C@P H?h@pЍ ) @2htwOwOwbwPwPw0@-`P4M@ㅐ@P PP Po4Ѝ0@@-`p@4MhPP @ lP @4Ѝ @P YP @P 0 00@M-PM@@pP20P0 0 0T 4P0 0L Y0P 0C0 $ PA @H Z3ᴃ0UP` U P?P@0Z%0U0PS0Z000 00c U  00?@?0P0 0 0 倌~ PЍ  P@ Xkg$ Q QT*0P  0P0 Sg W PU  S00 ) I0 00 00 0wP@$0 S2 S?>T*0S 0 P0 0 0  0S @[0  P0 P$ R" R/.P* 0   PU 0 0(P@u$0 S2 S?>Tl*0@1PwDPwA-P`@h-@P P P }R(b,PP RPP@ 彋ịp@-@` PP# -2(`1   1d 1@ ! 000 0!`pp@-@冋@胋/0@-lMP (u@P000 00RflЍ0[PwM-@ZMP80 `ᐡ唱'`0P 0 ( $(p`@P hP (Ef@G8ECZߍ@嗎@P  8P` 1$  P  !fhP' 0 00vu  R0Q 00!81011 01080p 8P7 e P`03, PPQp g'0 S01 0!( 00 !, 10', P ywmPw@wPwPwPw0@-M0B@FЍ0A-@hM0 0'``@VP@e P-  Qp_P|_PlePPP0 D2  PP pjP  iePljhhЍ0 04 80 &@峍pP  8TRXX!xEe0@??㓍P8 0T0P p0  RQX4peP$0S (0 0  R X5PP P@@P PU:GPP@Pw/ӅwnwPwwPwQwPwM-@ZM8`0 i&H_0P0@P, $ $p_@P hC@P 4d@P@PP #P` 2 @  EP  d@嬉8媉ᨉᦉ Zߍh@P h @d0S( BP Dh^P 4h^P PZ#@p %0 S010!(0100 !  &q!@??崌@P0  bP  % D& 8 %+ R 0< R303?0 0 0 p@p "dx< 0 R#(#s0< 1 R! 81#(0! 0 0p@p P Dcu-Q@mPw@wPw'Qwonww;QwGQwPwPwM-MPPcK??@ ML\ʂ\*Sj? A?0 $0   0 P 44c$0 $ BR 0( z%( `p@DT 0 c  ?0?0@0M?? 0 _ _%Р20 RZdh0a@ 0 `v  0@P$  <%SQww~QwQwQw/0@-M@l0< 0000PP 5/@T Ѝ0 P P 0SHwkw@-0`P 0 0<0 `@0 4/@>T RT TA P 0 0 3/@PЍpA0 E Hw@-P`0S 0<0 P@0 4/@>T RT T AЍp@0  P Hwp@-0 P @P {$0 <0T03/@`pHwA-p`PWW `@P`W]ЍY0<0@ 04/@<T0 RS ,P Pb0  @ B‘0 @PHwQw/M-pP`U@# *0&S4<0S~b Azb㑉P 0p0000 0@P  p @P0S 3/@P P y Y&ADPꨉwPwXwQwRwԈwwkw@-@`pdPp 0 0p07/PU Ѝ@-@`pKPp 0 0p07/PU ЍA-M`P$ VP@@ A 0S0'&pP&AЍ@P  a0   0 0t&0pP &AP 6`P剜@P A1Rw;Rw0@-@< <eP40( (]Pa&[wCRwPRw]w|RwRwM-p M@尰  @@ 0W:1" 2 P p| `P P  PP $@0  V+0S Ѝwkw0A-PMp 0 0ܡ@P la APЍ`Ё0PQ@0( 4/@T0P@$ 04/@T$03/@T(PU 8, P: ,00S6 0 !0 a0GP @P* `* *V  0  0  003/@*T0 03/ 03/P&A 03/|*RwxwwkwmwRwM-@Pp``M‰0SI t0@00 RR00S0 SM< @PG0$!0 0M @P= 2@P7@00Z !8@0400P,080<0 0, 0'P 0&AP`Ѝ0 H08 0B ,I"0PS`kwkwwRwHwkwA-` HM0 P" l, .pPA  4o'@P  ]`0S }PU Q`UHЍ40 @0SN0SP0 <00f @TrQn 0 00~P 0 @wP_0000 0z.@P/6@P<`0S DZP@P PN  D! &P @S0S8 0  0P 00SgP4@u00P a @Y)T dSP <@<@D<0S:A< \_`APAAV&AT="wkwRw6SwmwXw(SwkwkwwSwM-01`< (1p 0 0 00   0}PP@P 0S _0 00-@P  0S  @PЍs_l| -PPlk_:A E⨀Zg @P HwxwkwpwNSwoSwSw4wSwA-`|pD7PP@0T  @=+ @@@ 0PPU&ЍPꂈw="wkwA- p|, P`9@P&Q  0Pp 0,0(@l-PЍkw4w@-,M0 p*0 00S-@P ^,Ѝ ,`P P P 07P 0 E B Y0@0C `0+-@="wkwSw4wM-PhM00 00PpP@ хPP&A 000 00@Pw0@000 0P@j0 @0$@W (*P&A$\ `p0 $(:P@ V\@ET$B,P ,0"@q* @,@P 0 T 0s%P 0Sd ` d5YP0 S  ᤅP ,0`00 RYP00  &A$<:T `0W50':ThЍ0@P 0[ 0S@ T`P`0 00dTe,`P `P 0 4TW,@pkww="wkwkwE-Mp)PP ]@Ѝ 2@P] P `P8t]P:A'V _ 03/ITUpWPp P`@ᵂP ?  0"&0*&T) 9 P#U垂 @P 嬄PPt]&A" 0 3/@ T @~]ႂ P,x]@Sw,TwHlwUTw!Ww{Tw6Sw000 000/w|wp@-0P0@3'1'0 00 00pwww|wE-@РM00p SP` 0T <#Px0@  0P @H0 T   & 0 Ѝw|www @- 1`MPp  AQ0 pP 0 N @P P 0  P \&ЍP|\{0p0p0 f @^T D\< 8 @P @wwkwTwTwwTwɅwp@-P@`T(P (\p` Ppp@SwP, 0 /S 0S/wM-@xPU  P0 PP品`pPP 0S 0 傁pw40M $0 000oЍ/www,0M@000oЍ/wwM-pPpp@T 0DS` 0 0``00 3/0 S4`8w(w0S/0S/-l 00CQP 0 0  ^*   0(wA-`pVQ  WPPU Q$@P&Q   00 0 0 @0 @@wp@-@Pk mp@xp@-@Pb Vp@op@-P`YUQ@@V@T A 5\p@-E+ S@-<Q ! , 0 0@wM-@(`P 5 aЍp̠P U0S  000 0 0 000V%0S0 P pp0u00 P 0 ppiw@-1% p@-@P $ ps@-`@P0 00C% Ѝpp@-@P [$ pp@-@P`0 $ pp@-@PQ#p8w0/w00S/M0Ѝ/w<0S/A- 0@S p`PUPU P  UPP P  UP<0S  P P: A3<@S <S 0P  W V036 V @ #@P@ (0 00"P0P `p0 00 Ѝ`ws@-@`Pt2T 2T 0 0000 vЍp !s@-`@PZ0 0000 bЍpA-UpP`吀@TdAĂ0S 0S (, U0:80S S080 @0040 (0, P \ UR0 /0Z/\ \|P3 0 0 0@0P 0U00 0 ZS  R   UQ 0 R R R0&A-P`p(,@QU ?oT20S !ЍT T TTT P :P! T 0TP PU 0 @S M-M HPP p Q @P W`  @P 0Sy=Ѝ0S RV@ {@P` &QW`00 S/ Z 0S y @000 00dPU:Z* 0VS 0 `6/Q&0 }W Q UPQ `00 ;/Q Q@ QkwM-p`P@ TU`V 0S 0P NP @#{PP@&aV  0S  (  NP ZT `@D hQ`Tx ^ QR !@0A-Ppb0 0|@ETT ` 03/@:TI 03/@00  ЍkwM-MP!0P A0' ,0 0`0|@T [:A=TU 0S:AVp0F"p0Z!:FW [&@Ѝ P    0 0Pp Z: R Q  |Pp X p W 0  0 Q @pkwM-` PpG@P0S@ @P 0 0n>AЍ BRQ @@0x00 P0P @P 0V 0 @@wW 0RA:AA-`@Pp QXR 0PPpQ 0R>QPTwM-P@py@P 4y`Pw&Q00@:00U0 y  PP  PPP <PP@` (}Rw&QHwlwlw UwA-P0,`@0V; 09 zPp4 0S1 U P (0 @P Ѝ   0@P0( WU@ ?(  0"&0 *XjTT40p0 AU J00(wHwp@-@P`P ?(, 0 #6 *4p@0 Q 0 S ^0 0$0wp@-@P{0  pA-pP A `P@T  LP  pZQ  00SRAVЍ_ 0e@FTP`0`F     J5kw-@- ЍЍ/-@-& 2 ЍЍ/@-`PM! @P  Q p 0W0WP@P 0PE    0 U Ѝ-@- ЍЍ/-@-  ЍЍ/A-@Pp 0`@P  @P 00@-P1LM0@ 0@P LЍ00 R000S j0 0 PQ0 P @ 00$PP 000p0   T0\@ 000(03/n<0 x@04/ewlwwHw0@-PM\@P i0000 MQ0S S VЍ0 80S M803/6Q lw0@- 00 ЍwA-@p0000 0P `V0S S a _Ѝ00SU 0S 0SpWX00 0  P 0 "0$`PPUP2 SPU  1:LlwwBUwp@-\ @L L0DBH 0DP$ @ 0(0, 004 Ywnw?wGYw0E-CM`0p P00 @P0 PPP 0 q Z@Cߍlwkwp@-@PUT00 A X >A P 0v@pp@-P`P@TA$ pp@-P@ 0000 00000000p@-@`@]g@-@M-0MT0pR0X000P`2&0  $Ig$P\UXPP he<PjCi@P 0AЍPfPP&A P@;P 4f2fP0S @PA  0RPAhkwRQ00P0S,p@-P0@SM X0> 0PS @`P Ѝp0000$hP H0L0 H0 L /p@-@PbT Q  PPP Pepp@-@P`L @Xp@-@AT A X0@>AKA-pPM@`0UW00V0Sx00S0T0Sq s;P3hp/:Pp0) S5Z:P P0SC *0  00 !P0P@S0 00@@Ѝ 9;P"@0Q 9rP0)S*0!* * 0 0 0 !!2#rA <;PA0Sā00A AhkwxkwmwRQ@-00P0S $(`,P00C 0@ \^600 ` P@P:Ѝp @-M8P@`p|U A  @PP @{Ѝ@-P@`a @iЍp@-@P@`@_$p0p 7/pEWQRe@P&Q N0$p, 7/P4U00d ЍhkwQPM- q(M P0`SP@`R @BP`0ShP`dqAd[`P `8 00)ppV`1q3d5+:U-  d`p ! H L8\(80 SH00H0 PP PH0L 0 H0L p`)R q pPH0 L Q$00@P000$hPH0`L0H00 S L05*(Ѝp@-@PT Q  dPPP Ppp@-@P` Q@ps@-PP0@S` 0`I0`0H`LPЍpur ^P`Pp@-@`PV 0@bpM-M@PP Y03/PAU Ѝ0S0S @T`pT 0S0S >3 03/P0TUPE&dP  K ` 03/PcU@ 03/00yYw@- 0@  Ѝp@-@PpA-p` P@leP (0 0p0`P&w$ 0S/S0/蘆wp@-@PT8 0 p0S S00p蘆w@-@T :@-:p@-P@0S pPU/oP"U&pp@-P@~TU p:pA-p`@PoW. 0SUP'V/o"Q!:A #1 Rh V  X S@A   A蘆wwM-p6X 0PSPWPU > QЍ``#@@D0 Sb`/`[Q0 0N0p@@DwM-Pp`U 00S0V0S  W〠@ @D0 S: B8P 0 $0S* @wp@-@P`Pp 0 PPIbp@-@P`Pp 0 0 PP0 P P5bA-P` p @T 0 ``$bM-` 0@4 8 <000S@000 SS 0#0C S0 S  04 8@ AЍdPP  0 P P 0PT 0X 0\PX(cPP\ cPD ,0- .40-7P ;  0pt 0x 0|pX0 P 0PZ 0S SPPP0S S 0 0  !R 0p&A a[a}a A&AK &AbPP PP 0 40 X$0 $Pu $( apP  Pa&AW   80 pp 0 呲+ݖwwp@-`Pe6 @5PP;PppA-@`PpT P:W R U RP  PPUM-`Pp xV P: 0UWX@x   E`F!ap`P 0QE`0ab@ T  P 0U0Ua cpPK&M-`p@$1V eP<:TW00X0SP / 0 F!`P 0AD`P U  HP @@ @0t`S@*bP&A-@`pT PP : @PU  P 0S:0aFQU 90@S*M-`PpV P:W @@T@U@T  P5@@Z0T@;p` @Up 4 :5`@XPPA-Pp@T` 0 pp0S_ ___`@-@ 0 000@_@-@RT P]:XA-P`p?VUK Q(F`x0P 00 00000 0@ 0$02&QwPPp@ '蘆wA-`@V CP:AT A0PpT0X0\PUL@0 SS 0C S0 S  04 8Tjw Q@- @0  Q 0# 0AS 05:YwA-@ᬀPU`0VP  5Ppt:(  Bd :T T:(00T*8D :Q $: :`0wlwYwYwYwYww?QM:\ <0 Q:P5PR/ /M-@ M `PPL# H9 ЍQ 0S 0  R 2QA00 0t5 2000 80@P 9& P( BV`1(0 0(0000! 0N/ YX00T00E??>V0 @,00(`00Sj 1Q40 0/5 2000 80@P (0 0(0000|X PR R 0H(pG@P SP PRp"&P Rp ,( @    p p p"9/0 0"&*>>(!00p   GR= 9.swYwCZw!WwYwow ZwYw7@-@P  P 00A Ѝ0lw0S / A-P0 @4 `8 <000C0 04000C0@A 0pW 0R: B 崀R:@ @P0@0C0@@-@pP`PPP P:^PP  \ V P J0 0Q0  Ѝ0 SP P0*///0@-x@0S:0$ P&,* Ơ P  3 #P 3 "R 0S:00wM- M@@0D0T  00 0  8$p0`000M_PP T$T %1"0@ p`p`$ 003@3T 0 QS``0` ]F T   0$  0&#*60000"6":& 0X#3P#\@\ \X` p`1p1X*: R11R 0: 0 000\X 0( 0 *60 0S #6:"& 0$ 0^P 0 0S aa#6:"& 0$ `V0 p&fj'v@0bi\& Ѝ0P@0D!P@014T0 `$P pƠ 0&ʌpWR"p W(,p(, WZ $p P0S00  0S $P0 0 000H\@P0PLP@T P  02P"@ww$4wwlw@-P 0 0"&*#6 Ѝ@-` ASr0PpP P P( 0 --@P& Ѝ 0 P00 : +-@P 000 pP@ , @-@`kPP :Q Ѝ0p * V R  0,,`6 Q n,P vwiZwM-_p0#03 f'vjz(p0KpW @@W0@3T Ѝ [0* ~P@ wP@P @ 0{ @PU  P %VZ"6"&  00 W R &fs@-@R  Q /@00 #fPj 0 =P%V 0,, PP%! "` @00Ѝpʑd}7@-@ P $46P Ѝ0P PwA-@P P@DP0S<h@ d,\R8`4P!0,UV  44 6 `pcDA):ʑd}wZw@-P `P@ R( S ^00 T:Q(Lp @ W(@DU (p000ww/s@-O`8tP  B B 0"&*0`g<0< 0  B00`"&ZЍp8ww@-4M\@P&0 `P0p `0pPL00000`P(0|0|`$0x0 0p00h0h0d0,P0\00X0 0T00P00L00H00p4ЍmwmwXlww4mwhlwmwkwlwИwkw(kwkw kwkwp@-h`P@T P  D#0P 6UU0 B}@w(lw@-@-@- P  0$  0 10 Ѝmw/M-`@pGP'T  V R QЍ1p1@1P0S'Rԁ`V'0pW.0S ` R`P0@ 0@ |1@DDPUOl!l1(0d1,00P 0S \03/E` &,*  Ơ ^`PpD0\  # 3P 3 "R D`V#3\ 3 "Z`` 0R  0wwwwwwww wHw@-PPP0w@-pQM@TU@PPJ@PM@PJ8a@0!,,` @@P=p  @p 0*P! 0!0!00p@P(@P% @P"@P@P @P@P @;I.P@DO.0 040`0n@P ( 4@ЍwZwkwww҈wZw@-`@P V3 : _ 0 3 V ЍpZw@-P@`dPT  P .P d & P _0` 0 0S0]Ѝp Q Q-Ptw3wp@-@`P7@ 0DP \\\00p@8tw@-@ @DP@,} p@-`P`FPE@@pm @j T@@@-@@DP@I @- @C 7@-@ 0 S R0P ?P [P *P7PU Ѝ0@P ]P@ -P@EOoB UUP ]P P@ ]0P0P  R@$@ Up@-P@@p@-@pP`00 0 00PT00 Ѝ@-@P`psT A 00 0 00?@w Ѝp@-@P`] @ipA-@P`pO0 @Z00@-P!M 00 0000 00!0 P @P3 0@0!0@P) 0@00! 00@P 0@0 d00! 0\0@P  0@0!0$4@Ѝ0 t2wkwww*w>wXwZwA-dP`p@ P  8-P 0㓄$@T PvwA-0P `p*P@ W@P 0 P 8W00@Ѝ0M-(M 0 =YPP& 0@p0 `0X30H $0 00 $:P" P W (Ѝ$p 0H 000 0 P0 00 000 00@ 0@D <0  DC 0@P0 @0UbEfiVa0@-M 0@P`P(DD 0 00@0$ $e@Ѝ0 UbEfiVa4ww`M-`P M@  Ѝ0QS 0Z0[0S@0S r0S  0S /@PpT3TZpp0U 0 DQ= Q"ZQ W: 0 ppW@QR W@U00S 0 R 0@ P :W! $ $0000400800L0www wxw@-FPP@G@-T@M0sЍ0 00( 0g ]P wPw0@-,M @P$@PP 0S000AU,Ѝ0 0@0!H 0ҴP $0RP A0w[w<[wI[wE-0 M0 @0 Ѝ@  1RP P B`V0@U#* pX`` 0S%   =P !` 0 P `v0 P 8H+P 000`Pj[wUbEfiVa[w|w@-MsW@PS0&ЍGP0(00 h 05P!RD;0?USR uP!Ww<[w[wj[w@-$00 (x@[w0Q0 #0w@-4000( (0@P 0ЍwlUw[w@-@-|p@-hPl@p@TM-MpPp8`V@P&` |Wc P[  PV0 00RPM h0T0CP0L010 0@  p1h pPTV;0S8  ,<1V$041(001,0,100 0<00=080 >080 0<0D SH @V 0 rL   ` Ѝ& _h0Tp0CP00P̲P #h l0Pl 4P kwmwkw0VwXwZwVwwmwA-PPp> 0S6A00S2A, ` R  B- <#0€"\ :,@A@AApj0SS 0 cPIWA3j0 f AA-PPpB ` 0S"A30S6A/0S2A+ Q A- <#0."\ :a,@A@AfApij0SS 0 bPWA\i0 }f A@-@ P 0P P P Ѝkw@- b@P Ѝ o {@hT  P0mwA-@MjP Ѝi0&S! i0 Sdo.0000} P R ,!_.PfP;P4@<@D<0S00SP`i nPifi`cip WP0Sh00  09P`*P &<@\w\wwkwA\ws@-@ wnPiP SP Ѝp'iP 0&S h`lPPRvnRQE-ppPpW  Ѝ`@riPhPcWP h00 0X P-P@@ SPKihpP0 P-a\wj\w@-.mP Ѝ0m////////// Q00 Q0S/p@-\`@TpPL0 0@0t0@@cR,006 00Q000pwwwwA-@T @00SLPpW@0@`0>0pS  D00D000< Aw_w+ww@-A-P`p@UV00W0STA00S@000CSNA 00^0@00000000 A@-@-@-p@-PU A @0@T RA0D@0<@@0 pwp@-@`Po T A @00SNA SA VD000D0@0U @ ipwM-`0PN0VS00U0S AR@00SNAM SAJ <0SJ 0q0 ,0 @DT AOO t@t@Z S  Z(0S  R00S@@ !PA3 5:0B0 @!0 s 00bR000CS 080D000< D0ЍAwwwwwM-@`P p$(?o2 V0U0S6@ QA.[ XZ00 Q0S'W   0? 0S4 0@00SNA SA Dp G=(0@@D00D0 Awwp@-PU A @00SNA SA@= 0D@0<@@0 pwp@-PzU A @00SNA @<0@@0@}pwp@-PeU A @000CSNA @3<L0@,><P<@0@A`p 0D@0<@@0 ww@-@?T A @0 RNA RA C @+<//p@-p@`PP -QPp- U -K$0Pp-BpwwM-;@P (R0cP,s,S RP ?? RP@  P@0S X mR2P  @P@| @P{d/.@PuPH2`@ 0@2$082@(002,0,200(240$280 2<02@02D02H02L0 2P0`0X0; 0Ud002/>F12121313131 3131313131 31$33>(31Q -0pQ h!P0@P T* 0DQT 0,!40@P 0@P Ѝ@O@O0SO80&AO*0@OTwwwwlmwkw|mwbw4fwfw gwewawawawaw`wXbwdwbw_w_wgw_w_w_w_w_w_w_wgw_wwwl`wp\ww\w\wWw@-R@P Ps*@ \w@-@TDe*:Ѝ0*005P Ѝ@\w|wE-`OopP( 1BV@W@T @ Q`V 03/ Ѝ0S0SZ`Q@P [`Pp*:QMPPX0 R*Q00 3/P00XmwHmw]w7@-4@P P$0$ 0  0PP Ѝ0 wXmw'wkwlw@-r@@-`P Q @P%):Q U@ U:A0 00P@Px  00l00 0\ {@P P)ЍpQ 03/P:Hmw]wXmw'wkwlw wA]w8lwXnwl]w@- ;@P d)Ѝ LY 0<@ 0@ P@P )[!WwHkwXkw]wp@-P`5/Pp0@2S$P P I5/0@?S?0p@0FT5/0@?S? @5/0@?S?p@Pp P 0S P00///@-yLp@-@LP 0P0qwpwQ7 R4 P006@ \03S,P-# PP=#=0µP6P=ౣ=0µ ?0<<@Ɍ 0 00?0<<0? 0 000/7@-P@00SU Ѝ0P p@P@PE P/0S P/7@ Q:6@ Q/!Q 00#7;AP0CSQ/Q 0S P  6@ \ 3RPñ @@%6+ 0P 7 000//PQ7@- 0@SP 00S Qp?PEU0 Ѝ07@-P@00ST Ѝ0P @7@-P@00SU Ѝ0~P p@PEP P@P@@PQ7@- 0@SP 00S \p?PEU0 Ѝ0P00A0@S /0 R/R/ wP00a0@S @/0 R/R/ w@-2p@-@P `MPP@p A-?P?`p Br@\0 7C X@!`$*6L Ń ;,à#? S?0 00S0 S*#?0006C Q1:7C Q?03:#S?0 R/0A RS`000S?00/-(0LR0 4#00p ʄw0 S@/p@-`P@ 000@TD0@000pA-@p`P  00 0PUT0P@0 @@00 00A-PQp `p @X @!v!0  B!P@ g!@pM-@S`M 0S@XЍM  PkPЍQp[ !P !P  r  W  0S ZPp 0S \kP P~!PU 0X ! !n!P}wWwA-@Pp I0`00p Wt`p0  < ` ` ` ` `!0000]wM-@Pp` !0000`0vVd` 00 0W 0 Q 0 |K 0 hE 0 X?0 0 0 00 0S4 00000]w]www]wA-@Pp2 0000p0Wt0`p 000`0000 (00)`0 000000000000000M-4Ppb@` 0 0p0Wt p 00 0 0  0  V0  0 00d0 TQ0000  붅w]w]ww]w]wwA-@Pp` E00`0Vd`  000} 0wpP 0   0l0 000000 00 0 0 000  0000www]wM-p0@`'P MP0 pPQ i0 3/[`(  0 00 V$ V( U$ `P6a U(5Q 0` P0000A  Ѝ p|w]wA-@@MPU@@Ѝ `0`<` s p N@T WL E$ 5/p@kN 0$  $]w]w^ws@-@PP`ЍpT Q%PV 00.STT @0S@`V5s@-Q @`APT -%pT @0S@VЍp0 @- \ 0sC@p@0@-?A-pP@ `UTU@@Ѝ 8/PP@``P@0Q/M-@P`M pT 0P0S`V8P` aT`VS:V00 7/0PP0S@P`Ѝ `  RVVPP`0H$0` aT00 0 `!R 0` 07/0P`0PP`0P"^wI#IM- 0M0@000#03P00S000@0 0@$@LAPX  T(,8(0,4<QP@ ,@ QATP<AP @RS1:B @ Q402<ĠAQ@`PAE p @D`PQA`P<ƠA @Q *``Tp҅ ƌ `Ad<Ġ$@`pCV(@PFT*!B \ L B  b S! 00L0 0C 000B 08<0Ѝ@pGT@@P@pCT0@CPP`0@P0 `P`00x@T$*@@@@PEPpCTP0S0!@%*0@@0@E pS0@@P@pCT@SP@F@S@@F@S@F@@CP@PVPp0 ``pW`Ⲁ`0@ pSV`'t``Vp0@D@/ <R@D@QA   GDV^wt^w^wM-xM,8P@Q@,`Ap^Xq^[ 㲰 Ჰ x@DQ@DA@TQp@ᲀxJ@T^ [P^p@ZᲀpxWPU P P  x# t# ^ xpr^pᰂNPP  T @!T!1*  @/o"$ % RP#$ P2Uz* B(  Ap `@ Pj:Tk:@D`@@@@`A0 p45 @`@```4``0p`VpAKP@@@x@PDU@Dt@TDE Qi ,@ Q%(@ P@T RP A8PlpP[(uP\P`$PVPPUP @PQPaPHEQPP! ! !_xЍ@`PPFU`LR ( \  p0a@A̠ \ ! 0P@`Pzp :ww蒅wwP 0S @- @@4 )@@@ S.@@ @ @(@,@0@8@<@l P L J/p@-@P$ 00 0PS (0 0$ R ($ 0%3/P U0Pe0 E20/U0P$0 (3/00p0ES0$P40p@p舅wwp@-@P PU $0S 40S 7J $04(3/( $03/ppM-R` M HpP 0P?U\EPE@TLD@D+Q( Rpp5W#W0  R0t'22`S3P3@0P@V?U\EPE3 ЍV}GW=0pG00\\\0 \  \0   \   \ 0  \0   \   \\0 \\\P\ 0 \ 000 0 0000P00@0 Sz3Pv3Vm@0`SS@S@ S@ S@ S@ S@ S@S@S@S@S@S@S@SPS@@P B@U P@WM-P0M$( @T% 0S0S08` S 00 000

Z 00 0000000Ѝ0S 0 U+0V00S {$> ,2u0 P0`W  pGeP0 0S 0 0 p&2Q =000S =&b$ 00Rp=5PE2:  30 0 0 P4 0W 0pGePUv0S` = 0SV$ 0   ,b"P0`0U 0S`0   ,,`P0`0U 0S v  0&$ 0   ,bP0`00; U 0@`S`0 P`000 ' @0W1!Z R P  A R R 0 B0 ! 0  @0 pG 0C @0S+0@0000;g W" K00 0S P 0@ R02@0505070S W0  0 pGS E 0 0 0p0(08`Sl0L00T0/>0T00 l0p0P050h000`d00h0 8 P6cPE0 h0h R/*TL 0SWp 0pGePP P{Pl6c0EaPCXWX pGePPR6cPEF30000S5 S>l0L0 0T0l00/T00pl0` 0P0t3fl0`P00X0X00l0d n0P043U00EF1 WR8T0L0S BW 0pGeP0&aPE R@ph0|  0h W pGePW pGePP6c0E cPC0 0 0p08`_w`wE-`0DM$00pP< d(0@P @DЍ PP`P0PE_o 0C0pRP00S 0ST@00C000 R0S p ww<`w_`w@-`p@Pp 00 0 Ѝ l0R3?  2/R 2/R /4R$ R s/// /PP P($// /08!QF@-@04OTB 2/R>T<:1P9Q7 2/PQ3\.  2/R3#RT\# 2/PQ3P 03? 030#Q030"S\ $<Ͽ 3#Q3 "/  03?0#3@-@(>T>^($ 2/Q/0A-0 P`P 0p 700G@S0 p @P 0S DP @@@ P  02/3? R@S@w@-0Q Ѝ P@-0Q Ѝ P0s@-Q`P0P@@ P P PU000ЍpU 00CS0@@T@Ut@0@- 0P0S Ѝ0@-@0 P0SSЍA-@Pp`PEPT@ 4P @p@-`R @PPp 2/V:pp03?*03?0CQ//7@-P@ P P@T @ Ѝ0P @p@-@`PPPUp0U3?`03?0pp@-@P`N0P. 1S C0S U03?S 03?U0C0 :0tSU0e 0SR !@P V@p 0V@00 / A-`pP@ P}P 0 3?2/ 0 3?2/ @- @g0P  0  A-`@Pp0P0P07@3?@S@/P @U  0U@0A-`Pp@P0@0#ЍS `P 0U 7P 0S  @SP0@S  @0 ZS@p@-P`@s 0p@@-@[P@@-@bP@M-(`p,P@XP@ PP  1P 0W  P[@Ѝ @@->^\ 00 ЍP@-Pp`@ 0p Ѝ@- @P 03?S 0 0 03?S ЍA- pP`@P X  1PV00Ѝ03?S P 03?S @-Pp`@ 0p Ѝ7@-\ 0@PP 0S 0 0P 0S0 Ѝ0`w}`ws@-P0@`BP0 Ѝp⸅wA-p@PP.0`/SP  /NP HPP @PT:T 0@/S / F2P@@ 0DPPp@-P@W p@A-pP@`^PT Ѝ0SQV0S C0Q?0Sqq @- 0P Ѝp@-@P Ppp@0 B0Asp@-@`P@P p=P P@E-p0 @P` ` T`#*J P U P @` zP Ѝ`0@-@000ZЍ P p ,0`$0P////nw`w`w`w03?'S<Ͽ Q 0 3?R  12/P//p@-@PpP5?S $ 2/PU40p p pp@-` <Ͽ1@R  QVP!P3U C R :0R L Bpppp@-`@"2PPp0@D3?23?0 03?23? 0pp@-P`@Pp$ 0D2/ 2/$ 2/03? 0pA-@P1(p(` 30 16o7p$`  12/8 0 0M-(@pP A `6o `P 1P PPB`0  P15_0k P& 02/ 2/  c`U 010  0 P V   0 3?0C0C3? 0Ѝ05_07P0pM-Pآp@P` 6ob0I@P78:;p ЍA-Pp`@P P6o0A (@A-P`p@P  0JX p P0( 00 0 0 P4O@ Ѝ00 0@@- `P 0000V0P0S@   Ѝps@-@P`P 0Q   0 ЍpM-@PP10 ]P)p'   @PPp5_P`p 0P40@ ; n4 `0Ѝp@-P`@ 0p@p@-@P<PpPp @<Ͽ  p@0M-`Pp@P(03?S$@ 4O@ 00 T P@T P  @P40073?$0pЍ 0(3?Z 08V0#03X0S 0 S@0 B (070402p00@0 @-0P0 S 003?S 0 Ѝ@- P p aw@- p誶w@-@0dP 0S@4OЍ@-@P 0$ 0`P bwt 0/nw0@-$ AP  ow2bwM-PM@p  $P@`#0  0`R/X  RR  P  `Pp Ѝ_⸅wA-Pp ]I`@TЍ0 0/S000SS   PV`0@⸅wp@-@PpP0 0p@磅w7@-@0PP 0S R Ѝ013?1 @-0P ЍM- 08`@PPЍ0Z0P p0ppT:40S8X% 04 U0S  0PPZ 0 p 1W:40UX VP0P#T 03?0AP@-@0?P 0TЍ  Br/03E-pB00`%P  0!0q1P:40S JV@  Ѝ@A-@`pPPЍP00 0,0 P(0@-0\ 0ЍM-0p@P(TP[ ` 0P  01PR @t@@@Ѝ /D @-@ t塏P t 8P@~wЦwRQ/M-@` A, @@R H P 03/P0 [EPET  W DR@ЍPꫪ 0  Pp@-@  P @P op PpP 0 Z pewM-`pPM U@ @Pdߍ[   !0PP!0P @|FwA-`pP@TQ  0P`1@p@-`@P~6|6 0 00 000p-P 0 /p@-PQ 0S@ 0p 0p@`<$TQ `Q 00@\8P 0 pwA-@PPp  H0 `0S/6-6P U(600wM-@`PP p@0S \0 0 0  0S   P0 000@wM-(M( P@' 0[2#Q`!`3p0P U H0X0C?o20u0< V PA#p0 0 0W0 00CppGV 0 0 0sGUP s  P0S2 PU  T05/P 0"0L0(ЍPT00 0  #P 0005P P000S 00L 000V6 } P10S& 0S  T0 #S>@0< SSD0T*0S0380S@0@C80SP  P80080 QS* \  C0ZQ@DD0 @`0< =SSSQ @S <PS   P R =S @0X0 f@@ P  @<0SS0S  0 d\SP0 0 X0,` ( 000K00p00K00Sl ,g@ xPa wewewkewA-P`@p0S* 0S@6/P @-P`x0x Pp0h00` WU@E0D @0ES@EE  Ѝ襊wnwJwkwfw0 -M   ЍwM- 0< b3 pB>>3  @T  ЍM RP52> ` !B!b6; 00P 0UP5RX0W U ;A?o \20 S PE 40 0@S P,h U c  w+fwfwfw6fwM-PMp@p@SPt`@@T@x 0R0305 : " Tp1` pZ 0@DD$V%0. S  P00H C  PЍU0 1 U00s0s00 0T  `0@  0 ewݕww>fwM- MP@@Sp`@zPUtP001(0 ! 0(  1CР0$0 $0 0P0n, $ 0 %0,0@Dpu0P  K TA-@PpT:`GV`! @P5A-P`Qp@&df0@P0T  T # 2RW :pW`0?@ OP@-/Efwp@-`?P?@4@P    p0 0 /ݕw@-@0P 0C40S *000C ݕw 01# 0 BR /      M-`P (Mp Ԁ0S(Ѝ 000S  0  ( 0@  h p PT ?o@c(014 0D(0(,/Tofw4cwfwfwwww@-|Q ЍP0 0R  #6 *0{ P ! w+wfwM-@@ `P p0KQ90 [/X2`0 Rm 0BSj 0  ^`@ [S 0^P @CH^ [PX0C0Iw ЍVX NV S 4W "A@  ^ S0!  0 R0c 0c00X AVZ3Q Q$ @ @@P0R 0,S <@CR  00 P ` 0000fw0M-p@Pᶀ`AX& U\  ^L3# VZ @0 @U@00C0\ 0 LN0M@-@ B T 0 000CQ^M-,a0 0P0 0ᶰ p{'0a[*  R :Z    B@a@ T T 3R K pG X* # R@e @e@  0p 0 0\P @Ѝ 0P@  @U@Dw w@- i @@0 ;fw0ƅww w/p@-0 @P0Ppp@ mwp@-@P`  =Pp0p@ \ w p@-0@P`  vPp0p@ H wM-P@or@X <`0<P0 #!*U0* A@ TA-|p@P` -p 00 E0 00CRQ@ Pw p@-0P` @P  p gw p@-P`@P  p gw  p@-$6 P A / P `` 0p p @8P010S 000P:000 00CPU0E2` K    H0DT l0S w>gww@-p`W @ VP:NNUQRUå WQ Rp`LL\ 1!R  E-@ T@5`PB\p*Z0 X X T@ pW @00#P R00P0 S    /2S0 "2/igw2S0 "2/gw0 tP/mPSP dP 0P//D n0@S 0 / / / / / /wp@-P`@" B202pM-p@0`4PQ* t#0AS0 0 0 0@0PP 0 0 00 0@P00@U0P JRPЍ0 eP000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00@ 0 @PP 0 `0 S   0 S h 00@o0 S 8 0 S R0000 Q^  Rz0000 Q^n P_oR@^P PE_oR[ 0 001@,[ 0 0!00C0 ꣉wݕwgwM-P`0@p0 00 PЍ00 P M-P`p0@0 00  P 00 P Ѝp@-P2 E0CS 0@20pgwA-P@Q`p0S 0C0Pl0hfRPE `20CS 0@20gwM-@P`p200 .R#R R: 0b0QE$B Q \RU ?R [R b^R00@^R |RW M002p0CS2 20000Ѝ b \Q ]Q   A0C0 RD12b @ {b h0 0)S 02 W0!0St0*R  ?Q00 K 8PV0 K괄wgwgwgwhwhw7@-P RRRRR0^0C?o2 2x@u00S0Shfeo Ѝ0E-p M\@` P   0 000 Ѝ0  PPU00\0SR @-h0@@ P R P  p "r RQ @B/ݕw  @0S0/@ Q/0S0/ 0\ 0C R /R/- 0^A \S  0 S00\0S / P0/-P^\S0q R0/R/0 0QB/A-@`pTP P@1@D" r00p@-P@t@0 SRpUp R0  \C/p@-@P %+PP@pd0\/- ^ ^\ A0 R/^^ R A-p@-@P\`@T 0PS0PpP 0S000wp@-PU @0P  0pP@-@0S R sb0A S/ P/0A-@pH`P DPU@H@ PPE qP/0\/ R/0 0@s@-/0<# 0m Ѝ 4@- R  @-@@@-?!!@-@@  @0LT3#," !4ׂCp@-`@P@P 0P:pp@-@ `-TP1P!@Tp耖P/0 -ddQ S0#$R0#R>2 -0A?o2 0D00ݕw!/M-P@`P5 V p1 0      01   Ѝ  x  pM- MP @ x pd0 ``TpPp-0 :5P@@U Ѝ wwhPwyw 06#8##/ܧw0/ܧw @-2'&'0 K@- '-@-@- hw 0@-QRQD0!6!Ơ! 5a0Q001c00000 03a 1001cQ00000M-p P@` Q`*M`` !bRR&8`""f &"e&b0  L!  e&b0  L `#bf! b0`00 L`L  L#GGŧM-`M`倠V Z `pP@ / S& r0Q-p@D) Z^ ZJ @ `r 2 + 3,30+p@Dp p@DQ Z@D@D 0000Q0@D4 W Up5P R U0 3 5 ZPX PX  E R  0 PZ/@D@DP 0 8 @R5 PZ/@D@DP R5 R5 @QC 00S ZQ 0  RZT`ЍR 7 B5S50v}wA-R `(@ ,0P 0pS 3 5W T'ЍV… 0C  S U00E@0  0P0?S0%*"0S 3 5pV 0@D00ꚉwRA-``Pp@0 0 CPPP  LPTDS50 APP @ 0D@D@P@0 S 40 C5R5 BhwM-0!0!P#XM`0%0S  R V050X030H50Ft%S V05p@#-S 0S7 0 C R p "00C \.0.SP40P0 C R &*S)P%@P0+S S #S *SppWpg@@@@@@7#0pC:#0CP00C Pʯ0zSgSLSP xRbR"%R XR V%03050pS- X0ƅp<ZS 0h Cr 1" lS lQL0P Pc BR   0 S50 BRW0Gpgpp0`V0405 0` FRWpGpp`PCS50lS 0@p 0 00US ISg MS= DS wp @!@iS[ mS1 aS p a@000 @R0@up üP 0 @hp  wv0 0PP@@T30#s0 0:00 ! SQ0S  @@0@0 {@@0@@4S 0K 0, $0, @$0KQ*  S00.0lS BS  LS  [ 0xsS P0@ 0T pXЍ Fp+V 5 @ ERP@@ lS ZS hS LS 0  PEtS  ?00  @0 0p p 7wݕw"wBhw@-@(P8TD -@- 00 ЍЍ/0 -@-   Ѝ Ѝ/@-M 0@P E#ߍ-@- ЍЍ/0A-@00@K@ wwjw< w 3wE0 0 0 0 /3wt wp wl w 0 /+w/ @-0/+w @-0/ ,w @-w0/,w @-k0/+w@-{P  ?,w@-T@0S H0H ?00@ ; 0m00@৆w w` wx wp@- u@PQ 0S*  m@0 p0P +P &P Q000 0oD 0@ R \0 d00S <0 P0P *'D0@0 <0< Bjw\ w+wKjwOjwRjw+w+w+wl w3wh wd wt w3wP 00 0/3wt w0/p w@-@P<0@$0$ ?0C#30l wh wd wMb@-P00w` w@-2 Q220S Ѝp@/ @20SϿ2|0 S? s 04?s0S0P 4?s0 BPP \Q\ S S}Ѝp@) SP BRr?\\n 0Č0Ͽ4?\s0P BR_`0dov`VXVV0 @RR0SOPJ   01 0SS00  ;  0 4?S0S/ 0S0S0S&Ѝp@ Ѝp@S0pP`FV:04@ <?@s0q4/Ѝp+w+w+w槆w䧆w+wWjwt w00?P ?PP//槆wp@-0`@?TO Ot@Pᔸ d?T@/Tr0R$ 0 p~ O@TD @0 p槆w,wp@-P @r `n 04S/r0R$0 pqQ 0ą ą0ĕ ĕp,w@- E @?0S400| 00 ?0S40@0000   5 1 P Ѝ+w@- @` p0  t@ X 0P s0@?/O0 S4R$@TD0 @ Ѝ+wM-pW. P ArP`+`Q, @R(0 0 0t (0@P@P0`L0PH0D0@G<0Ѝ1` wwwwwwww@-  Ѝ:@- P'wP@-0P 0@S00  !  P 00S 00S  Pep P h`00SPH<8uw,wtjw+wjw-w,wkw+wjwjwjw@-DVsP 80 P $ 0 @5w+w0kwP $2M- p 2b Ppp#t6@PPoЍ0011U0 rAhP1 0P 1@ Mp \1 D1 0R m ! @! P0 02/0S0S S% S0p0P P@t@n R | t?rp0p;r UU @X?@,w\ w+w+w+w'wwl wh wwNkw+wd wVkwYwwwA-|`P@:P pP V P ,P  0@0D'w@- "<0R80R4 r Ѝwkw0P 000C S@-pp/p/ @-0/䧆w @-0/槆w@- 0 +w@-P@ 0 +p@ @p`0 P 0P?0S40PPPPT0``H0Pp40 Ѝ@,wkwCw` www+w,wwwwM-0@S S Ѝ 0 0R 0 Ȱ0S +Ppi  P PPP` ׵  ӵM PH PPPDPGP` ᾵ЍM,w+w+w@-1ap 0 BPRm  ,@ @1!0@2|"#p`1@p0 L0@S 810S $p@D@1!0 T 0  Ѝ+ 0@0?0, <0o@, <0e@, ;t0[@@` w,wbw ,wkwkwwMbfw꧆wkw视wkw,w,w,w+w+w,wkwkwkwM-$(P Rt@Q | APR U  R  R`E  RE Ѝ PDd H $L0@0V4 4 ЍM;E P #p00# R*00 P x3p08"Q  00| Pg<3PVLc prX p^ C0\ "0 00"0r Q袟 R00000  ЍMAQ0Ry 0S0R0S$rH2H 00 KQD#002PE 1@ 1 00C2#Ё 4* [/A G0Z0U-*QP p?T!P0H!00@@ 81  JQS 0t@0 RVX 0 00 /r >0?s00CSm,w,w,wMb,w,wkw짆w꧆wlwkwwlwmw,w,w,w,w,w6lwDlwflw,wMwww,w'w,wwlw wlw ,wnwLw+w{lwlwlw@-\ 000P SDD@8B404+,00S@,wwlwlwlwwMw,wE-B0S0001oP b)oP Z2 oPR PQ*?0toPlb @QL00u R,0p02rB0 0P "<0R80R4r | u 1!0S 1 R 00# |t tA@lnQ XhL!p 81841@Y($1p1 1 {mE 0 0@y-00 @0p0@ῲ,0 ЍE9,w꧆wmwmw视wmww)mw[mwwomwmw+w,w ,w+wmw,wmwkwnwnw ,w,wCnw'wbnwqnwnwwnw,wnw,w,wwMwHw,w,w,w,w,w,w+w짆w@-(.P/ Ѝp@-@,P0<003/ spp@-@ . P P $p0Spp@nwnw@-@PD00<00SHP+0 0 0 0 0 0 0<003/P&p@@ ownw@-P+`+000@ `L5P@ L5P:0<00SGq HW 0     ;  0 0 0 0 0  ;P  Y U R ~ Ѝ  0 0 0 0 0 0 3/Pxp 0 0 0 0 0  H$( ww@wow.owWownowwows@-`Po (.@P &+U 0$,Ѝp /@-0@S@(k/s/0Sp@-@P PU  (/,`P (t/PP@p,w@-@P@@D0w* 0P,w@-@0S0@-`0 PP Pp(H-P0@ @ ЍU*P pA*P ,@0,@D, 0RP 0SH0Wow@-P*@-0PD0*00@-yP vHp@-P*0SD0 0@<003/Pp0000ppA-`0S@00l@|lP 80T0P0S tPP @;PP`@00@@pP @P @F&U,wowowOjwjw,wA-\`pWPP #*@P 0S 0<003/p00,w0P D00 @- *@o/p@-P`@P P 0 <0p@0/pps@-PP@ P@ `0<0 03/@P0<0 0S  3/T `VЍp t@s@-(*.@TЍpk`P+ PP( @0D0 T x0 HsV 0Uhl0D00@.0ST] Pjwowwowow@-x)00 @-dPp@-`HMP@P P0<000  P$   HЍpow@-@ ( M0Q   k Ѝpwow@-@ ( M0Q   k Ѝpwowf@-(0 P$  DkPЍ pwpw@- P q'w@-x1k@p.kPPT LPT@jPowowOjw@-@` kPPTD@ 0S  0 Pow,w+wOjwp@-Ajl`@dPP 0S PjP@ <jP P p@,w,wowowQ 0"S B BQR0"SS00/0 Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-@-w wwww wwLw\wwwww wAx(@A Ǚwϙw֙wݙw䙅w뙅wwwwwwww&w.w6w>wFwMwTw[wbwiwpwww~wwwwwww磅w#w$#w.#w2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣykI)OGI8z!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcI+w*w+wTw www@www<wL'wl(w0&w4)w%w'hUh=OtUR1hlww2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bGwIw,HwGw8GwFww8(How@ @ w'@B`w`w`w`w`waw!aw2awDawUawhaw}awawawawawawawkwwׅwׅwׅwׅwwׅwׅwׅwׅw7bw@bw]wDbwwJbw[5wi5ww5w5w5w5w5w5w5whww|w8wŵwpww;wwرw0;ww찂wаww@x}uu@x}e '2w72wG2wX2wi2wz2w2wԕw2wЕw2w̕w2w̕w2w̕w2w̕w2w̕w3w1wvwlzwyw vw yww(w#w#w4w4w3w3wl3wc;w䲂whwLw(w &9wؕw79wؕwxw>wD‚w0Âw ‚w4cw$̈́wwewLeweww$cwtew Tew\ewDewt;w()wD)wDwew@ww߄w,cwcwxdw'w kwewcw`dw:wcwcwcw0hwTcw|ewL%wewewhcwcwewxfw fwewewlewlhw0;wfwcwhwewcwdwewewcwdewTw>wCwkwIw Qw Xw^wwew ɨw ow vw~wwwwwwwǨwШwۨw娅w2x0x0w ! Ԃw0тwTтw,ӂwЂw|҂w(yw wzwwzwwzwwzw w{w w |w?w yw[wHLw8swdqwww>w>w>w>w>www係wwnwkwtwkw|wxlwwxlwwxlwwxlw*wkw>wkwB-wM-wd-wz-w-w-w-w-w-w-w.w.w.wޅwޅw҅wޅw ޅw ޅw ޅw ޅw ޅwޅwbwfwiwlwDžwƅwޅw҅wޅwޅwޅwޅwޅwޅwޅwޅwޅwޅwޅwnwI&wV&w&w&w&wR&w^&wZ&w&wc&wl&ww&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w&w3ww  w 0w ;w Fw Nw(wZw?wvww w w w w w!www w 9w Uw qw wwwwwwwwwww ?w ?wwww w w ]w nw w{wwwwTwww w w w w www$w>wLw ?w Iw dw ~w wwww @ @`00P]`FC=݋#D,J. w]w}ww{w]wzw]w|wlxwxw$$$0$$ۂwւwւwׂw ւw؂wlڂww]w ww]w#w]w]w w]w]w#w;꧅wk"w~DwH/w"w5ewN"wO"w'qw&"w"w]"w#wf#wJ #wJ #w/wGwTwZw`wdwnwhwrwww |wwwwwwwwwwDZwϱwױwϱw۱w౅w Zw鱅w ww wwww#w)w/w5w;w@wNwVw^wdwwwpwlwww~wwwnwnwwŪwwҪww㪅wwwwwwww!wnwnw/wmwxwwwwwwwwðwɰwаwְwҮwܰwwww wwww!wqw0wɅw=wnwnw 1w:w̅wLww4w]wewvw~w^wwww Ϋw׫w 뫅ww&ww%-w8w/wNw\wbw sw}wwwwwʅw̬wӬwଅw#ww,w7w JwSwewnwwwwww̭w߭w筅wwwww5wAwSw]wtwwww®wǮwҮw֮w ww!w$w"Rw]w$|ww'ww(wɯw)㯅ww*ww+7wAw,TwZwnwnw Bwww2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>"7*@k.66Z66u66666y !1Aa  0@`@@A@!  @a`10  @&KPPPPf|. CGZjv8`{BootOrder1234567BootCurrentBootNextBoot####PlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> !"# $$%(&*,'0(48)<@*H+P,X `-h p./ 0123 @4567@89:;<=>?    `zT~-Ewin(-5+ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O   DB     ttttt 6RitttZ_dtotq16$1PU11111)1111115(u-boot*EHCI Host Controller  * +,;=[]__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtusb_setup_descriptori2c_idle_busfec_alloc_descsphy_device_createpmic_alloc_ehci_create_int_queuefs_devreadefi_free_poolefi_runtime_relocatelmb_map_update_notifyfecmxc_recvpmic_dialog_initpmic_initpmic_reg_readefi_free_pagesi2c_init_transferpmic_reg_writewait_for_sr_statei2c_imx_stopfdt_find_or_add_subnode(((((AAAAAABBBBBB    (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %x / %x Resetting CPU ... (%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32CACHE: Misaligned operation at range [%08lx, %08lx] PORCSUIPP USERWDOGJTAG HIGH-ZJTAG SWWDOG3TEMPSENSEWARM BOOTunknown resetCPU: Freescale i.MX%s rev%d.%d at %d MHz Reset cause: %s 51536SL6DL6SX6Q6UL6ULL6SOLO6SLL6DP6QP6D6ULZ7S7D8MQ8MD8MQLite8MMQ8MMQL8MMD8MMDL8MMS8MMSL8MNano Quad8MNano Dual8MNano Solo8MNano QuadLite8MNano DualLite8MNano SoloLite8MNano UltraLite Quad8MNano UltraLite Dual8MNano UltraLite Solo8MP[8]8MP[6]8MP Lite[4]8MP Dual[3]8MP UltraLiteTargeted peripheral clock should bewithin [%d - %d] PLL1 %8d MHz PLL2 %8d MHz PLL3 %8d MHz PLL4 %8d MHz AHB %8d kHz IPG %8d kHz IPG PERCLK %8d kHz DDR %8d kHz Error:Can't find pll parameters: %d Warning:DDR clock should not exceed %d MHz Warning:Unsupported or invalid clock type display clocksDIALOG_PMICimx53-qsb.dtbfdt_fileWriting to BUCKCORE_REG failed: %d Writing to SUPPLY_REG failed: %d Writing to BUCKPRO_REG failed: %d FSL_PMICimx53-qsrb.dtbWriting to REG_SW_0 failed: %d Writing to REG_SW_1 failed: %d Writing to REG_POWER_CTL2 failed: %d Writing to REG_MODE_0 failed: %d Writing to SWBST_CTRL failed: %d CPU: Switch CPU clock to 1GHZ failed CPU: Switch DDR clock to 400MHz failed Board: MX53 LOCO ERROR: %s image overlaps OS image (OS=%lx..%lx) Ramdisk image is corrupt or invalid RDCould not find a valid device tree FDTverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command ERROR %dE: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... bootmbootz## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... filesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Setting use of fallback Selected fallback option, but not set pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedfallbackUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %sUnimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareELF ImageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkpxedhcpUnknown uclass '%s' in label No bootdevs for '%s' label "%s" is way too long Invalid partition number: %s Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-std/boot/Invalid option Unexpected value '%s' extlinux/extlinux.confbootmeth_extlinuxu-boot,extlinux/EFI/BOOT/tftpPXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootmeth_efiu-boot,distro-efiEFI bootmgr flowbootmeth_efi_mgru-boot,efi-bootmgr#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2025.01-3u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. reg/aliasesethernetethaddreth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: fdt fixup event failed: %d - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsbootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Trying to execute a command out of order Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available read %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobdevicetree = %s serial addr width shift clockbdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureNo UEFI binary known at %s bootefiBoots an EFI payload from memoryboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticuclassfunction: %s, cpu-time: %lld us, frequency: %lld.%02d times/s cyclic_demoRegistered function "%s" to be executed all %dms cyclicCyclic-necho args to console[-n] [args..] - echo args to console; -n suppresses newlineInvalid ELF image Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr

" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Unknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx crc32The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08lx: %08x %04x %02x ? Zero length ??? byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmwmemory write (fill)[.b, .w, .l] address value [count]nmmemory modify (constant address)[.b, .w, .l] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc erase partname mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsrping failed; host %s is not alive host %s is alive rootpathdnsipdomainautoloadpingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolactiveeth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu NET sub-systemlist - list available devices stats - dump statistics for specified device stats%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed edit: setenv## Resetting to default environment runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storagetruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+-%d %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopserialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imageprebootNo CLI available%.*s%*s syntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort => *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! modelModel: %s NULL device name! mdio_register: non unique device name '%s' %s: %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_ignorelistusb_ignorelist parse error in "%s" usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: %s not found stdinstdoutstderrNo devices available!In: Out: Err: pre-reloc realloc() is not supportedalloc space exhausted cyclic function %s took too long: %lldus vs %dus max (unknown)CRC32 for %08lx ... %08lx ==> %08lx bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Problem No valid hush parser to use, cli will not initialized! %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS%s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdubicompatible/clocks/firmware/reserved-memoryrootroot_drivernoplist_empty(&dr->entry)!rcdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Seq Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p fixed-linkbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kx%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cellsinputunusedunknownfuncGPIO%d_gpio_mxcfsl,imx35-gpioSystem reset not supported on this platform resetting ... sysresetunable to find wdt device wdt_rebootwdt-rebootu-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvclock-frequencyu-boot,i2c-offset-leni2c-chipi2c_generic%s: Arbitration lost sr=%x cr=%x state=%x %s: failed sr=%x cr=%x state=%x %s:trigger stop failed %s: failed to clear bus, sda=%d scl=%d %s: failed for chip 0x%x retry=%d %s: give up i2c_regs=0x%lx pinctrl-namesscl-gpiossda-gpios%s %s: i2c bus %d at 0x%2lx, fail to request scl/sda gpio udevice *)(NULLi2c_mxcfsl,imx21-i2cfsl,vf610-i2cError enabling VMMC supply : %d Unknown modeStatus Error: %#08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group-size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%#x > %#x) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)boot0boot1rpmbgp1gp2gp3gp4bus-widthmax-frequencycap-sd-highspeed%s %s: Invalid "bus-width" value %u! cap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobeno-mmc-hs400non-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found eMMC%s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed fsl,tuning-stepfsl,tuning-start-tapfsl,strobe-dll-delay-targetfsl,signal-voltage-switch-extra-delay-msfsl,wp-controllercd-gpioswp-gpios%s %s: fail to enable vqmmc-supply Cannot write to locked SD card. CMD11 to switch to 1.8V mode failed, card requires power cycle. Timeout waiting for DAT0 to go high! fsl,esdhc%s %s: Unable to get clk for %s MMC/SD: Reset never completed. FSL_SDHC%s %s: fsl_esdhc_init failure fsl_esdhcfsl,imx51-esdhcfsl,imx53-esdhcfsl,imx6ul-usdhcfsl,imx6sx-usdhcfsl,imx6sl-usdhcfsl,imx6q-usdhcfsl,imx7d-usdhcfsl,imx7ulp-usdhcfsl,imx8qm-usdhcfsl,imx8mm-usdhcfsl,imx8mn-usdhcfsl,imx8mp-usdhcfsl,imx8mq-usdhcfsl,imxrt-usdhcWrite MDIO failed... Read MDIO failed... phy-supplyphy-reset-gpiosphy-reset-durationFEC MXC: phy reset duration should be <= 1000ms phy-reset-post-delayFEC MXC: phy reset post delay should be <= 1000ms Payload (%d) too large Can't find FEC0 clk rate: %d WAIT for MII Gasket ready timed out Could not initialize PHY %s %s: error allocating packetp some error: 0x%08lx FECFEC%imdio_alloc failed mdio_register failed %s: error allocating rxbuf %d %s: Error enabling phy supply FEC MXC: Timeout resetting chip Unsupported interface type %d defaulting to MII100 fecmxcfsl,imx28-fecfsl,imx6q-fecfsl,imx6sl-fecfsl,imx6sx-fecfsl,imx6ul-fecfsl,imx53-fecfsl,imx7d-fecfsl,mvf600-fecfsl,imx93-fec(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYSMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700ERROR: no/invalid property! ERROR: no/invalid speed given in fixed-link node! full-duplexasym-pauseFixed PHYgpio-controllerpinconfigpinctrl-%d%s %s: could not find pctldev fsl,pins%s %s: No fsl,pins property in node %s %s %s: Invalid fsl,pins property in node %s %s %s: Error reading pin data. %s %s: Error mux_reg or conf_reg %s %s: wrong pinctrl info fsl,mux_maskfsl,input-sel%s %s: iomuxc fsl,input-sel property not found imx5-pinctrlfsl,imx53-iomuxcfsl,imx53-iomuxc-gprregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltregulator-always-onregulator-boot-onregulator-name%s %s: '%s' has nonunique value: '%s enable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedstatesenable-gpiosgpio regulatorregulator-gpio = %d is invalid. Should be less than %d %s: No available memory for allocation! PMIC devices: name: %s bus: %s_%d PMIC: %s PMIC: Registers dump failed 0x%02x: PMIC: Register read failed 0x%02x: 0x%08x bat%s is not a battery statechargeBAT: %s charging (ctrl+c to break) I2CSPI|+|-|pmiclist - list available PMICs pmic name dump - dump named PMIC registers pmic name read - read register pmic name write - write register pmic name bat state - write register pmic name bat charge - write register %s: POWER allocation error! %s: Cannot find udev for a bus %d %s: invalid tx_num: %dstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted fsl,dte-modeserial_mxcfsl,imx21-uartfsl,imx53-uartfsl,imx6sx-uartfsl,imx6ul-uartfsl,imx7d-uartfsl,imx6q-uartfsl,ext-reset-outputimx_wdtfsl,imx21-wdttimeout-sechw_margin_msu-boot,noautostartu-boot,autostartevery %ldmsWDT: Started %s with%s servicing %s (%ds timeout) WDT: Not starting %s WDT: Failed to start %s watchdogRx: failed to receive: %d Waiting for Ethernet connection... done. unable to connect. asix_ethRX: failed to receive RX: got too many bytes (%d) setting autoneg failed failed to set multicast hash failed to set configuration mcs7830_ethError: SMSC95xx: No MAC address set - set usbethaddr smsc95xx_ethusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No USB controllers found usb_dev_genericu-boot,bootdev-usbEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x dr_modeperipheralvbus-supplyError enabling VBUS supply ehci_mx5fsl,imx53-usbenv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %pMmissing environment variable: %s *** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksMMC partition switch failed two copies of u-boot,mmc-env-partitionPartition '%s' [0x%lx; 0x%lx] too small for %senvironment, required size 0x%lx blocks u-boot,mmc-env-offsetInvalid ENV offset in MMC, copy=%d No MMC card foundNo block deviceMMC partition switch failedWriting to %sMMC(%d)... !read failedReading from MMC(%d)... ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystems%c %s: fatext4unsupported** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s fs uses incompatible features: %08x, ignoring error: overflow occurs Invalid FAT entry: %#08x FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: FAT%d "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driverDM_TAG_EFI not found /EFI/BOOT/%s1234567Invalid load option for %ls Loading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed Error: Cannot initialize UEFI sub-system, r = %lu EFI boot manager: Cannot load any image Can't find %pD specified in Boot#### Can't read fdt Booting %pD Loading image failed Uninstalling protocol interfaces failed Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exitedBOOTARM.EFIneed device tree invalid $fdt_addr or $fdtcontroladdr invalid device tree Failed to reserve space for FDT failed to process device tree failed to install device tree failed to set watchdog timer ## Application failed, r = %lu ## %ls [?25%c[%d;%dH[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory Partition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUl%lsDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting %s rng-seed%s/%sboardver%s/%s%s%s%s.dtb/dtb/dtb/current/dtbs///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed Cannot persist EFI variables without system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event Disk %s not ready Adding block device %s failed, r = %lu Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### installing EFI_LOAD_FILE2_PROTOCOL failed Creating event failed Failed to install ECPT manufacturerproductasset-tagskufamily01/01/2025_SM3_biosbaseboardchassisevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okayseparatefitembedbloblistnvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcjedec,spi-norsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.count = %#x %s[%d] [%#llx-%#llx], %#llx bytes, flags: invalid %#x %s: LMB Map notify failure %lu This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. Unable to init LMB no-overwriteno-notifyRE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7pxeuuidInvalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again netretryyesnoonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotateethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskip[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead (7:>.*62/##333333+3 33 demo - register cyclic demo function cyclic list - list cyclic functions bootcmd=mmc dev ${mmcdev}; if mmc rescan; then if run loadbootscript; then run bootscript; else if run loadimage; then run mmcboot; else run netboot; fi; fi; else run netboot; fibootdelay=2baudrate=115200ethprime=FEC0loadaddr=0x72000000mtdids=mtdparts=script=boot.scrimage=zImagefdt_addr=0x71000000boot_fdt=tryip_dyn=yesmmcdev=0mmcpart=1mmcroot=/dev/mmcblk0p2 rw rootwaitmmcargs=setenv bootargs console=ttymxc0,${baudrate} root=${mmcroot}loadbootscript=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${script};bootscript=echo Running bootscript from mmc ...; sourceloadimage=load mmc ${mmcdev}:${mmcpart} ${loadaddr} ${image}loadfdt=load mmc ${mmcdev}:${mmcpart} ${fdt_addr} ${fdt_file}mmcboot=echo Booting from mmc ...; run mmcargs; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if run loadfdt; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo WARN: Cannot load the DT; fi; fi; else bootz; fi;netargs=setenv bootargs console=ttymxc0,${baudrate} root=/dev/nfs ip=dhcp nfsroot=${serverip}:${nfsroot},v3,tcpnetboot=echo Booting from net ...; run netargs; if test ${ip_dyn} = yes; then setenv get_cmd dhcp; else setenv get_cmd tftp; fi; ${get_cmd} ${image}; if test ${boot_fdt} = yes || test ${boot_fdt} = try; then if ${get_cmd} ${fdt_addr} ${fdt_file}; then bootz ${loadaddr} - ${fdt_addr}; else if test ${boot_fdt} = try; then bootz; else echo ERROR: Cannot load the DT; exit; fi; fi; else bootz; fi;-///)/+LPTX^ #0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass &:!(6CQ_ky."*&'hUh=OtUR1h+.1  (H_7arocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.  0123456789abcdef+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to  ɶAOHa4py #(-27] - Run script starting at addr$)9aGaKNS DMWDDa  ( w   U-Boot 2025.01-3 (Apr 08 2025 - 23:07:41 +0000)@Sc@cccrwww؂ww w|w̌w؂wwwwwwÅw ́wnwnww ́wnwnww ́wnwnww ́w nwnww ́w@nwnww ́wnwnww ́wnwnww ́wnwnww ́wnwnwxw ́wdwnwnwŅw@́wwnwnwŅw@́wwnwnwƅw ́w wnwnwDžw ́wwnwnw Džw ́wwnwnwDžw ́w쵀wnwnww ́wTwnwnwDžw ́wwnwnwgDžw ́wwnwnwNbw ́wضwnwnw /@iw@́w wnwnw[…w ́w@ wnwnww@́w wnwnwYgw@́wwnwnww@́wwnwnwvw ́w@wnwnw2 w ́wLwnwnww@́wwnwnwNbw ́wwnwnww@́wwnwnww@́wwnwnwNbw@́wwnwnww@́wwnwnwIw@́w0wnwnww@@́wwnwnww@́wwnwnww@́wwnwnww@́wwnwnww@ ́wXwnwnwiw@ ́wLwnwnw څw@́wwnwnw_w@@́wpwnwnww@́wwnwnwww8ww rwww w 2w w w hwhwwjwwjwjw wwjwiwTłwcwjwcwcwjwcw4Dwiw$iwcwhw cwnIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ ]w~w(pw\wH\w~|www ́wpwwwąw ́w`wąwnw=Ņw@́wwFŅwjŅww ́wwwnww ́wwwnwƅw@́wwƅw#pwɅw@@́wwɅw ʅwÅw@Pw`́w(Åw4qw8wѢw@ ́wئwwZqww ́wdw wwɅw@́wwɅwɅwעw@ ́ww7ƅwtw w@ ́w\1wwnww ́wwwwƅw ́wwƅwnww ́wwwww ́ww^wswDžw@w`́wDžw#wwww ́w|wvwwƅw@w`́wƅw}wȴw߅w@ ́w@wDžwDžw8w@́ww@wZwŁww@ ́wwwwvʅw ́ww{ʅwnw̅w@́wHw̅w̅wXͅw ́w`wc˅w˅wʅw@́wwʅwʅw\˅w ́w0wc˅w˅w˅w@́ww˅w ̅w"w@ ́w@w(wTυw ́ww\υwυwFЅw@́wwNЅwuЅwυw ́wwc˅wυwͅw ́w|wͅwͅw)΅w ́wdw/΅w=΅w҅w@́wxw˅w ̅w΅w@́wLw΅w΅ww@́wwPׅw遆w؅w ́wҀw؅w7؅wׅw ́wҀwׅwnww@ ́ww ́wp wCwjwwrw‚w(rw@w(Ԃw,tw /w,iwiwXuw/whuwLqww7wY ;wcowDwow:wcowwDwowD#w]>wlPvwwLwvw#wmpw@w(قw,}ww$w|wwAww4w wBDwXw8Dw~vw|wwww wTw'wwdw6wwXwwIw8wDžwwwUwYGwDwӥw4wåw3wCwfwݥw04wkw|Cwʥw`4wkwCw/w"w wlw "ww,w|w7wZZ4wwHw|w6wlww葂wD7ww蝂w葂w7www葂w7www葂w6w ww葂w6w0ww葂w*7ww蝂w葂www{w mwwP>wT>wX>w\>w`>wh>wl>wp>wt>wx>w|>w>w>w>w>w$?w@w@w@w@w @w$@wFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwFwGwGwGw GwGwGwGw,Gw@GwlGwGwHwHwHwIwIwtJwxJw|Jw8Lww>w>wpBwtBwxBw|BwBwBwBwBwBwBwBwBwBwCw$CwDCwCwxDw|DwDwDwDw Gw$Gw(Gw,Gw0Gw4GwJwKwpLwtLwxLw|LwMw MwNwNwNwXQw@RwDRwHRwLRwYwZwZwZw ZwZwZwZw`w`w`w`w`w`w`w`w`w`w`w`w`w`wawaw awlawpawtawbwbwbwbw bw$bw(bwcwcwcw cwLcwPcwtdwew ewewew@ewhw hwhwhw iwtiwxiw|iwiwiwiwiwjwjw|jwjwjwkwPkwTkwkwkwkwkwlwlwlwlwHmwLmwPmwTmwXmwmwmwmwmw|nwnwnwowowowowowowpwpwpwpwqwqwqwqww>w>w?w?wd@wAwAwAwAwCwCwCwGwGwGwGwGwGwGw@IwIwIwIwKwKwMwMwLRw0Ww4Ww8Www>w>w>w?w?w@w@w@w@w@w@w@w@w@w@w@w@w@w@w@w4Aw8AwAw DwDwDwDwDw Dw$Dw(Dw,Dw0DwpDwEwEwEwEwFwFwFw|Fw0Gw4GwGw@LwDLwHLwLLwPLwTLwXLw\LwLwOwOwQwQwQwQwQwPRwTRwSwSw Sw$SwTwTwTw\Uw`UwdUwhUwUwUw VwVwVwXwXwXwXwXwXwXwXwXwt[w[w]w]w]w]w]wP_wT_w\`w``wd`wh`w`w`w`w`wTbwbwdwdwdwdwdwewew0fwfwgwgwhwhwpkwtkwxkw|kwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwkwlwlw lwlw\lwlwlwmwmwnwDnwHnwLnwPnwTnwDowHowLowPowTowXow\ow`owdowhowlowowowpwpwXqwhqwuwuwwwzwzw{w|w|w|w|w|w~w~w~w~w~w~ww$w(w,w0wXw\www wwwwwwwwww wwwwww w$w(w,w0w4w8ww>w>w >w>w`>wh?wl?wp?wt?wx?w|?w?w?w?w?w?w?w?w?w?w(Bw,Bw0Bw4Bw8Bw"okaydefaultmma8450@1c !fsl,mma8450dialog@48!dlg,da9053-aadlg,da9052Hdu regulatorsbuck1 x7buck2 x7buck3H&%7buck4H&%7ldo1 'w@K7ldo2 'w@7ldo3RH2Z7ldo4RH2Z7ldo5O67ldo6O67ldo7)0)0?"ldo8O67ldo967ldo10O67ssi@63fcc000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u0 ipgbaud rxtx! disabledaudmux@63fd0000"!fsl,imx53-audmuxfsl,imx31-audmuxc@okaydefaultnand@63fdb000!fsl,imx53-nandcu< disabledssi@63fe8000*!fsl,imx53-ssifsl,imx51-ssifsl,imx21-ssic@u`2 ipgbaud ./rxtx! disabledethernet@63fec000!fsl,imx53-fecfsl,imx25-fecc@uW*** ipgahbptpokaydefault]rmii ftve@63ff0000!fsl,imx53-tvecu\Et tvedi_selokaydefault v!vga"portendpoint#? vpu@63ff4000!fsl,imx53-vpucnm,coda7541c@u @?perahb$okaycrypto@63ff8000!fsl,imx53-saharac@uipgahbsram@f8000000 !mmio-sram?$memory@70000000memoryp disp0!fsl,imx-parallel-displaydefault% disabledport@0endpoint&?port@1endpoint'?+gpio-keys !gpio-keyspower Power Button (tvolume-up Volume Up )svolume-down Volume Down )rleds !gpio-ledsdefault*user Heartbeat  heartbeatpanel !sii,43wvf1gportendpoint+?'regulators !simple-busregulator@0!regulator-fixed3P2V007?regulator@1!regulator-fixed usb_vbusLK@LK@ ?sound.!fsl,imx53-qsb-sgtl5000fsl,imx-audio-sgtl5000imx53-qsb-sgtl5000,&-82MIC_INMic JackMic JackMic BiasHeadphone JackHP_OUT@Mwdt-reboot !wdt-rebootZ. #address-cells#size-cellsmodelcompatiblestdout-pathethernet0gpio0gpio1gpio2gpio3gpio4gpio5gpio6i2c0i2c1i2c2ipu0mmc0mmc1mmc2mmc3serial0serial1serial2serial3serial4spi0spi1spi2device_typeregclocksclock-latencyvoltage-toleranceoperating-pointsportsinterrupt-controller#interrupt-cellsphandle#clock-cellsclock-frequencyinterrupt-parentinterruptsclock-names#phy-cellsstatusrangesresetsremote-endpointreg-namesinterrupt-namesbus-widthpinctrl-namespinctrl-0cd-gpiosdmasdma-names#sound-dai-cellsfsl,fifo-depthwp-gpiosfsl,usbmiscfsl,usbphydr_modevbus-supplyphy_type#index-cellsgpio-controller#gpio-cellsbootph-pre-ramfsl,pinsgpr#pwm-cells#reset-cells#dma-cellsfsl,sdma-ram-script-nameVDDA-supplyVDDIO-supplyregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onphy-modephy-reset-gpiosddc-i2c-busfsl,tve-modefsl,hsync-pinfsl,vsync-pindac-supplyiramlabellinux,codewakeup-sourcelinux,default-triggerregulator-namegpioenable-active-highssi-controlleraudio-codecaudio-routingmux-int-portmux-ext-portwdt