@ CHSETTINGS/@@/@@/@@/@@/@@/@@/@@/@ﾭ&1)  "Oo/Oo   P!:0@" $Р0@>->/@0@CKP0@9K|P0@K$"B$!"B!$"B$n"Bfo"BgZo"BZgo"Bgk"BcpGDpNlF5Fĕ h"u"hFr_"K%"pS0@DpF F)Yhh_h!h#C`Bh&K E!h$H+hc&khc_h`0+ۿ_"i` 0+ۿ_bi` 0+ۿ_i` 0+ۿ_i` 0+ۿ_"j`!"hFhC`bhK(!hHp@B a0@?DpGpF F~0o)F Fx8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pG   0pG8pG0$h4_@BМB 0 ПP-f0@TР_Р_440 S?PР (/0@\8&/@FhO1 bjG%@$0C#&@CC'@CcLBLBѐ)@(0C#*@CC+@Cc `-,0C#.CC/ Cc` (oboxpiF$0 k3dkBd#iFpF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pGpGH a0@C?@ pG?CS?opG??#S?opG?[ O,$OopGH0@HD0@H0@XHFPVHxVHuUHrUHUH(5"5! F$OH_IH\$KHV$ DH@M#! ($0@,h=H7$"#! 9H(! (75H@0H(.H(,H(C)H8")I( F@s"#I(4$"$ $!F (HW#F! dH#!F Z( H"V" I(?pD*b0@a0@!b0@b0@b0@5p0@b0@c0@N^>H8=I ! :Hx%"F7H83I ! .H`#/K/J/I0K@/-HH#+K,J,I,KOp+HF()HH"FHa"K#JI"K"F HR(KJIKHK#KOpKJIb0@c0@3b0@b0@0@X0@hW0@X0@*b0@<0@xX0@HW0@W0@!b0@b0@D0@HX0@W0@b0@0@`X0@(W0@W0@$Y0@X0@Y0@Y0@W0@F@He(P?H`(S=H[(U")I(1:CxL+/%I F8 @B F!I(  FI( FI( FI( FI|(O0I+ IIb0@a0@!b0@*b0@b0@c0@[c0@3b0@b0@lc0@5p0@yc0@c0@c0@)c0@:c0@Nc0@c0@c0@Fo#FBF x3 :^*# p𵅰FFF6 F gPF9F!F3F*F# F/hK / 3#U#BѧB(hO0!(F3F*Fd(3U0(K(Lb#,050:0G0"JN#F(3 "bHH0+(ѝ 0C C"IHHn "HHf!" HH^" H(F0",0@U3,0@c0@50@:0@G0@h0@KFjKB"H@  0@,,0@HpG50@HpGG0@pGFб(CF H@ɻ! FMFH FFHc0@ d0@2d0@pG pGpG@pGOH3aK``#qK`pGPd0@opGopGsKFhFBF)Fp@iF(FSpK#`##qOC``#a p@#*F1F F( F'VWd0@-MFFFo?@! hF?RB @FAF(F,hG?(o8F:hKB;FBF)F0FM:FQF0FF(ѬhibB< DihDd(FcD"@ADG(iBF J pG40@OR " (0CC00 0Cc0 (FR ` pG "!PFO8H Br 0[1KF("!i%OCPF &N&KZ%p/4DF+chB'8FF!hHch#hGx $0+LGH 4B5- HO@Ll0@0@0@]d0@/@ud0@d0@U/@O2D 0HCc0@Ƹd0@ K0O0#L0IF" F0@ F F FF Fhh Fo!0BB 6BFh h^(&o-MhFFFF(FFxhb!F(FF8HohjF!F(FPjF!F(F D!F(F¹!F(F&IF&H !F(F(4!H2ohIm&;FQF@FF(9FXF*+y++ RFAF(FCF+y+O2F*I0}3ۻB6" QF@FF0F2FIH|FXF a0++RFAF +ah3 Z`h;3h`+jC+b$toqO4nie0@o0@qe0@xe0@0@e0@-M FFFGh;hBOa@F(;hEسF5D;hB'Oa@F ;hESD;`*ZFAFD8`   XSB EAD 2F Fy0FOcZF F\D k FRFAFcTD I@5O0#-E,MFF9FFX8hF.H(F ,M :FOa0FrI2h&KB%%K*F# Oc@F3FF:FOa0FT( 8F9 I7!FHD2FQF@FF"FPF1FD:FOa0F1PFBF1FDDD$e0@ E+/@,/@e0@O@ pG𵇰FF*(9@!$JFOQO O K JaS __B`2F@!O<2F9F(FFX3+ Ohi,F F H H K#9F#(F e0@2f0@-/@FChFhF0F:F!F0DF.` F p FFIH8Ho FpihH  H K"#)F0FOFVf0@Zf0@cf0@~f0@f0@./@FHhDF F0@8F FKK`1!F(F8@f0@Dhi@@ Fi@pFFFF8i Ji@#1F(FFH Fp./@f0@FpGi( pG-E hF +FF++\H4o ZM(hH  PF FHFTH!1O O ChE1h(h(^(,(:IHoR?,;,BjPF(`XoQF>Ho FF(#F+`6H(hF(h!FF0Ha",h FOCOrOQ &HK (hg1FF*h8F;,h Fs#F1F8FmpoOS"F1F8F (;y+$+H FR#F1F8Fx(f0@g0@h0@R&T#D#CBOOC ERD#[#E=F8F F7`((FoWE p 8 (]UL*4+ N#*4&7F (LH$P6--Ы+#-$473/$4o %434;Ho 43 4. o1H(-/MOc#T=/F&44B(Hu(Д(44 $S@+o `(Н06?HU(ѱ(4$˱ I 4[Bo 1DBܔ $۲BF4<=8>?-EiL%#`#T(4*TCh(FF4TT T$T8T4T+T,YH ")FOzsXC(40+  C b4+@𐀄+4 4 IH7Bh! EWq?/ؿ#@Hؿ(4(4+  C 443404;,04BQ> '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O 4s0@_ 0@-MFFFO pL)44+.+@O +404,C04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F^4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C 434F #)4-Д+4?|POo(4+  C 4344pG FL4;+        M#)4G(ڽ@Hy40&KS HpGZ0@s0@-MFFFF): x+7FYFF x F ?)F"x3**F0FFK]=+a5)DdbBE(BF8F_DEGD2FAFH FO4jt0@KhpG0@Jh3`pG0@-EFF.FR_+x-+ =!(F[Fx)F4H >?+f+ZG.0k:F(F)I 0 O X*;  0VED F{!FHFO T+:F)DEјB K#S+K)FhHFO0t0@0@t0@tt0@K0 0 xKOsjF! c]OsjF! u0@F FI" Fu0@FJF0 F!FH0@0@FIF)# J@h 0 "L1( F L0@ F!F<#xbxCxCxC#yCcyC8  0 FFPI*F Fe0o"u0@8 FF(*F8@! F8Xx1( Y(РTXBXAO0 F FFHV0@ " L( L FF cHU#Dd@ IHX B  BB &u0@0@0@J0Fʿ")  pGF8IK[HDB AhB00@0@0@p%O4)F FKF8$toK@"H0qh@B1h HhGF8 HKP0Fp*6Ѵ?,F5Tu0@tu0@'o&9F FX_JF "J FkiGF@khH CH0khH CH0J07+oo0@-M}F FF= # 'I2FhF iF@FFPг23nFXF YFF{h@Fu PF0W``QF(F0L`H)F FwF``o FoH1oxu0@}u0@-EFFF(H,! FFp F 0Fo !Fy:!(FF(#;F(F|F(BF!F(FG(t. D F(RF!FT# 0 0F# IF(K(F1 F0ooF/@p@ x0,LxX,1 N D F%x1u]@DЙB F`p瑔0@8FMXM!x(F:@8!xH 0@u0@8F5( Max(F!@8axHn 0@u0@7F%#!F BТB"x0*bxX*-x:*O0*5- 0-A%lF0hOPP+H8P8`8h@1FHJ@1FB((xKS 0+C`0@p v0@v0@Z0@-MF FFZK/h,F.Ыh3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FHb h9FHZ8F KYF(FFH"FK!FXF(?|hw9FH硐0@0@`v0@Av0@v0@v0@v0@ JpG JpGhKBo pG )ۊCjB pGhDDpGo-A`F" FFo h;`6s,+! "!F@FDx+4$<`0F!F"@Fh 5$,D & o]( o](#sBFF(F0F!F( ((+h3+` Fp-+h;++`,-O4O4#(+O0]O0#F F++FO1FF FFF%DB$ F2F9F FI(4iDpGhDDCh`pG7F F!F(F( (,o  F0(O48hFDD F(` F8"FhAh hh# F!FoF0C18hFDD F(` F8-AF#FF FT-O4 F-!F8F2FAFFX]+2F@!@F]@+!FjF8FFpFFFFM"FF1F(Fp@F F@XF F@L-MF FF(Fڸ%%BF!F0F,hF0F GB!F0F:FQFW(ѻ@(F$FFFFF"FF1F(F 0pFFFF8-h0F (` 4 FpFFFFF"FF1F(Fs FIFFSO3F*F Fpw0@-A xF/+ F5/! F(FF!F8FF88F(DFFBBРF04/+/!@F(F4F)FBF8F(F%o8FF FM!FF(F8@(  K@BS K(FpGHpGHpGHpGZ0@Dw0@#w0@9w0@Fhj$ D*FD۱B؆BӘ DB oh?=DB ؤI oopFFF`hh  ``ppFFFPkjDjbhD`p-M(FFFBSPFh6)j.DRFF 0FF,۩h DF)D#"(F 3F F)jh(F AD)DoF(*jD*bQFFLDFO@r0$`0?`0_`-MFFF,i#$ "YF(F_P?/Q#6`piFFDB!F(Fp@#"=O0p-AFFFFFF-CЈ0F#" 3($l` 3 `BF#F9F0F4F3FF(&2F)F Fp-MF FFFg(6C1)F F" FQF8(٥h-UDf'"1F FOscQ4F:F F8BFYF FOsPF>Ds`opFFFF"FF1F(Fp@8+ h+o F]o JC o x0@JC x0@ F0M\B0K$5@`@ _0@sF p%.F F((.x.+@%#x46.( FsFNM| F#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -A&FFF4FDE0FU$18F&E$4p F h@&1F FB 46)#!l```(`0 # J`p# t"K`pG#`pGt-MFF E4ah)8!#hYF-ҀhGЩB&%ah0F97FKBchB{#hOS 0Y>-=F-PFQh?(+%Ѹ"h h"8DAF0GP# KJ`` F#h@Ft`#h;Dh ###h;D30F`B+PFQh0+ѸhFC h"XDAF0G(#h@F[DE`#h[Dh+#h[D3`{8F#hS 0+x+ѢhchB-=F#h-^Q#hPF^p`#h@F^` h(DCh+Ѓh+Уh03` hh(D"AF0Gh"#h+D`O2#hZQhD`nF#h+D3 `kt-E&F F3FF8"oK`  ;F"1F@FG("KO0` O2#h-ZQhD`t-MF;lFO # FF{`"|KPF "xK` %YF*F#cU;l #RFylxhk ;lZ3h@0(Op1FO(] 7F0Fp3h+k+Cc;`#x +C +A#+B%F; CE;hB+x{h;lETP1FkL!h(IHE  )уB ғ 23Ex)ѭ h#F" De,FF0]F=+  cCEjxEBE=+#+p]FO+p;l31F Fk5 Fzh9l(#ZFYF+pF; CE!# p#x+?9;l#k`#h+sZF!FHl\+Px(F*F;2 Fzh9ls(?ZHotx0@x0@y0@-M F'<"   $+C C$ C  2K]fF1HM : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H6!FH11FH0@ay0@Py0@Ty0@ly0@-AvBF FO/0F:)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(F-AFFFIF(F>F(FHO7F,8FjF!F(Fx/+D<[BF1FT(BF!F(F-Fw0@H4ty0@pF?F!?@ F(3*F! FpFIFx3\pG0@F38CH#DBF#Sp Fx;A\0@2+ͿKZ"2ؿTpGy0@2+ϿKZ"̿2pGy0@hZ`xt("m(S(d(0(pGn+ pG pGOp`pGOPpGOPpG pG pGp FFF!"pRa D23D2p-MF k FFF%9])?K+2\ldM3hBF8FSFk;F`BF3`;Yx8FSFk!DF;xD-0h;xB%(F[xq*FD@D(3h+D3`45hSFBF8Fk5`;[xDSFBF!F8FSFBF!F8FSFBF8FkzF(SFBF!F8F;[xDtSFBF8FkdF(SFBF!F8F3hSE ;I\ 3hSE 6I\33`4H3hSE /I\3hSE}2hREz!;x[xP3;DBoϬE22`y12hREb!;x[xP3;DBϬE?S15hm 4@5h ]B]A;Zx3hCDK204;Zx3h [2 CDK`"FH摔0@y0@-MFFO F;F(FJ Yx;F(FJ1D(F-MFFFO FCF:F(FKhYxCF:F(FK1D(8 F!2+ʿKCU28y0@ FA\F)Fѯ]+;UDix]D!R= F")F:fU2[+˿Kd2cpy0@-MF FFF'2+hZ*`x.*,#* *e+`b+hx)@!p$ )P!Ab/@ca/@ca/@ca/@b/@c/@-c/@-c/@ca/@ca/@Eb/@\*q?*ŀ[*Zxb^*aO 3+`+hxbK2^*$|*/9F F^"AF F#02+˿TK2Sp#U+`! F] !!bZ*`x\) ])YF FKQFH (Fb  FI FDFO (FbKOF F!!QF%>2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`x z0@y0@"z0@5z0@Iz0@7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpF瑔0@O2ؿB;?+pG DDB;?+FxF2,;+/*FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 88F80F,F F8!FvBFًB F{ FDBF9DB xO3DɲB FKBFOzrF33hFOzs!pFNB%F(5F(Fdp0X#"LM\+$* 0* %-9KBKA2c\D;#瑔0@!-MF FF(m  .H1F(F"  F1FXF"@ PF1F@F@" 8F!"@ ! "  !(F"  F!XF" PF!@Fo r#FFF|Q HUz0@hZ`ppGFJ-A#&FO:L\= %Fpgp:+3,F3+#+p3F+hL` p瑕0@-MF FFF %) FhGEFixO -) x550) ##0 +#l)'`i)#q'%)8)иF 0 0 + "c)d)u)V;%k #`0# 0##qpز(+P#i/@h/@h/@]k/@h/@!i/@h/@h/@j/@+ "`-"[B OI"rF[BٔҲR *OW O0 RD tJ8!Oэ+xVM+)m+"I+'+FlIxF\3R "#hpCF3#`,F ;+O0 O " F"kx4+O H #O O  0%  303 001  F89E!T;+!hH ` p   F.#;V)? ORO!cFB ٔ۲S  +OWO0CD  08O?خ#; "` 0VO #` YF FhG :ܸ?)? FhGʚ;̑0@K FFhFh ]h/@RKW ]pGh/@ RKF@"p@pGh/@ RKF&"p@pGh/@K\D C9(Կ08W8pGOppG0@px0+CxL\D۲x+"0F%&F0xB `(Fp*"* "0@"ѿ "οx-,н@ƿ0@BxF0+CxI\A۲x+"0$F!F/F8xB 7` F*"* "C1A瑔0@"˿pFF)KB J \@Fl;]v `!p@B!`O0p0@"տ!IK[FHDB pGAhB00@0@0@pFz L J Kp@޿0FciGch3r Fp4B$0@0@0@JKzLF¹#;rB8FciGch;r ;zjhB5B8FkiG(%F4縦0@0@0@pF FFjph{2F)F FG(opFo\o%F"߿8% F `CiK`id`,II (F8Pd0@wz0@7F,hFk,H,, KJ;,Fkha3 I]0K J~,FJJJJc0@z0@z0@z0@!p0@z0@F FFF8FS( ѳhB ,DB4o! o%o-AFFFFx FF FtAhCF:F(F1DAFFFp FF F[Ah:F(F1D@-AFFFFx F}F FBAhCF:F(F1DA޹81FU+-ѐ1+)#FrI  34, " I6: 8"IR1( O0O0z0@z0@i?3#?@3 ?$?#F"!( F8 @BFO0-MFi?3#?@3 :` GFFT"! @#?y \HEO3{`xh`7FCF"QF0F~(RFqhSH0!U)Ѫ*NH0F x`(rFp)xI=)y):0[E6Ѻ 1)/{iYF8Os`j+0FCCSD#`ꉫCCc` 1I,U+ySBSA*x[*Cd+yR0)yA )  5By-)2B@F(q""`siIc`{id8Os,`aS0FAA;hD0:h[F F+x`Lz0@z0@ {0@Pd0@"#F]pFF#z{(FF(F(&$!F0F !khJ> IF(FpT"@K r4, p4{0@z0@hkhGo%pGFpGo-AFF FFh,<,3Bo FhBChB@(Fj-AFF FFn#hk;F2F)F FFA`Go%-AFF FFS#hk;F2F)F FFA`Go%pF FF:#hkh+2F)F Fp@Go%posF FPoh,<,3B0Fp FhBChBFj,<(0 -MV@JF!FCh\F(ojA8FF-eRF@FF(X193!;#A19!!9!?a4&&Fa`CargU``% h,<,3B FhFB BhB8F~@jڣ F,Fo :{0@8?0 ?!F@ F8!"F(F)J(F8F8@ -M,FFFF#0xhF8L! F(o (F4Ccc,bc `CaO3<cdad bCh[l d;kk cl Ccd9k(Р`[hkIcl Ccd( a3hk3j[hlIcl Ccdy(`k4cc#d` FyF(hc[hhclC@cd FG(F3hj+ FG( FG(@ou#RFhFFFFhl[ #(F#<oO08F(;Cl*Ԁi%hj8#j[hXk0bj"Yl `bikhPkj[hk0j#)lbclCScdhcl i+)lo 8ao8F(7Cl 8hHi`cl FCcd`cl#cd(cli;+is F(h[j+ FG( FG(ohpGhpGipGipG@jpGjpGP4?B #<; `pGhki42B #<;` pG#`P4?<;<BojdhdhB `kipGj[hXhpGClCCdpG`pGO0pGpFJ K LB$ Fp0F!h(D4產0@0@0@IK[FHDB pGAhBH0l0@0@l0@-MFO &KL\'=FB  .F 5Ѹ0FXF C+(FF7(F.F0@0@0@sFFFFFH*F F#poO3]pFFahlZT4_<=<B cl F(p(F1Fk0+0hS`Zh`pGKFɹ  F J3JP(  o笞0@FP  pGF p FP F0!F@FJFP0h@8B Ch[hBip0FF+C# `(; FF(:! #Fo p)k) ( `#acae``` hK`!aba`jc FGH+kSci"iS``##aca4` ##`0`o"o_hpG#7 F`FhB!F,;,Bo+`0j9,;# F `0R?B,;#`#h`jj2B,;` pG7 F F,`0ChFZl hj#FS/,:,B0O0ljBF#7`K FFo01(R?,;,BЙlB+`j8FF!yF%`F8#F`a"FF@#F`"FF@׿ Fe!F@{hFh]n# ` FK0#h#@F/ F #h+oFDh@j,h`3bc`iFkj[hiKG0#kjS``#b#cFjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@GsFFF F1FpbO DP< +`pooJF"ۿ"]0 FFFFF F!FW"8 FhhhkiGchD@  pG7F F2 ohB BhDB *``h`0F2 FHFh,<,3B(FclմB F}Ch`Dj,<Fs F@Կk!F@h a``h!0@ ` @ o K P#@pGsFhFChFFh#h HYh+h J+F2Fopo {0@0@-EF0@FF<hFh0FzF0h"hhX @Q 0CA 0 h+iC"p2F@FG(oo  F'(!FoIF F@{0@-AF"IFFxFth$ORIHo _O M_x8F$.п_OqxFRӕ0@0@E|0@0@-EK)M''FFFOzv@J/D@F;xZ_ > I H) H&_OrxR".F0@ӕ0@0@E|0@c|0@8 M KF)FxZ_+ yZ__xOzpRF8ӕ0@0@-EF`.MGh.Kh/FzZ__Eox0FBF9F F;F(ѿ_z$_Hbkz9FR FBFp0FЃ@F_ObkzOzpR_HbkzR( &9F F_OrxR.иH罕0@ӕ0@|0@-MF6+ hi<{/uHoxqH?oHAF FF(ѿ_jKF R_ R_ R_0R_HB' 0RAF F(FVH%AF F _Or06R-;(oЃm ՛0Z_ ;_0RIտ_"0R/=HHO=KFPc`HjbhDCSb8K!dB.O G԰(?#l0#@# # Ft`S`(@D0պ 0BjCbORO^jjN@#xs"3hBBK6BHbM#JJJJ@sCs0栆g/@@0@<\0@,\0@<\0@0@@@@@KnKlO S+sh@ кOк_к_"!o F f +O O7#1#d FDB"CoF(!# H C FOHBDZF(Ѻ_## FabhmKB]3h0+@'o"9F Ff0a000Oscg Fy#CsboF13!;#A19!!9!?a4""a aoB+@1 BBsa# 0I0^0#`On3h#+WO#0##8KH$@#`# G*? F`S`"(90CE?x0 +(JR#pKBKAt#rb$I0Bt "H"Ob00J FGbHGjHb" F!o@&TKE1FH"X<;B< < E [0@@0@pp\0@4\0@0@[0@X<, C B@XJ!h4GBF#)F0F8HOr 1hG#)F0F0H z9D" 1hG,H5hjDxGo#$HP+32jD@,8++'FOH9FBDhkDG8wc[E [ FoOb9FOt#d5t3w]Fu \0@p FDF d B(Fp0F546L5*z Ѕ*Ё*Kɲ_1ppG0"SC|3JhD10"SC30"SC30@L5Zz#2@JhPm@pG0@Lerh**1*4𽱳# !%_'LCSq_!h1`11zCAC#C3C_"h1_@#h!Y4#"%# !"#!"#4!0@Lesh++$o0KhL_pFusUI_'Op' pBO'pOsh+:+ M+h3_ pSp+h3_p pSq +hq3_q q rSr!F,hT'@_'r9' r\s' Ls4D#<0@CQBxMKp-M44F4t4Rh F0F!O FD[3D 4N b B;t k/=8F!(F4GRF8O3!(FG (F 1G2F8O3!(FG(F 1G 2D5(FG?DD4P[\?cZFAF(FeG(00300?DD-EFF FFB  (2F3Ft ( ќBkϼјB o O\U U cD3 3cD BDko O\U U dD3 3dD B D4LEB F0F!fOr!(F`ch++!o@F9O PF#QF@F(рF_B ( FoIu@FO ch++4s4R@̣QO  "k\ S@kTE os!\ J@THoI40@-E LEh*СB$!FTBXcBGLLe'h eFq_L5AhI DB=x .xk- _'hOnNG_q_'qF'hq_hO Eѵ Fѿ_&hQ_$hQ㹽h?h_N{" DB! " DBhA  DLhDBx+#h#DB$0@-AUJFxUNXp0 +SHo2h*Dn_@bo32hm_@_'Od2hOeD|D>H!r HO0"O1(FOzpPm0@-A !O1@FFFFhSBrh!h[hkH1`$ F*FH炂0@0@pFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA^"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1opFF" FO1F("O1 F( E Fp@"O1pFOS"O1Os"! Fch ib-AiF.t F(!"70FhI`+hC+`0FdI"bI{"F`I@FuB^KB^KB+hC+`0F[I`0YJBc XJB WJB^oTJB C뀫CbhQhNJB#chZhJKBjF0FHI.P*Cs뀫Ccj + +,Os"! FBcj F ;+"#OCFOBF2(ۥhch Fiba FG   o #OrchZh$KB+H! F(H !C F(z)h F"#"LCB!(f0@0@0@0@`@w50@@x}@YsrMtMK0@8FF"O1 FOd# #Oca#aa(F80j %h<+b<# `C`@b```"aca h# `L`h`Kh`L`h i 0"`o Fc khlhih `pGh8cYl `j`bpGCh\lhh_9)KJ[\Q\O!O Fg@2CFh@H`\C@%C_Bhh`C)C ),Cr0@l0@F_#"iS`_"iSa"h`h"#iai F"F@@S$Sp FFF?!?(F)D Fi03F*F F8p@6H3omp߃0@ibi[k`ikS`ik`pGpFF$kh[jBo&!F(F4("S   P C: ;"1F( Fp!Ch[jBoF][1!Ch[jBoF]@_1#-EF*IF F~O#@SCS(#|] COGR% ;8CB%3CG@Gc) F F ۣi]ciAAcicibS0@-EFF F#Fh1`hѠiOhBB`ihOBB`i h"`biWabiaha"OShh@` (#h`hi2U"@E"h^ COL^&  " ; B N& # C F&@FE( F( F( ۣi]ci@@cicibO h F chl]l#]C< h 0kJ_bsYa@R0a h#Bh_sYa_sYa h1%iR 0CB 0 F0h@m+Ce"chl[lw/&m.0F@(@ichi]ksizE*Ed+pEEhBйh-qвiOW!(F+hk_C_*hc+hk_C_*hcC F$(F=`h(chFOzpUch.JbchJX0@+/@+/@/@M/@ FFH#h0@+F FF!L # h 0 #@CppN#)F h 3x}0 !# h %(.# ! h (#)F h 0@+ F F# (р#!F 8 #"$!K`]0@#"-!K`]0@L?! h3B h@?!Ҳ50@(p%&"&M F(h1F( 1F(hȹ1F(h (@1F(hP1F(h( p0@ph )F Fk !)F FhG 0phkhDGFpG pG F ܿpG8 * PD8(F8 Z @#hk+i+! F+iG(88 X @#hk FkhG  p8 @ hki !G pG R hkh" DGpGKF!l hbh!l M8l H  Br ]ʄ0@o%hiDh@X\_pG!F@i`i@!o  F!@i$@ihh#D@Ҳ_ZT8 F!F@i "F!hi , 8ao  F  * 0, +J@i!V Hx0@pFF@i!F@!`i`i!`i"!`i%p@!8 FPCiFXi!QF(F 88F F!`iRB"!`i{"!`iv"!`iq`i!il"`iFgk)F F`i8@"!Z8F(F F(FO1`a F 8F-Ao)Ekk^lhq<.@x= bE yB"o Ӕo.& @ V`"` .>3O>rE" 2CT"|[@ V@*B"XB=@BHOR,BBBB bdYdT>>3O>rE?r" 2C:T"|[@ V@*B"Xj{:B"R" B= * *A"€€>@Do Bk<!spGopG#0k ZX"BZZ̀0ڈBUڀڀp1pG pG9!L<`cgc>d#e( ޱ{{˹KJF2FPFI  `#aN@##K`O K :" Ju`jhk``"a`z4t0@1m0@0@X^0@0@^0@F,p"@/d?C??  "0<B bш @Ӏ##cd#b#LU0lB 8+@ok F(9K-M&NCԡx1DL@vZDBF $(<F% E]jB%E],Т{bh±! FX|qajB!BZ{eAsbjchB"!F@F# {\2+L@B( io ktC#kU0 p!F눛#`C눛C!Fo,!F#T0>0+k#0CpFop) h: kkBHc$Lbor b<@9@>@8@Tlm(Lebb,`U0lB ao<ok&F Ko?Ku?s???B ؔ?#?#h[i! FG е(;U 8 lB:ѐ/**o*m(ebb"`"AsO,~ p,Jh*$OODl/kp?+k/o#-Eԁq0{>zF= O %}?}Հ#{?+++JKR#0I@"HE#?O }?+\h # F O @dRsBq=е(:UU(,U$< D[9zpBβ>oJE1FDU"h?C?#hc`祆0@-AF'Oxhk Хn ?2F!{H#k†0@F@7htDtt?Ozp"F){@H†0@! h AـhـhۈpG-MF1FF hS /BТ # aa&0#100# 0+@ $pO , 0D(0 0( p+"tD( jejF1hhs@𼀲؈ @,؀ F)Ji 'o(X( OHHOXH H XHX(hP"&>O#  $0)]Е rQ |!! pu &):іH6 8C !r& *4і/R0!B(F1 Faڀ&0+@40#rv(i8A!!rD r( h*ub{*\Z FhSCaQXBObhZ"hZ/"0Riqi# qi$ q hVs! hZs3|h_( k2C#Lc#(0 0' n@&  #Oc*CShC Ӏhۈ ڈ I#{H@J"! Fm!pB!ۈB#{@K2IHS0+ћ 0 +SCS #֖0@0@0@ 0@-EFFjTj F&0sO +h%ثh/Lڈr:O "hI 'n # Cf#%0hAhJ``C``kG#h% hB;"1籨i( hG#a#+bk{ #kb"#hZa&0+",,Zrhi) hGoak{+#+b#}+#ihS``"`"ahB *F9F,]FGF#saK7`3a{Cs0#i(Fp5#u` 0"F iOh1Fi:`G@4;h (FBHlO0=0@ 0@i 0p h hd8DkFah)hhhhG#c`h)ihhG#`j) ihhG#bj)`ihhG#b##`kc8phF0 F (і0 HC0#kahBУh)F Fp@hGp0@pjCjFh+ciCi!hhGFK`#"&c`Kea#a#h!F`#h2F^`ihiGB p&b!Fioo ` 0@JF\H0;زpGD ;۲\D7;瑔0@{F+/i[ ih[hGj) ihhG#b#j[`ih[hGj)`ihhG#bcjih[hG0#0#0#s@kǿF&(1 --:&& F"XU,\xB5-ѝ0ԝ C 0C 0C 0C 0C8 p%:&pF FCi@0"4 D[T4+4 FKdhl`+`K)F+apip@"hiGop0@"Kj`@˿ piFh*21i>J>K)Fa#iK/sF=K:F#F@Ѽ bjJ @5")F@Fn@ ;|!}DR  j9F @s$B  -E F FxF(o8F`h=J (`bsShb 60`304C#b+Н00.h b,0+PhE%-0B)F%H$H?O2H (OC $Ѩ acbO3a#O?1@ !?h `(4`cjs``cj`#sa )F @p b @D#aP 0@0@0@i?3#?@3 N ?T"0`$?H"F! (#O53`(FF"Ip"F(" I6("IR( P )0@z0@z0@"0K`F FmD!Fjh HO00kii@0@(F ,0@iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1Fb(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD](`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F#z.#>F;"0Fs#{!0F#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF2FiF@F&(F%F(?AZFb+#,1<-MF FFx+x.FF5/+\+0F<@o UF;/+\+ci;*0I0F#hZj"[jc`#3#a+x+*'IKj3Kjc`=+x+o FF(<XEF8ZF0F<wP<1CEAF0Fm(iz!hCJh *"Dc`+O 3#3#azh0@O0@-MXFI@ FFF(5(@2"1F FS(@р.ii )OO$E{3F,-x KBq+F FNFdDE{'mh^bk+Cr^Ex F ?O@!?F(O3o!FH(FbHv ) )OqOaBMA1F[F!FTH h )Dj 1J1V*!FD(F +!+OsOcBZFBz3F!FY(2H2,KYFBE,+F!F=(!RAq!v+DYFh (Fq +%+OsOcBeZ F(^ **OrObBR[FC FJKo 5o2@R0@e0@#"#]#J`J`J`J`KJ#?`pG -M KFhFF0F@I"42TO &F! apppqqRFIfq 2F RFAF 2FKhMӹS0@^7p N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`T7p7l7|0@M0@KhP )A1JhB  L#h3 +#` H#"#`K``0@<7-M*F FF")FOHMҹ xJxC#(ыxxC#+"ёOy/ 0 :FQF/ B ѣyyC#г6@0F?#q#qFBFF4:F!FPFBFF&I:FYF FF51F*F)F8FMO;h+"KhSEN0h"AF|#MFFRF FLG"AF(h!h(h#;`#`3`ъ0@T7^7Kh8 pG-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*{ [2!!p!ppap#qbq4GHFh'F #;F`pFAF8Fe>H(b"!;HF(\^##p#'cp#6Hpp'qF(Z-(Ra#cq#qq:F0FF4+H*K'F(FF@Fh<#;FFAF`p8F#7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)tw ]##p#cppp41F Hp4;0@0@ 0@(0@0@0@-AFFB!x)ѽ)ex5C)]2))[()hHDT3+R#,0@,0@+0@,0@7+0@7+0@7+0@+0@+0@7+0@7+0@7+0@7+0@7+0@7+0@+0@,0@)S!,0@+0@7+0@+0@7+0@7+0@,0@7+0@7+0@7+0@7+0@7+0@,0@7+0@7+0@+0@7+0@C,0@)5,D":Hd"8H"7HZcx+"4H- #*F2I2H':F1HE#.JU/F?-@#*F+I(H?':F)H1#&J/F0+- #*F!IH':FH#0/F"HxKp"HKO*F8FO5王0@p7l7h7d720@<0@Xt0@x~0@ ,3-3"sF1F KB#MEq+p+x1Fl+xl,p@˾pcSc-MD)FC+*x+Cx+уx+ F"Kh#JBR[Bk3:FoxKBx*5*Kћx+ F")FW#")FlHP"kKkHhDIjKx l4 F|@fKx+Ob!FdHcI xbH{QF"aH,#3`_Kh\IF]H!FM 3Zx2DUHM"RIF( "QF+?yJN7h/?}/?q/O FA0BI@)F@R F=IOb F#D#wcw#0JwFwhg5J R$ "% 4BF#&IF8"I4BF BFQF!J9FhpD# FC"O1)DcScP7L7X7,3-30@T7Ë0@0@^720@S0@Mb K`K`"K`K`-M$cOcH<`(!F?_K`_K`Hh%1`@@R! FYIOb FO #VJDwwFhQJ R$ "% ("","0"4#FAF8":Ia+F*FQFp. 0FC# (FCC CcX*K-h*1 "@F#$Kh;H#P " C" FD#O1KIhB#H;`+)DLpIH"P2`0@0@S0@Mb^7-320@-0@KhKhBH\@r J Ih@oOcFF`@)0@20@KJ`J`"K`pG20@"K`pG<7pG@d"FH o?^7L#hKJ#?`Ja`@aQ`QS``##`@ο0@#8+H^*MF` +hB"om%K` F8$I F#I( F!I(" FF +h3+`Kh@ 3KFh `KhsKJ`/BrK`K`KJ`"K"KO0@<7Vf0@X0@[0@47870720@20@K(FFK`pG20@KhpG KF` `KJ`Ozs\CKC `MbKhKuK`tK )F F`@߀rKh@GOv@qmK]B(FFjKB[f{#{C#@V[B&e}#}:C#[@v@w BоB B@𣀳o-@B@)F F@jO:*@@s B{{e|F&#|vC#[ :*oٮxxF&vBg.e+x@*`+\!(F(V".JhB3H" yyyC#[ +8kz++}+ k}+/H@2F)F F@v+(~k~@ @(>Bi}+}}C#}8A! H[IhGL7H7@70@0@T7`0@KOsB @s@ B   pG pG0@pKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjt0@^78F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubu^7E"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! Fr rD7FFB"w"JFh!4{rd+uu#",v$kuulvvvT7-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F 4$K`K`K`K`K`S F O0oS0@M0@$$:!H8 -3(()) + #@J?O( KhcH Kh#HKh H"IH*( CF(H H H t7}0@P70@T70@Y0@^70@܌0@0@ Hf" K` (H"K @޼Zf0@<790@("\K-M`O"YKYNhZO`F<e F#;`MK`-/'7 HL( DK`:A"AKo`>H":K`"6K`"hb-Jh/JhB"h#`G3h+3h++2+0(F((oL"hbFH1!hHKHh --$hqo?t7<74707(3W0@T7_0@0@0@0@-AHF FF:!@FF@F;op8`*Fq FS# ,D<(*FI-3+"K`<7=$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fhq%!J!ueu[v#vuu%vevK6`uK u(F` K`@?t70@)<0@M0@T7x7-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! Fr r%uuuu ubFFD9F2F1F(FMt7<7T7OKONhR2h:*\fs\\OrREI FPCH0D FAIGAIC@K@Jh42?I F F'0;KD:F Fh9I8KD F:F6I3hD+ 4K+ F:F2IDe$/K0J0Ihh h/H,"-K`ObR+K$h[k%ObRO@s(k%I$%ObROs(kI$%ObROc(kI$%$%F 870@ 0@$0@MbPy0@(30@0@0@0@Í0@88<8@8X7<708ԍ0@0@0@-MdJFh BbO9h)aJhBЊ*. "o𤁲oв@`" :`$RJQN`4cEOKOKM LIPFWFx(FsHJHJBFFH#;`EIPFAFx(F]AKh2>H#;`=IPF+F G9K`9IPF F <*K52M`@ EE+L#EJ+#DJ}璲)*`QII!9`I* `OI0 `I `BH)hHmHM88 8<8Mb880@0@0@0@ 0@$0@/0@K0@8 0@088,8(8$8Q0@_0@0@9)0B?rkfI h3 `0C0aK`aO9h)rи03B( F2"SCZK 9h$BS+hUI0UK>hTK`TKh"0*h[3OJ!hOLD2F \#hE0BT@M;h00+DCHY8hBMBJ(h(`h?HK)h hOzs!XC;J:H="9K`# )K2$K !hBPp# @!Ff)&H# +3+$L+h"Blz!J#D#cbHR!kc[;+?H"K0@$8(84888iC0@0@ 0@$0@8(30@D80@0@0@0@<7880@0@Jh3`JhBIH!@ǿ H K IhG Kh+н@48 0@̎0@0@0@$0@iC0@ 8-E܁wL0##0tH "!v qH( "!mnKnHmM "!b(`)hziHOzs+`gHfN "!N0`1h)bH#3`@W"B9F^H#'0[Kp\Lh"!F@F0`F VICTH#ҲQI " F!FOH'sFMH|GKLIDJLHvKI hcKKhJ0C@BGHf FL9IEH^!hIICHX h!AJ@' >K?Hh?K$`F=H=K `^;K2h`;K;I(h`g:HRE"9K F`8K`JO@a5Ka`4K"`4K!F3K4HEOr2K2K`2KE |70@0@0@0@0@$0@"0@T0@0@h0@0@P7@87T7ʏ0@8ߏ0@0@ 0@0@l7p7<0@$3[0@j0@0@0@0@80@ 8D8 0@iC0@e?0@<848880888X70@88( u(] 8FF#h FkiG"!( 8Fj !`h-(ahH|o0@FCl hki㱀l FyByCyCyCzCBzC#h FkiG&ah@HG(ah@H?͐0@0@sFF(F#3`3q+hFki+A1NjFl0H[ #y C C C C C.by4CxCxC"yCbyC"iF F `ihH1F"FHiFH"iF Fj(Fs (FG(NbyCyCyC"zCbzCЩl"Hih Hop0@f0@"0@K0@b0@0@0@ hF+!F@( #h+pFhuF)F( dN0`0!F( 0`%`$h FpL8F $`ClK`(L8FhB #FHIFF0FX%O7( %x$ F0FB5DiF(FFh,<,3B Fgj1F`h(B٣lBf0@} z0s0Cl#`gdlO08F{yFkkl +h(FkhG(##`##q 8oN3x#H3pFH`Ij@< FjFxo'F@Ho#3p F(FoO(F(O Fp $oos(  ,#H Fp!HF(4F(/|$[lHHZhl.BHu[lD+H S K%0@0@0@0@ɑ0@FFH IFhF!FhF0@ۑ0@FFH IFhF!FhF0@ۑ0@XKIhFFhF8 ]0@0@@hH{0@HFH|(F8TI(<F@H"F F(~f0@0@X0@8FHQ08 I( M(`{+hB"K`穑0@X0@X887pONF0hM+hBH,`0`p H@(|p@ T8P8~f0@0@) x"+219:*K? "+#ppG; Q/b:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/Q ; aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P-PA/P-PA/-]/   }2 e//    q } (  }}}q d} (, , h   D4D@DDDpDDDD\DhDDDDD D,DDD DDDDDDDD`DdD DD DDDD0D@D<DDDDDDHDDDDLDDDD(D DG DGLM DHpDHHHDHHDl Hl@Hl`HlHlHl@D@0uH 0uH@@@:;v;<t8D};2SAɳf16$?===2SAɳf16$?@k0@o0@o0@p0@p0@Wd0@p0@$p0@+p0@/p0@8p0@>p0@Ep0@Kp0@Gn0@Qp0@j0@Pd0@op0@wp0@p0@p0@p0@p0@p0@p0@p0@p0@0@0@s0@s0@t0@t0@"t0@.t0@8t0@Xt0@8(HTw0@ew0@tw0@w0@w0@w0@w0@w0@w0@w0@x0@x0@'x0@8x0@Jx0@[x0@nx0@x0@o/@ p/@o/@Ղ/@/@w/@/@/@,|0@/@/@/@@@@@@@@@@@x}uu@x}e @ @ `ppp00'@B/@/@ /@/@Ӣ/@/@Y/@  !"#$%&'()*+,-./0123456789/@!/@/@/@/@ /@/@W/@/@/@/@/@/@/@/@_/@5/@u/@/@/@S/@E/@!/@a/@c/@G/@m/@l0@ m0@1m0@4t0@q0@{0@0@!/@'/@S/@E/@)/@#/@-/@i0@=0@u0@0@0@    !B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>Bypassing DPLL failed 0x%x DPLL locking failed for 0x%x Clock enable failed for 0x%p idlest 0x%x DDR3 H/W leveling incomplete with errors ti-musb-peripheralti-musb-hostgpio_omapi2c_omapns16550_serialresetting ... A335BONEA33515BBSKU#02A335X_SKA335BNLTA335PBGLA335_ICEBad EEPROM or unknown board, cannot configure pinmux.No AC power, switching to default OPP ti_i2c_eeprom_init failed boot_os1.500A1tps65217_reg_write failure tps65217_voltage_update failure BBG1ddr_vtt_enam335x-evmam335x-boneam335x-boneblackam335x-pocketbeagleam335x-evmskam335x-bonegreenam335x-icev2am335x-sancloud-bbe-liteam335x-sancloud-bbe-extended-wifiam335x-sancloud-bbeomap_hsmmceth_cpswti,am3352-cpsw-phy-selcpsw,am33xxfdt_root: %s SPL: fdt_shrink_to_minimum err - %d SPL: arch_fixup_fdt err - %d U-BootLinuxTrying to boot from %s SPL: Unsupported Boot Device! SPL: failed to boot from all boot devices U-Boot SPL 2025.01-3 (Apr 08 2025 - 23:07:41 +0000) Can't load %s: No load address and no buffer %s: Skip load '%s': image size is 0! Cannot get image data/size fdt/imageskernelloadables%s: can't load image loadables index %d (ret = %d) spl: ymodem err - %s Loaded %lu bytes UARTThe Expected Linux image was not found. Please check your NAND configuration. Trying to start u-boot now... NANDyesautoloadNo Ethernet devices found ethactProblem booting with BOOTP usb_etherUSB etheth devicemmc_load_image_raw_sector: mmc block read error spl: unsupported mmc boot device. spl: could not initialize mmc. error: %d spl: could not find mmc device %d. error: %d spl: mmc init failed with error: %d spl: mmc partition switch failed mmc_load_image_raw_os: mmc block read error Expected image is not found. Trying to start U-Boot spl: mmc: wrong boot mode u-boot.imgMMC2_2MMC2MMC1%s: fat register err - %d %s: error reading image %s, err - %d falcon_args_filespl: error reading image %s, err - %d, falling back to default falcon_image_filespl: falling back to default spl: falcon_image_file not set in environment, falling back to default spl: falcon_args_file not set in environment, falling back to default argsuImagearchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imagefilesystemFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageinvalidInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImagescriptScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwarelinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareelfELF ImageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390shSuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-V%s: %s: %s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? memorydevice_typeWARNING: could not set %s %s. regUnsupported %s address size entrydatadata-offsetdata-positiondata-size/configurationsdefaultdescription%s: Missing FDT description in DTB NULL device name! mdio_register: non unique device name '%s' Error: Cannot find high speed parent of usb-1 device alloc space exhausted loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileenv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d setenv%lx%pM*** Warning - %s, using default environment Loading Environment from %s... OK ^%s$Error compiling regex: %s ## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flagseth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" nowhere/aliasesFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cells#size-cellshimport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! %llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s### ERROR ### Please RESET the board ### RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.Whole Diskhdusbdmmcsd%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x DOS%s:%d%s.%sidescsiusbsatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdubirootroot_drivernop%s: %s: error: gpio %s%d not reserved get_valueset_dir_flagsgpioinputoutputunusedunknownfuncgpio@%4x_generic_%xi2c_generic_chip_drvi2c-chipi2c_generici2cTimed out in %s: status=%04x Check if pads/pull-ups of bus are properly configured i2c_probe: pads on bus probably not configured (status=0x%x) I2C read: data len < 0 I2C read: NULL pointer passed I2C read: address out of range i2c_read (data phase): pads on bus probably not configured (status=0x%x) I2C write: data len < 0 I2C write: NULL pointer passed I2C write: address 0x%x + 0x%x out of range i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! Error : I2C initializing first phase clock Error : I2C initializing clock ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d MMC Device %d not found mmc_blk%s: timedout waiting for sysctl %x to clear %s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s: timedout waiting for status! OMAP SD/MMC%s: timedout waiting for cc2! %s: timedout waiting for softresetall! %s: timedout waiting for ics! MTDnand: error: invalid bit-flip location nand: error: Unable to find NAND settings in GPMC Configuration - quitting omap-elm%s: uncorrectable ECC errors (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYqca,keep-pll-enabledvddio-regulatorregulator-min-microvoltregulator-max-microvoltqca,clk-out-frequencyqca,clk-out-strengthAR8035AR8031/AR8033AR8021SMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700cpdma_process timeout fullhalflink up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc Updated phy address for CPSW#%d, old: %d, new: %d ti,am43xx-cpsw-phy-selti,dra7xx-cpsw-phy-seldavinci,emacNo serial driver foundomap_serialep%d%s?%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! falseidlein/statusout/statuswaitUTMI-16UTMI-8musb->config->num_eps <= MUSB_C_NUM_EPS, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%sERROR musb int-queues only support queuesize 1 ERROR int-urb is already pending on pipe %lx Failed to enqueue URB to controller MUSB host is not registered Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! timeout sending packets to usb ethernet USB RNDIS network up! highRNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:ef:00:01usbnet_devaddrde:ad:be:ef:00:00usbnet_hostaddrmusb-hdrcRNDIS/%sTexas Instruments%02X%02X%02X%02X%02X%02Xusing %s, OUT %s IN %s%s%s STATUS MAC %pM HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready cdc_connect_timeoutEthernet DataRNDIS Communications ControlNo UDC available in the system All UDCs in use (%d available), use the unbind command usb_gadgetInvalid FAT entry: %#08x FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) UPartition %d invalid on device %d ..Invalid FAT entry Error reading cluster ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d AM335x U-Boot SPLhostnamebootp_archpxeuuidInvalid pxeuuid: %s bootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d bootfileDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again netretrynoonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) filesizefileaddrUsing %s device octettsize%c%u%cblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) tsize TFTP error: First block is not block 1 (%ld) Starting again /s done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Error: eth device name "%s" has a space! Error: %s address %pM illegal value Warning: %s failed to set MAC address ROMDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethrotateethprime, eth%d: %s [PRIME]ethernet%s%daddr%saddreth%dmacskipethmacskipload_simple_fitspl_load_simple_fitspl_load_image_fat_osspl_register_fat_devicespl_load_image_fatfdt_fixup_memory_banksfdt_find_or_add_subnodefit_find_config_nodebootcmd=run findfdt; run init_console; run finduuid; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x82000000arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxusb_ignorelist=mtdids=nand0=nand.0mtdparts=mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)arocsdxbimEPTGMK(((((AAAAAABBBBBB0123456789abcdefwait_for_eventwait_for_bb(4$,0  $(,048<@ #(-27Oo/Oo   P!:0@" Р0@>->0@pGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDH   F !Fh a a8 DBpG;?JKFdKaKa -EF F*M+OB*K`ER00L \$KB43B"KB;B*y*KX hDCH 0!? ?W#IHX5"SEr BR  NB~FIHX&'@  0%%FM #x#`0#FF9OBЄB  "F4{1HBHAG2*6$`B`A+)h D 2"`K`H  I"K`L H FPO1 0S$h@)4$#-M&NF3a&KFhFi EE 2i;h4HIBF:`(FkhF;F0iD0a,9hBPF)F#DB: "paI F 2iH0 L -E"MF+h iFFDB,3B#`##`%h F#FAF:X$#hB$##`P(F-h5BO :FAF(F!B( ,#`-,L H -MFFFF)h0FOQAF@E,1F8F3#$  F2RZE*`0FB"8F?DpGpF F0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF zi [40pG8pG/xРoWРoWt`8Р <0,,0 S__ 0/0@'و񗁀 _/_ РP/0 /0Od@P TP  Q:< 80QR:/  # piF$0 k3dkBd#iF'ppGs0F[k`H F:H!X5(HWKIt,FHWw o0;  FGp0k7>Q cpGF H:03 F HWH F@[^|pF i(F0Fpo!F(F(FO6F`IL(ZH@0G%@$0C#&@CC'@CcLBLBHo )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHW (oboxF=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk ! H  H4  H8 @ORHWɼ!-6=G8 4 8 :8 pGH40J3 `pG@pG pGHVBd-AF"KI9kkIH%lW pF <k< kYAHW|j"kak?HWv#jbjj=HWp#i Fp@"!1F Fp@#c* p-AFKH(I':FIIV FKF(6F FK01F FKW"F FJYk 9F/#F1F F7JSf(CB+F3HV!#- FAF+JO{+O(H<(&H7($H2x"H.8C"IUG( 7"IU;(1F FJSJo1F FL(ەB+FHV#1F F JKET)XJ0cVHF$ F"FQHUF("d NI"Fj LILM" KI"E JIH1_Cc_EOH1H1_Cc_E H1!F"c Vv!E "\kj_#տ_Oc6HbV{j_[տ_Oc0HbV!j ">&B,HV+HVT*HV")K4Fa(HV"%K`%KpH1_#c_JH1H1_#c_HH1PFFHVeE " V!E "YFh0OapDsH0jHF"fIU(eL$"cIUcK(F"`IU `K(FXHH"[IUZK(FQH"UIUPCxI+QLRJL+F F(MINH9FMK0&_46_JH 9йGHV=0ԝ C C C C C;H98K8&_<6_6H 9\0ԝ C C C C C)H9(K(Jx(K)H)FF8&H95`%H91FH9-Fl)FH8 I Q 0L{" FIUX(!F`8d=hBT)G[lDu}ꆀꆀOKFjKB"HU@  0@,,0@HpG50@HpGG0@FH8jHU IH8b HU x I H@8X HUIIII50@:0@,0@#DBpGx0*<-M0$%T&F "!@P P"1F #FF# "!FL# "?F0AHV6X.Q [E ! 2! R! V  ! f"!FPFB"PF fU2 -.*SEp "!@F-" R@FUBF#0! ;2F 2HV! 9F0HV(FSF@!Jh0Vy " 2U"AFHU" V(U{h5|`'`c``U3/KFFBD؋B FHVyoBӣB BңBV-E/LFo FFF@x(F+I" -(F9&H&(8FVoFUaKAF8F";xH3F H( a 2 H( HV3F H('((BO-MiF0C F0 "!hH7hH8#eJ0)0h!Vw@O 0h GXOFh((*QFSHVoZ8d#AF8F R() L;e xed@F?( (M@H#AF@HVYF@F F([7HVt'o4Jyml2H1Jyml/H/JymlF-H-JymlR+Hl)Jyml&H#!@F0s#!@F0X!@FN 0++0J! (/0-H'ߡ@(d({((|(({l+i00+ 0 D0|k!0h(!VtJ)D@Ւ * آK@#hqhN(?oF0 00+RѻOА pOo T F( OqXF9F (?XF*F& Ѹo8F;mKpJyml(?kmH(fkHkKhxWF hHV?hHV<dHV2?1*?!? 0 BH BEBBcl+;Д"0+TH sF(JH8IH8*ԔFolи@ F=HVf-E# FFhK`xF )F )#) F+R *#k`44` ) #*0,IF+"\ *ѧ(`X#E(h3#0#]F#YFKJF(F ##j#ahOH%ajMHUUj,?5=H7!UIF((DH7CHU=)FUF#x +1 F>ITFh RF!FFTp# 0(FTX#)F0JO()F/HU(F F)ITvF(4%FOQXFI_)F!HYF()FH%(H7'`h+?ۮ[^Y9 iQ+ZlO K`5F(" U-E FF FFF(( RF!hHUo F2FQF(FQFHUm;F2F1F(F(E 0 -MFF+@=!HULo F'oaT:FF  +++)F' "3"+FRD(F 2FHUFGH nF(jH"!U!( 2FHU FDoi@a!dbd`" T +ƀR# ABBABBBAABQBBBBBgBuBBBBBB"  + +khc`hTh`8o Ja2FYHUx( iTh`(RI iTF(T\`a(#3p\FFIiT !0FT1FBFaTi/_Qi+Z1F#j+O cj+H$j+A(#8cc-,#c/" +sR#BCCI@C@@CCCCC9CCsCCCC9CCCCWCF e ߆ F&hhwn`,tF.Шhg`TQ3"+FRD (k"FH |$D F}H FFT&F FT"8D"F I HUvo# }IUM2F(F pF%Fh`h hUhB Fp@@80F6hsF FF "!aa#2F1F(F#Fk~F3hk HU$hc`. F$ FpHU !&!-M$ F iCJ 3 @K#Fji(hF(mЫF9H77F"[_E'+,NF3HTH 0FF0F,K Q(GЬiEDT<#@D$h@S!I@FTBFAF0FE(0F Mih1W< S"(F+FW< SFDF?hFQF0F](0ih HT4 gfff6M!`!!-AFFFF!"0#s 0g`#v$0`cv(FS(FSC a=# "iTH/!(FS (@Coo QipFFF HT, p#Ca!F(F F !< S/pG0FFFB"@T!0;`<<5B0D0`W?3#D 8`)8FL#h+"(FS> h8 4o܅h+ pGB 0 FFh FFIHY"PFIHd"FIH޿y"4-M F9`زF F4F"I#K#HBFT!F!HT--'B E,O3AFPF #D;`FHToBFYFPF Q &)FHTao%RF@F QN o"""h""FIHr"8FF#h+O0`h()FSj h8 4FIH)PFIHݿGFIHӿ(4FIHɿ"FIHZ#F2TK` H7& "!TO@+8H7 "!T8,P@ ,DBH@7 "!TF`++H6@ӿ"!T&+B-AF FFFDDFE7F(GFB)F F:FSB<s N FFF1hX1h+F FF FT Fp#iF3]FH8 F(  l8 pG-EF#+` FFF3`8KIS#slKl+Б"0+ hCHT! h_#l OlH5.7g;xS9F F9F7HT]%! Fx /2I FH'0H )F# F-J#/9F*H)F F( 3x+1F F 1F H# FJHF(")F FH)F FFHjF)F FH` `HO0ߡ\,v,,_~,,!,,,-FJ@lB hpG"!H6l+pGO0pGF"HS@ M-F"HS@ V--AFFF:cHT'8FF^H) (0C#* CC+ Cc+@UH0FSH,+cjQJeS+`hi`q@Dd hs@ Dj),q@[ekc8kecc3ikdsid88+eL(dhi2D[`i+acD`hi D;IB @D*b48kb @HcDdD<; @ @DDcL8S,8x +lDh(dD`hSDRB@D,fh "I S("iF@F#FB"  " I \3DO0_----.0c@+cb{#{C#{CC{Cckdb}#}C#}CC}Ccd) (0C#* CC+ Cceu&t6C#v&CCw&Cc+e%0$A!&0AA'0Aa!D)`bz#zC#zCCzCck`$ %0`zB"&0BB'0Bb#zC#zCCzCcD;RB@Ddb|#|C#|CC|Cc`%0$ `|B"&0BB'0Bb#|C#|CC|CcD;RB@Dab~#~C#~CC~Cca%0$ B"&0BB'0Bb#~`~C#~CC~CcD;RB@ D( )B"*BB+RbqЫba`&B"bBBcBbb% $aA!& AA' Aa`&B"bBBcBb D:IB @D)( B"*BB+Bb*0+bqp&B"rBBsBbjb% $qA!& AA' Aap&B"rBBsBb D:IB @DeF FF PHT| ) (0C#* CC+ Cc+FH+48+xCHq&p6C#r&CCs&ScД%0 $p"zG'B "&0 GGB B'0 GgB b:DyB:; @D#|C #C CC c;D; @D"~B "B BB b:D: @aD`6C #bC CcC c;D; @D3`) (0C#* CC+ Cc+ohiQ#D;RB@D1`b.5.d.+0+]o  JhB]JB!]¸o 'V"M-MFFd"!FQF@F(QF@FF"FHHR'#FJFtRCICHSq 2AF AHSj@H6FpRF;xc9Fj0000001.1J1111112.2J2hKXBXApG׷FiEihB F-? HS& |CA Y ih D0`  `h2`@` F@hFRF0FRByh%)D0FRt(,F FF@hFFFj@7`hF HShC"@jCb(F9F FG(ЃF2sFFйh "Fh"1FZia3`` `0i0ChD``(Fpo pFJFF!ChS]RzFp F1FvF O+` F po 2-MFjFFFm0FhhF+tnah  +8!XF9JS%O ]F [O QF ]`BhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFi5epGpFKF*F!JRa kEQ{ c51FF F(F6p#d#bo QM FlFB k6,#bco-AFFF@FPFAF8F F5c*hBAAF8F`"#1F F#5_+`o' "Caa 8Fh`h`iB 88RpFF H4@#F3pXxKhR(FR`0pp`h3Kh(FՅ7F F(` F07(`iB08 -A 0"M"L  1F /K\CBkh+ 7D5JIz( "AFHQ O3BF)F#(@333 pGp FFV!FFHQFh(FIQp(F IQX#F3p Fp HRCo#)FHR:P"ц33pF F"!{(Fkx J##k#Fop1F(lsF FF!"FhRrOB"`F*FpK` 84𵽰 F عci ifiF0FFu/F:h1F F#K"`W?+=*F/Fo@"O1 F>("lkP"!lP# " #)FP( IQF+ HQ(Qtd(o 4O!F-A FFsF"!0F#kj1F J(FF o9F(F(EnsF FF!"FhROB"`F*F p-E$FKF(F  BFIPFR"!F(h XhFE :hB;` ooA4R(H F4<(F"!Rj#F 8F8+d/!Q`C4"Fb{jUJjJ!+FJRQ(c o 0F7#b0F(9F2UcO6F44QMK` U4F F50KFK` 5-MiF Fư+[/I0FQ?F0FQ`ihF3F" FF(?#Fb#H4FF5p  BFOq0FArF "e2x¹mCe `O2F0!F;FPFF0FQd(o ge#e(FFoz4F F( FH!-AHKܰ"F  B?J1#F$!>JR?@';H4(h!F9H4Fع7H4ر!FRqF!4H4"!0F gF@O1/H4*(o F\*Kh(d&H4(Q+l(cF$H3F$I=*#H4(!FR< IFF@FRp"FOq8FAȹ8FQsd"!F @!FH4ne(e#bmCeFo A444444QR8mFCie F(( F8@A!F(F8@-E;H F!4F i((^ei(F$F)F Fu(K#l1F2"# k5@(= ic@F-7khi !!JR!k" Q/! Q#p@FB( @F3k"k=lm3gmm!l["0F=po=lH!H45F :F4 o%pG =c  Fx## bC(IHDIoօ0F9K`#C` 4FFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-M F!FFF F4!FPFF=;F*F!F'FO GE(xh.$=Uh q-* pJ-p%MqE$qqh $"]h-+ PK-P%@PE$P@D732 `A @-M$ FFFCFF&F;O ZF!(F F ]Dȿ6$ȿElEL &FRK$FFFFF(`L#9F0FJFh#`#!5-MFFFF !F(F S+ +"9F(FEDIFDHQxO0F1F!F(FF F ;FR (F {+ +"!F !F(F $FF ,#F#FRK$!"FG F DO4O E4BF1F??F D -5-MFFFFsۺ ;F2F!F(F MFSF2F!F(FES(F FFFFECF*F9F0FFF, FF*FFIHQ F H57FEFFHQH4F$ F0P70#F!(FJF?FzFHT5b5p5-MBFFF$ F!=J(FEOFFEAF(FE#[EBAF(FFO8:FCF(FFy F3F'HQ=TFAF(FF,(?O !F(FJF8FFFHQ8D::8:99::: pGFF FF( >HQ{O5=HQv.Fo F(9H F(6Hlf0FP#D3F F1J1Ig F`/H3` "!Q(&+HQG F F( F(0B#5ӱ" FFHQ$ F(E FHQ'ah F O ! F)F FOn0F:;:;5;E;V;;l;-MF!" 6# O75FFFp@F)FD+ (Ҁo  Z*e/v$dddd")F@FEh@F E Fйo *S+P(F  2[EܺԿ""*e8O 7 /)F@F EFx*5 26DB5ZB/"+0FO *DBF"B ܺ :RFb]F3HO5C5S"Oر2/*yW 5B-/*"2pJSBSAFRFFO 3-Ѵ4B3R:IhS2  DB3HP:2HP>.$9F FF)F5HP.<)HP1HP`k-HP.#9F FD(F+ HPd.9F F()FHPUHPP+*F1F F1F K@Տ<<<<=&=9=L=b=. x==T==-A!FFIHPHP! FFIHPHPI FDDFIHAPHPP& FD*(F+! FyIDexJ#)F FDFlItHP&9F FD (F++")F FDF2FF]IgHPw)F FZJj>F)F+s")F FD/2FFRI\HP)F FDwFLIXHP.^KHP)F# FSJD]FDIRHP|.SCHPwOJ#)F FDMFHPGO#)F FCF:JD+FH)F FD|(F+->F)FcHP'1FHP"I *HP1FHP&H I $HP 1FHPH+1F FJ1F>=<=v,=T>!,> >L><f>4y>)>8]'>+>>>ChDpGF FFF2( 2F Fh)FhG Zh`O0-MF[K#Ƞ#SF2FFF$SK!F"(FD"F9F(FD"FF1FKHPy *9F(FD(F }BK"!F(FDF?HO>IF@FO(L!F(F(8K6HYFPF!F(F4J Dx + hS0HP70H!F(FD!F(F )K g(?ZFCFQF0F\#K B!K@FOm(K+HOIF@FO(0O2SF2F!F(F(H oQ>??D?v5?B??L?j????칆" FFDT@!OU)F F` )F F pN")F FD81FFHP N?'@ @sIFD DIFHP p&)FHP!F(FC(F+ +"!F(FD1FF HPf!F(F6(HP\v,=E@v@GφF 80XBXA F P0XBXA F T0XBXA 8F FC8clh(F$!FD?F(FbFFFJ(FD#F!F(F JD(F ID(o F8ooo)oI; !0FDF0 Fq-MFFFF#MD%O \Eo[FRFAF0FFF0F(B  F,F F8 FlFF{ #*F F(o8o-MtFF| _ Bh 3h k+JR#H:FYFP+O18FFFYFHPcќHP F kF8F#F,AYFHP8F ڎHo!F8FCFHO-d0Hh!F8F(H`o HZ!FZF#8F8"FF8FCXZFvHO0!F8FtJ y [mH9!F8F(jH0!F8FL0_BF!F8F0Y(j"!F8FR(c"!F8FKF([-@<"!F8F@F"!F8F*(@'"!F8F"(@"!F8F(@"!F8F(@"!F8F (@"!F8F(@"!F8F-#!F8F0L|FpF@F!FF*F0HO/o-&-(!F8FYF&HhO!F8F`HFYFHOo+rzh-:D,ГB*ҹB(YFHOoDЅ@@@A$AGAdA,+A>AAA#B2FYF@HO#8F!F ??0(>ѝ?0 +9Ы+6-`#BF  FF 2F+F9F PYF&HOopFVF-0FCHB1FBF8F>F-ѝ?0H `! ` +?A +F `6.*B-:BaBByBl FF I:FF(####9FF F F&-MF# F *rhr@,r FN(#!NF(^F"+FFB#Z##)F Ҁ(FjJF (FDq( ,€@E4kh+DE/aHO'o`  ``08FYV0FO2TFO' CE(CFDJ (F"F(FC##Z##)F !(#5HOg,#! FNF#;#!F(Fr'JF (FC#DF FZh ro F  F (HO4o sFFDH O' FfYFDXFDqH 9FXF( XFD0'JFHo `8B C CLCmC-AF&@sBXp8FN)FF8FNg@8FN+\,+ Fs+O p,!N`$ FpELNB)F hN8(4TpF$ FpLNB)F hN!(4-MFKhF_FF,%$K0(F9F0F\F(KO50F9FJ0FCRK<"(FF)F F+F9FJ0FCB```'a`aia bXF abbh H$OMi#j+KC?}PمrDDDDD-AF#F#`FF FFe@1F(F0 K#`O0"iG(KL?D-M#F`F8F!DJC 8FCIO F-ں#` 6#)F8F9JC(^7IN.(Y6KAF0FC)(F#VĠ!F"0FC0"FAF0FC*"FFQF*HO")F8FCF&HOO0!F"0FC@!FN@HNIFXFNxO3!F0FO8H!F0FCH  )F8FCF0 з?'F^Q??D칆??-M"FpC@!FNF0!FSHO"O0FPJ8FC +F!F8FKJCرJIN O !F8FCOFF- ڸк?HOO #)F8F;JC(\9IN^(W8K0FCW(F"O2K!F"0FC\"F0FCV"FF*HO1)F"8FCHF%H"!F0FC@HNMIFN+`!F;F0F8H!F0FC$H  ?q)F8FCF ЭE?(E>#E'F46E?SED칆?F#h h"hHN( FEFF #hKh"hHN F EHpG-Mh F "l+B (omm-II`h(F:(F FIjFF0F!F4(9I@FF(>N(o%*FF1HO0+:NF@F+Ix(Fo "(F&INNF(5)FZ7 N6X@F0GF( F7/+F!JOrM*IX(fIc(F HOVEEFEEF#F0FHpGHpGHpGopG(opFVF "!"FIlIl"IlIlpIl 8IlFo0Fp Il IlNa(FFFFFFF*K`#C` G-E}FF  FRF!iOJ WCF$?miR*o }2My)FF(Z@FiCihDo-#F"0Fi(oOr!F8FMM@FihhD+-#F"0Fi(bx *O0@@* :aD#xBch 1oooŰF9FFjF`- C)F ;F0FJN FEoF8FF FM-Fر FI F! I" I HM K I(F F8@͸o 8GG+'G2/G-AİhFmFNh,h FD#h"HhMzF(90FI3(h( BF8FIF+h:FYhF+h8hl F((hF(8hF((F[FBGFFFG*pFFT!NPFF HNG"Fq(FFH$N FpO4HGpG FH1!F@ҾFFHN| F&( (H F HO1 FE H F: F(HH}HHHHHH*FF Kh@&$!W$N4BF0FV.FFCXhNx+;:+9#+7 "%I`hr`h.  !K0B HNO0 @=Mh-h-#iK4#1F0 8 Nch.ݣh.hglT'I}†sF F1&`KHhVNkF"1F Fp:IsF#M FLId2FaCH]pTm۶*̿XhHN'Q"iF LNw 3]-MFF FFFFU;ܸvgI`hMF(@FhNYFFhNYFF iN9F2hFCFZHNC(F1h(ISF"FAFSJTKFBFFRHN,` "NIBF`hMF(?ѠhNFF(FS4`FHN"DI`hM0(F "jL6-AF>+ FFO0" Iphp(ChbB-hKB)FF3A`G Pi݁0F#*3 OCHN0 M`h)hj()h`hFF(`hNmM F"FHNVMF#H"N]fMp@NHk%F&+lk1FJH#kHH#*lGH6.!hCHahBHhAHAHLNz?H0>H< "+ FFO0" IphJ(ChbB-hKB)FF3A`G i݁ B!H,L-Eh,T,N-M0<,O'kM#iKlPFQ+FaF1Bq OF4OOYDFBF Er,F! # Dd! Bb #ah#HMe0  ףp= ףTlM-AF>+ FFO0" Iph(ChbB-hKB)FF3A`G Li݁*sF'H F(HM p"phFM"FFhMOzr N d# FjC I*F1FHM O00@T-LT-AFFW I"XhD@hCF:F1F(FFA`GO0pM,hB#HM pHNM(HMHHMh HM HM1F$hB!ءTTTTTUNF3h+HM H0FH!H0FHhH0m!(FF(H0F(0hU(0h)8 .-UUUUUV*8F*IXhLLX %hB(F 8-h "!hhM#F hB HM%Bh3(н8@O0醀ء4V'NF0hhB F-(F HM F#S```G` F$hءLV H F!0PFH0 FpZU*FFIXhLBF$%F#  sW%@#5B g %aW"Mrx+O0]-MF FF (hB=-(%sBHA(F"ɲH I HMr .D,D+F2F!F8 *M W pG$-AF FFFO!;F2F)F FFAF F(F*-EFFO4 F^h"0F-IL(7'<9 IF(4OUoBOH HVLIFXFLv"IH"?#F;q F(FV,yhRVFM%Yօ0 %F" F!F*FHM(F.Fб#FH"F#h;FF)F0FC(FQJKBF FLY* "@!KmXY" !KlYCh)j3BC`pGi;BC`pGi23abpGj:;abpG0F F8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF L8(7iro F>0FfH#F"!HMC@YsF(O@IhLF#hh)7Ob~Oq F(Y#hhh"h 2BhBYhFQ` `"`Z`T  FO2)FB pSOr(FL3F6hO1FhLDHH#hO1h(FO2@hB ! LF8hL(` (Fz H#h)ia 3k```#y+"#huYY O1Fl8 HS#HT0O1hH# Z%Z-AFFOVO'hBh/(FA*T &#S``FP&HM F(F + "I LZ F%! lF FMO1 BA \F F(FO2 hFB+FQF8F J.i(Dsↀօ;Zօ -MF)IFF"SCF!&J>%I?F(;F>FF! FhO1 BA FP(F8L0F4 F O2 hFB"F+F9FPF F((F8FFDsↀօ -AFFFFFKE,O1 FBID)F F1FKT0FK(DO2!FBUBF)F8FH -EFF @!FF(Z"xhF;]@Or)F? F&?xhh<F(FOrB F>5h;/+@"(FIK(FKO1FhB DDa YFO2)FB"Fh0FBb2FQF@F KpF(Fx0Fu FLL iƀ 8F HKFH8F#(FJC( FRXZ Y-AFF $! F'Caa 5E FU KjFPU#F F 580F$ F$7FFoBF#FhB/L FO2a#+KhD#b(9-=! " F3FF(<&FVhB*aiB)(F9"HFL'(FF(iXiGF(F"HFLK`(Ѱ%a(F99F?hLL *]ZpZF7H!`CaTF K J K Ih Kv K(FFM F0LࡇZa -M! 6FHOa /`8 FbO8F  `#a%}%/0OOb)Fh%`*F I9wFH:Oh.h B@,h1 F.JKBF$! FOFaaB(F(@𯀅KJK(FhKIFdhJByIS'8F(@O 9(@vIS'8wF(w 9(mmIS'8cF(c 9(Y ! F@! ~F(@F< F"S'?Fp@F_F>(kiB6(FX/W#h+7 h hGF7x-@ Oa DF(?VQF0(F0;JCF@T(7G(OS ^CF$! F(-Caa7V"##"## hh G7-Of7>ZFCiGF7/73H(FOXFKB?/? ؅ZaZօHօaZ!F(`OD7"# PFG7$ B'"AF0FpKIO E@/?(F`(9iKjJjK(FhiKiIF-hKEOc7ZFPF0GF7/+ ! eF PO1FB Wع8FRO7hG7t(FA.R0Fz/Z#}+?'SO2 PBH0O2?I PH8FYV 3 vO1 P\#T#;q<``F(pV*0(F-Jh$F(  cV#-3Bѧ OO1hy@B(FFBhhh#p#h`chS`#S``U (F5F6h O/F塼aZ Va*b>8 A0HL .M+x+3-L-I h8YF('"h)I8('I h8HF($N1F"h8(0hAjhIhGJ;+`H#+p7q(N!H@F(KIK2hKbF F<KB O0Z*؅* ؅**"[ޅ=[a#-M$!F F FFk%DE ZF F:FF(Aѣh-JB݀ (#)M9nBF@9@hSE F8KJK FhKIF;F0F9q(ZF FF(bihE FOR *F-h օ0a[[b(7E(KJBF]-M$! aF(_I_H>F{#F'YKDEр -(DRL0FrkihE@(F,MJNKBF F hB"(F:BKF(Q,BO(FBKBJCI'F(ѫhih;BѫiZhEM0y+л#.OܠhB 9PEF,9U(#F0F9("F(FF(г$HK>FL F("`q!F(FJ((FF(h` SFh(Fe0mbl_h\0jYkV = =@F= =8F== FGF>J b ؅ׅս \օ2F(F)IQF(<(F&IGF(2(F"I0=F(((FK2mI("F(FKI("F(FKI( KJK(FhK&FKB?%wLF/FFLo!\\(\Ž3\}YYXZa p"!I\F(0X! oF(/!dJ=I> F0(FL F pKF)FF0F(F, KBJ KBFLDsↀօC\ pX! $FH!6~F KF1FFF H6F0F@KB,F FpL]\ s$UB3Yhx-(Ixp)*s)ѕ&!0hL0=6.AD3F*F!FL\%Kh+HKF(Fp$KhF]-A*FFiKhiHhH.mgHK# !XhK-FaI`hJ( MM(9F\HK !KFYH.GF(`WH.AmFF(FhFJ60FJFPH.1F4F*|MIKDLH.%FKI(K&IH.(lFH.B]EI FK4CH. F (AIKD@H.F (>IKD=H.F (;IKD:H.F0F(J0FJ@(FJ=(F)F8"@F8(FJ2(F8!@FHBFAF)HK8FLr8FLF9F$HKw G!HI HKjzIKF FIKAH眞]]]A4Y][^24^V0^p5^]<^fB^H^Q^X^d^^3]"^O^* "!XhK 0 $/e$/~$/$/$/i$/r$/;$/T$/]p*FHK "p#h`h Fh4f8+F2FahHK 4eIctc$/Y$/$/0D<F MB  4B xH+\0F Bb-AF8H F-!KF!F0FF1H%BܽA-HݺO7-*H0F0FJ5D0FJ0D&ѧB"F1FAHK5%HK1,4lgBHAK#V%JHBBF K5BHK OBH KbB;Fq]F HK5hhhhhOgxQhh=hFFHKK!F`H@-h.:-M*FFO4K"IXhJKF(~ѧ FF%x-+!KWF/9б-?0F>c+ q+'?+  8%-0#$ Khx(EIHK~ F)F~H-}IF?(5uK1FwH`- !KJhB/FmHFF@/(@:FhHKD"fIhhJF(;/kFhK`@F(!FhK/FChF1F@p@ FPHK!F(iKFFBhBJHKu0F$>N3hEHi"DIhhJyȹ/"h0hh?v?F)ЧBHrQ4X$Pl.N i:hiHiITdiij j0j`~*jNjj"(FK*x?* 2`23Q))FH+F)x2 )Ъ[+*0MJx])F )14X$0BS\Dx])?ZKJ3 CF{MJ(FJHS4BDBED7hhxg+@#/!/њ0s+)i0h ?i0n+s+H/F!F0h? !FF0h?0Fn+/!hiKdFO5{BݓB 5n* ]E !F"0h?;F@F-!F0h?ښ0s+@Fi-O;>HK!FZF0h?aF(b)`ۚ0v+Q 4I/ "!iKF-')F F-"h*IK?O6. FJ7D FJ0>DBܻ!F'.۵T& - YGIK7B1FHa+F@F-G s+RF? FHtj*jQj }jkp+#l+@O//hQF0h? ,=)F"F0h?F`"FQFHKO l$-(!FHK(FXHK")F0h?UEF `xK)FIH K4,!)F0h>CF+ZR#Eကကက/ ; ; ; ; ۀ{J{H.hF 0h?khF(PѠEeIjH KeEaIgH K] cHKTZIaH KNE^H0"^IJh0h?T/0h h?(2?#FSH?g((?FOH hhxh+f/ѫhxg+$HN)iV J4 ,|X$h @H PK3h>HZh,FK3h;Hh K3h9Hh K3h7Hi K!F5HK3h4Hi K,3h1Hi K 3h-Hj K,3h*HYj K0h?>F'HK&I"J;F(G/⫨hKR3haᆀ)OkGφ i(kh$k@kFkMkJkUkbk vkk(څkkkkkl#l:lQlhlll"IhhIFȹ/"FhK["FFh!FKTBF;F0hMt˻"IhhIF(]ѫhxp+'0h>F~HK6}HK3E/AF0h>?FvHܻAFsH2Ka+"FhK"F F(iAFK:F#F0h?3(?FbHd+'FhKF0h?J(?FYH̻"XIhhIdh0h(?ԫ?FQH"PIhhIPFع//FhKe!FFhK`<0h"F9F0h4F@I"hhI-FH3h+?/ШhKB(?!0h ?|F0Ho0hJ$")IhhIй/3h+?!hKX(?ժ0h+(?[̺"IhhI(/OШhJF0hD./FLSl膀lll m*m.mEy)R]m8#x$.s$.$.$.$..'.-AFF")FFFh4*#h)ЙՆZ #h##`1F HJ#h##`)FP#jF8FF0iFHJHNtT݆-M*FFF@*^h4"0FII+(IhIFO 4%h"0FIIF(p+x+%2 aO FAF8FMHO 4O UFO TAh"FnHJhFWF,CF+(IF=1F(FIdpx!J#F1F>\CC"F1F,4B=3xs+c+i+O4t+&"(FFF)F>HJ!F8FF F&&&6IF02HJ瞹FmF)F,HJ_!F)HJ$..F_Fذd !F[$$HJ_FHJ7$B H-?{(FX7.$7҆Xt[tztttttltu*-AFFW I"Xh@hCF:F1F(FFA`GO0,Kh+H o` .uFFF. 8F FHJ:  FhhJFFHJ,!F8FF(FH uv-v0HJ ]Nv7F F@+F"!F0@"o0shFFFFH.$F"hhJFH h%.ۮB ")Fh )F HJ45- @ pO6 rvv* X0lHJ$O1Xh!JPFF HJ!F6 !F@FHJ  K`vvv.FBhlHJclաlHJxHJu FihChhRhHJbvvGφv*6 h,<,3B  Fj!XhJFF6 F(!FHJ- w*sFF(!XhJF0FIHJ$. FhJFFH FHJ FpO4-w5wF2*sFF,!XhJiFF0FIHJ$ .FhJwFF( FpF(HJO4-w5wF2#\.*D@x08pG3+O0pG-M*FFO4 FDKBKhAKhAKhzF8s$1FrF:I;HJt$!FxhJ!FhJFh(Fܸ!FhJFF_F/(')F;FzFFF)F$HJEGEO!H =DGE  K`K`K`KHJ ^*H  HJ У...-w5wLw>RwXQ 6*-AFO0Xh!J!FhJFh-(F!hJ|!F iJwF@FHk;F"F1F(FIHJ )F(-w5w-AF+FO5(F!phJC!FhJ>Fh(F(FF@{9F}F!hJ%!0iJ!Fc+ #NF0B I1FFIHJ]% Xw5w-MFS+FFM!phJ!FhJ!FhJFh(F@F!0iJF8FF8k)FPF:F I!HJ'8FFF!FD E ЫhC`#LF(B I7!F IpiIf(ѫhRF#`!FCF|F(оXw5wS*-EFO5(FXh!Jk!FhJfFh (F(FFs1FFع!hJM&bFD!FHJFF'D;+ܺ 2FIHJFIHJ%#!F F  @F" 4FAFHJq`w-w5wS-E*FFO60F@K@Kh@Kh@FEF@{Y9F=F(R8I_h!l!FphJ!FhJFh~(F,+HٲJ!*H%DD K K` K`, !H"H !HJ,F'KB#F)FF(Ѻ%D)FHJ#F)FF(FIHJ&{,...XwwwwX膀,w-w5w S P-A*FFGXh!JS!FhJNFh(F7@FF8k )FF8IHJ !hJ-(( .F i!J&F+F9FFIHJp FIOztO0Xw5w-wx F**O 0J,,xhJ,O3$@ x*+!0J߸$+Cx{+0FF;}+# p,o+FpG pG-MFFFFHF4Lh BF(F!hH(T hHEOeh>PFF8FF FHx-G @ 8 (Կ  (̿  C1FPF|1FF8Fw-! #XBXA  B  BBB  4\E)FHI 䅀w*FFh(F(3 H ! (hahho#O0w"K`KhK`pG/ //KhK`KhK`KhK`pG//////KhK`KhK`KhK`pG////// ]@ O0MFA`)FFF(`*FOa/hϱx I(F(hFHIO6$DDJ3FFH4 I8Fo(Fj?0F!?!F"F HI!FH, 0F MMwxQ|xxKh#JhY`ppG//#I/*D?pGD(/8 K Mh,L (8(x b< ^D/A/(/-M'O4>FH}0@#FF;u  F 9 ieܺvкs Qh;JB (f(H0+7d!8FML). 8(u-BpH+F2F!F)HIJ)F F)F&H,f;0)h@FH*hF0AFHBDI.PF(@F@F)hH+hDE3CD(DFB8F !B)p  RF)F@F(O0 H}ԣſxx8HFF,4 x1PBPAK-``h"!IFHI F8d$F  IOzpHyԣIymyy-M}HFF+!IIF.L !hhI@.F!hI<F GFODEFmHILP0H $Lp"LP0H (cI(hHFp!F:F`HIi! F-AF@?\K\H`I\$EAFYHIULP0H L"LP0H ( FNI(hH:FF!FpKHI4 F!BF@ AKFH`EHI%EKEJ`EK!`EKEJO5` ##" 0BK`BKpBKpBK`@K@J` z((% rF& l Р ۲B6 ^Н0²S >S+v LFOo#$NO 3p##sp 3pN#p0 00qsq9D-yyy z{EzKzzz /$/ /%H/D/A/@//..(/ F UU+D? 3B_# > _D. +D? 3B| (wS+M@#J`JHp#"KpJhBH3`+@~"+*q!"+jq𱀂xN :Ҳ2` "+qx`@(@|H+pO@q{H+y  O-*rtJ@y+pO#jrN"+r1 +r +*s"#ks #s~#&s+t#+p kpY#O psp 0T0.Dp 3F?D*U6#PJFhOJ`@)hFG"IK`>?)@@BKxB#`0AKhG,S*) F;%"KH`)F F*F)FHI()FH+Hc!FHI K`$.(/D/A//@/./ /// /zxy*-MFF:|pKhKh!F L^;F)F"F(FG, K5D`Kp`!h 1FIj KhD1FI_FO0 أ\/X/L/*L!XhIH `!hHI L/|* 3: FF!H A]O0wF+F;!hI!FhhI/F!hIHIfHH#F&%DB$B1FHIT HEFHh@FHD #FH`U4O0|ﾭ|-AF+F*!8h Y'!xhIK!hDhIF !hI#F8  -`+D- pO0 L/*pF5!h "2!phI!FhI( -#h-##x-#FF*S:- D#FB+#FF*3:O0p FF)Kh)Kh!F)HI-!!h'HI&H (;($O;x-+.kBD!h (`h9FI2KhD-!H!xHHI#B K` K`- `.,D- p .+FT/P/w }w,L/}Rw*F O0pG*F O0pG*-EFF&h c!`hIM!FhI!Fh-hI( H   xH] O0L/}-M*FFXh .V۫++JO`hR#I'O!;hhI;h! hI4FF'E$-#hhBЦVD8+F"FAFHI$BF9FHI F-##xb\绲,D 7O4$х(}L/-}_}8 FBFB HIcAh)@8@HIHIm|t-M*FFkݧKx[x4 50KxKKKKh60KBhhx40G(!FkhYx.53ШhIòx-+;0!I_. hI_x-++0!I_. !(iI.6!hiI"|I GhzHIO4 FF 40r+i+m++"mI GoF(@ԁ ػ @ȁfHH$w+$.&$VF_OB$\ 3!F 2 (*!F20 30 !FF OK!F(;F ?LJLI ,(F!F GHH4Os2F60)F 6 0(02F)F=HH}$6^ESEE8HHp5UE*#K4 p5 Zp!K` K6 KKK`K`KSEE2F)F$HHG6#HHBFF$2F)F (2F)FHH1$6^E605UEFFx/p/l/h/d/t/`/ĆʀvĀ>Gφm#2F80)F wHH)FvHH1FuHH$6^E5UE?oFF80#6  @C2F)F80 (eH$3F g8*F_HH#$ 65ZE kZHH3۲SE?4EFTO;;xCE[EC3\h*FLHH# ;BEHHGK7B # ~hDHfs@Hkr*Q@)@08J9N_2F! "5HHQ-HHN 32J*))F0Fs.IE-KF,HH7籈E @)т)F0F + #I$J+F))F0FI# l"I G(. 8h M4湁ԁb߁>Gφ0߅D߅n*ƀĆsFFF"HFB0`x-) PRxB"!H ` p #`O0-M*FFF@G[hxKh Kh KhKhKhKhK HKFphHxG,(1sh[xx+-Ѱhkh 3ChCj w-[j+hr-яH  #7w->/V'!HGF#r-7/ V'.!@FGF(;Р ZFAFG h  # J_h͍ Nߍ썆Gφ'+.Q?+3;CYn8~{Ď؎pF FF01F HH$ Fp& #` F( FXڿ:F*d&-E2K!h F&F2F!FH F,K,J1FF+HHj&K`i0+9!F&HH_8F!hhH!F!hhH!FhH(F!HHF'! FF!hhH!FhH(F!hH! Fz(FJ!Fz HH!O7_K4R k*F Khz@ * !XhHK!hGO0 L! h^pH !h0{+ H a F+FC#O!8h<Fȱ-!`hHf!FhHaF#F*F9hHH0F-(HH jFah (T0F)F"FF K JFBF HH` O0яK_򏆀*-AF?Xh!H!FhH!FhH hF!Fp#F2FHHV(F(HHN (Fl;F"F1FF K JFBF HH9` O0яK_7pFK!hFF(Ch+HH$ Fp.!hhHF FF(HHNh*-AF5Xh!H!FhH!FhHXF!QF*F#FHG0F)F;F"FF K JFBF HG` O0 ~K_ L h(( `!0a H  ׌BӀhz;۲+ J JR# Czi HG} ]F"SBБBh2$хIRp&FhhBp#S```F` (F-h8(F J FR J IhFG$hF_ `iFHG9 H $хI* F"H%"hxg+K+ M+G+k+m+щAQ2AQ"`AQ-MF# F??`vBv vhHiG&0F QCBA+z`H;۲+_J_IR#hjzGBAҩiZHGiz(zeF(9ib;m+bK+zMH;۲+KJHIR#hjzEdF9iKl)+z;۲+m>JR#hjz=HEHFO zmR 0cE0B+z0H;۲+/J'IR#hjz1YEsE 0  DO FOFO EpEA)cE?K+z;۲+JA_E`E?:hDI皔Ɣ$хI锆$х$хDs$х$х8M,h#I hBДBJHx* K(hxSFh H8@)ӿhD!FH)!F///Khh z;۲+JJR# KzI xIGH)" HF!FH)Kp/$хI/L/biBF Fq``N`a3%!KhB Kx+iBkila&`c`` BEC Zh\`#`b``2`YHGQ aEAhCBAJx3pu //Ǖ 0Fս@H)oFOrH)WC F 𕆀02@Eђ IB0G- B2I - BRI I -MeLpWE##p$aI x+,@^H) F @hiFuEF򞀻hFi Fl:#O 4D;;FFSoB ;hSE-;#=;?hWEѽii  #F=BFh F8D6C?3{˹hF&BFOؠF(!h@F)!4sjK-9#Fr"+o"bpF=Em,#=;F6h2[BBB#'FEEF @#; FD"K$pA!G//𕆀' N4h%hB$`d`#S``'`g` F ,F-h/#JpJ`4@ؿ//8F%0# FS``%`e` KhB I hB`K`p8@ 8@ս///0JFhB 0h%zBdzBh/-M3#FF ` `:!@FF;HG DP]E BF9FHG#iF,B-h:FAFiF(-;! FF iz(zȱCi R@ !x ;) (A;)@.Ҁ44`#x-+!O7F4x@+,0 x(+E )!XF.KRFS&IHG__F8` HGT.` /r$хIʗ-MMm,h̹K"`[`K!FH`[`@"!FH~"!FHy#J+`pH)bFFH)ZFOr!c"! ^%")F FN&IH)N0FF(ـ!HG MDM+xIH)PL FFOqH,pHGwO;x O ́h@E+#;p#`@` xS+9Ѐ"1FgHF%1F8FF*F(bHx,@+@V m#S`` I(F-h  [F*FAFa8p;x=+ YHG&IM(hhBt0-x7 {ZFF(Fp(ю,!#8F#EP0 AH8FE RE F F7HzBQzBh=-1K1IS%0HG%!w 0#9F#P 2E[# ZD<006#S```F` F$hr///1///ϘLݗ֘ꗆ𕆀8U0$хIu3FF "(FDI E9 5P' x/8:M+hBC9HF!FE(Cѝ$0 +F3H)(W#F%FZFAFF`hzYz(F=-%K&KS%0 F%HFFk Fq0`s``Or!FHE*hK`KpH FIE(*F1F Fq( K` Kpi毙/򙆀L$хI////FF -HF$ Fp`h 8F( KP` Kp0hz:Ҳ*KIS"Bz+FHF//$хI1-M*FF)ѝIXhELFFH)1FH)1FH)"Kp~ IhhE1F@r1FH)i(,tыONHF###"ZF(28F(*2("F9F0F###2#asa3a#T#a1F(FKIHFFQ<$hڼklQ<ΟԟȟP2ןߟ埆럆K_TF##j#$g#eHK(ѲH@ i 3F@HO 0F ki!F[B@2 "F?8hji23i(F5"2#F:F :FHFO @F 9FHF"DFHJi4- <, =   HF4Foi? 4/ <,  ?            nHFm"0FlID(Z# \ 0!hF"cI0FD_K`I`HFFI.!0FDF(ŀ"ZID(@XI FD###"3FYFh((ѭ(ʭ2F5QF8iFf9iCHF "0FIDzF(@~?\7!WF#FF(F(f"F1F1HE$bki 6hBq)HW3I i DSC"FD,@#",À$!(FqF1hJ𠆀>PVa럆ӡءgo}###"ZF3F (( (hoF*hH<Bxۺ i*h ;hRc*`H;`E2"hF2FCF   iFH FID(?^ FID(?W FID(?PI FDF(,"3T#23h52a#(F (FF1hJHK,FHE/+L2 F""!4#;`ki{`[Dia`BFSF(FF;BFSFqIqHEpJjK1h(FSF(FFCBFSF9F(FkiiDFDJ !F`Ht1F`HE~0F^IDF(ګ֫F"hE1F "hEH@(OHEX+LH2Or1F8F4FB($+i [B B8O@"!PFP*iQFSB (F8(<q#!F4HE$ hiiDG$x.HEo BW 64! "PFSW$0(F0jiD 0iBF 0#0#BFHEki4D框x_KT] }1Ģˢ(iii8 H"W @۲CTYFHE+i[B h CE "!XFW(0(F0jiD 0iRF 0#0#RF!FHkiD6s*FO0Xh; K`( G(ahHEO HEJ ؈䣆-EO FTNTKFTHFF'v QFENK`- --O5(F iF`hEehF(FDDBg@K@H'PObF:HH@FG?h:Kh0iFG=iF7H'7Kh0iFG3iF4H'4I x3H'3I x2H'2Kh0iFGiF/H'/Kh0iFGiF,H',Kh0iFG iF)H')Kh0iFGiF&H'&I x%H'-8F!h E#Obah3p!`hEDKOb`#h3p%rԈԈD-4؈f؈pH^l؈V؈]؈"؈(̵/F F F  F!!KFF" AH'IKF.FH'5 o F:F0FIE, ""kF kF I K-FH'(,o"!26՟bWR-AFFF" FWI `bChB -сh KB h;F)F0FFA`GO0 i݁pHF( [HMh,<,3B pl HHKlB+FbhHEj,HB (6 0 C 0/d)!b)c)O0%r)t)*V"O *P"O )&F*E"F!'"H   RE[xC  YFHE "F!FHE(FHE"AF F"F v B?v Hh Hn񇀕_Ȧ𦆀0-MFh#FFF 'F^F ;0`h x-)7!EY*F!>4/HP" !V8HBf5IEz4H' s)b) c)O0t)+H '+DF#)dF+:O PFM !E 4F;LP"!HB6۸9]* 8`1 H'd;F"FHE7 񇀔0*FM/ 0 M0hh'_FȱOa FJE"!FH(kh x IjF8#!'g p #!O0vΧէ'*FYhx-( F%'>>. (Ff+O?+#F::FITB`(EO5p!F"<,S_.x-.iF F'!o.a.f.нp@ G"),FH' pܧ-MFhmch*OF3iC;T#)FEFx?/ PFbh,IEFo5.5 E@6%O $O Ub C(hC  _EDbo@3B ## 0#TDcp3, F@6PFBȿ" KȿUxR!#' m!O0,*[h J# B_@ ]O0-M(FF}Z(^&O FZK#x-+ F.ICNF(A6BO6B>  RF =(D,="Or!0F %|:F)F s2xI+F*YF FID{0FC5-1F F'  HDO0 }ODF  2OQO<-EF!} FF!Or +CjF ( !} "AFhD xFBFù!F (//0JOq D. h'" h /0#FJHDO0RTT-A*FFO4MIXhC}Fй3+hh (w. b(i' F"@HD?IhhC\8"A9IhhCOF8"A\3IhhCA"1IhhC:".IhhC3F,H-K-J%FO4+OB(H)'H&- :!,!X$HD5"IhhC F(.ݮhh0F9F-i (:F1FHD|$(F cF۲r#)FHDn |TƆMM~쯆YhzGφt:D0FK~F2" IkF! hP(Fh +hca0"oA4򯆀*-AFFW I"Xhx@hCF:F1F(FFA`GO0d0*FH'F0$ F 0*0\h! FD(!FHDH'*#J)FbFHDF,ObI HGO4F44EH6QԈ-EF2HFFF&#/J &F(N+H'JF!((&K'IhDi&O *F ( >N*F (H&8`0 .*F (*F (V) o Fo 4EH؈j*"H&б!D(#w FX HD FHD$HO4F465F KFB C )8! FG(C(F8!?-M*FFO4 F^hI0F:CWF(@pFDI0Fx+x+]:+Cx+"F0D5Fx+ѺV" D' 0x+x-ѺFDA0Fx+x-9F0FNF!8#0=9F0FF  |0+CF:F1FpHDi$7F&FFFlK%O iKFSF9F0FaM+hcH0FaIC(?#TD0Fx+?Hx+C*h !##pF(*h!FBAeFBHD0F@ICz(0F>ICt(0F#M=T6eFF F"!hFD:hFhxh'`"#1F(F#'`#`-AF )F-29|KF4 kJ( hE$@  *%*/5>M\l|hhBDd d @HC{ "/U|"sT#6U!chF;+4J5JR# 13H[C\@FB( HSFBF)F+HCL)F*HCH,   ( ' ~HC0PFB(0FB(Cl )F ( (  ()F FT#;p O焀>Ѕ1OF "!hF@iF F0FiF~ 9ClhF @ (Cl Gаq ?$?Os"F&(!FHCP'-MFSHC1QI@QJ F 1NIOCMHNK FC1SJHC FGHC%FOEO1CEAHMCt?HCo !=HChta(F"hBцHB:HB70(؃HiAF2F;|(F F@F0F(F,wI`hAF(Ti[ !FE8D?4$?@4 nF G AF(F$?CbHB!F(F F\xi0(WHBO4WHFBzAF(F#F &Fiv@FsLI`hA5(U#iJJ{`JKB HHq O4^F BO:AF(FhGFxh$APiI` =I` +B U#h;#`#h+"chTo #o+phBhB\=#h3h+ 4#h;#`B>6 A2F)D(D@"h1FtH*DAg  >ch;c`hAhBkJkHAR ch"h;Bc`خhAhB_HA?ch{sh)N] +'s\ *$bhR@Fc`2)D@l&`&B@F&B#'Bu 7>F 6 6 #h;#`#h+ah)?U6J7HA ch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` |+'KS!`.#h3ahY1F(F@(F@X!h``BjAj+I hBH3h`BĿ#`BJR#` N J#h;#`JHA ?ch"h;Bc`ΆQΆ$(2{hBhB"T@i@ chjFD#h)F`iH(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D@#h1FT"h H*DA5#h3#`>? #h!T"hH*DA#Ά-AFF FF@"F! Fh#%a#s`~F.D#hah+B yB EѽYa`T"h!H*DA#h3#`Ά-A 0F FFHhFIN3+F pAO1K`K`K`K`#`8FICOb)F# F-0.0!6 /4'*F(+x vOñ!+:hrK)FS"@;h3+̿3FF;`lKhBnJ`h3` F:hiK`,@DFF@6fF~(@2BAto@F8F ,Fc (F$([ (YS A| } }| } } } }| }| } }|F((*(2E##7H#p`#+pO02H;!F(FF+x +Ѥ!F(FF@3B  .#8F#pI,DKDN#3k3q3#` 082 32($ Ά,"KFp,#hC`appGhZ`x(O0pGhxpGJ8?pGTdHAqΆHAgΆ "`B```aHAOΆ*-MFF:Kh\HA<f8H$ F$iO:K['h]AFHA!47BAF(h@8HAF9(-i$'XΆRFx I\  \[_(Р=XBXApGpGp FChhFB hd`e10F `0F#hC bhTch"h3c`Tp -AhF+|x*yZ"`xC#hc`;K J?PIZ? )F Z?Z0 D  DOZp(F?A+FLSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F?D=!F?Op0F0!XY\F!0[YB0F50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%`\dxhF!&F!0S'0B00F;07 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F?p #+T(DBp!(F(Fu7Kh{o4J`FEF ?P;h C (FDNF(I?;h(F&I?(F ? 7h(F I?(F?- 0BF46pF;!?0( HX@nK8 ;F43+6φhO9 φ`-MFF"!O8O %'  H"jKpBFF9F HOrk"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH@=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhGIφEφddMφRφWφQ\φ}! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H@#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?o j"K`#|/?K E?'?Ϯ!?~EѪ`φ K! K##Kh]QMh8M,h\ oK(``KaC`#`` 8Xφφ8) 0DZ FD 'H".(D! "@F"H F !F"H"FB1H@ 0[H@H@H"!FH AH"!H AH"K F`8!FH"! HiІsІ}ІІGφІІІІІl_І-AF "Kh8FA"O1ǹk-)FH@jF(H$4 ,н F?JFmFH&!F H%F@G4FBp?@F?4zllІцц pG pGIK [H0pGو00 o 00pG KF H0 R0 0 o 0 k cpG80 }C~#80pG pG  0IFX00O\C<0KF j hz0hZhn h HC цO2 !HLF"pd 'ц pG pG pG pG pG pG pG pG pG pG pG pG pG pG pG pG y8 \:"8 8 \"  ұ Rh2"J`8 IhR"8 8 0` pG80 ;#80800pGpGpGpG#HFFFh l3F+"F.F!iGJ=f0F BH;!R  !;C '@IAq[ @ A #1C _9F-Kе@; [   G '@f@@pF\  @@& @ _8FBсB H? F)F J= j Z #F,д Qgfff0ц` * pG pGOB8, ,P3DPHLFa 0 8@80;#80KFhw H"b 6=[]܅ pG pG pG 0 CsC 0pG HB =ц! H Fx" LH"=!"hH" ` "Eц D-H VцH}TL H? ^цfцhFE H?<\F H?H? 0H? ]oццGφц>Z 0I}@~  I K J[`<( D( +!0 8p_  pG pG pG pG pG pG pG pG pG pG pG 0H#3#s 0 0#3 06=j< pG#FJ3.FH?M@ццpF( H?>$ FpN4hB)F>($hцx"K`[`K`pGxt F("!j$`d` F½8Fhj[kK(F0)F H?O0 KZh\`#`Kb``h 8`҆xt-AO(h8 F( tKhpGt-AFO=hB1FH?y $4X?[hK1FXh> 4U$4 ,-hxb҆Kh0pGtFFF ;FO21FjG(( FFF@3FO2)FkG 8 M H,hB H Kha8@ H1?H?$h8x~҆Gφt҆҆-AFF" FF O0Os@B"AF8F (ѽ0DA 3`+pp" ~0H? ]O4  ҆7F FOzp0 ")F F [8H?H? Or0B@okF")F FCH0")F F 5H")F F, H0 @`d _҆ӆ҆҆ ӆ7F Fp")F F 0&H?S&H?P ")F F !HOr0B, 0Y kF")F FH0")F F H")F F H0 @<ӆrӆ҆UӆGӆ`ӆ#0"D*A,-Q+!A!ODg0"D BDoBg@@𵣰,FF0} G$?bp 'pb 〢OB)*:(=k)Ѫ #*4Ozp>%F-omoO0-MFF+FF2F!0FO Od $O+hn"A!(F##9C(n (sxCEo< o} G%?F+F"!FBF(F H?0 F }F1FH?'o")Fp$ӆӆBhF*@## 1fg0Y* "@! FOzp>B1 +g0 + + I H?o@+## f##o ӆ-EFFF%N@z#hn"A!d# F#1C(=ֲ")F2FFF(#2F)F#F8F(#x2F)F#F8F(o"xcx˱"(\\\3ZB+ Fڲ"pB #Ie"+8FOEY( %9=+ )` o8Ozp>o3 TopG Fh7n&A!Os;C"#AAFR(o#Bo@"Bgn"f0Fp & G$?ʲ#F!Fl(F(H?o"p1FH?`Ԇ<ԆFFʲ!J#pp#&QwBH?o$ED&1+ 3nhC$Os## "DApoԆ-A} ?FFFF$?+o }*)#p(z#FF((#x+%O38c9#FBF0F(8B ?4B#+pBcx0##x;4?#o"-MFFF(dѯHa q!zF+x{"(F?FB-ѥH!jFH? Ozp>b! FG?@ !?EF(A+FF! F*<ڴ !H?0F"x:*]"(F?jBx**3BO0x,**ѰE Ѱ?҇Bo(F*]&oo %Pqx)uH?;2x *FrHO;1FpVFQ]F!B 9x{x+R0+z+> )bH?8B_H0x[E2ДQ-ZH0F2%Oz1By&ok1# p F D9F " %!"&!;xDj#C&!2&!) )oԆԆԆՆ'ՆKՆnՆՆՆՆՆֆ@ֆdֆֆֆf gBp>( ")F@FH ")F8F)F "0F! #BF F! #:F F)? #2F F#-Ah`FFFPF0 H>v F1F(FVF(Ѹ(FDd#ih/`#"(FAA H>MBp>.(FA!(F%F(ֆ׆ pGFFF,Y(F3Ch+h;p$9 i(H>#;p3p(FiFI׆d#0hn#D$##"DA/0d#pA, *%)%hn#D$-DA"#Apd#0hn#D$##"DA0pGic8 pFnhC&d#"#FA#AF, 1+#xbxC"HCs_Cc#p cp0Fp-M ?(?NFBF1FF ۸@(F"1Foj F@9F(F''O Ozz (?"1F(F>1 =BF1F(F(۸@+7/O O4oг $$Bp=k"F1F, f"1F(FA1F H>$"1F(F2co$׆-MF:},  F&?(`"1F(F(7x1F / '(F:F(ր:F1F y3yx!#rq ""! yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/p/jѕ1+@##d`/g+hn"A!d##AA(F#A(x(Fb(&p, F(EO3c& 'hOH 9BcۘH 0"F>$E8F =Gd@Dd0&`azp a 9BW&O 9BWۉJhC#`KhBe#J` ,@4S@s@h#,9i8Fbc1+.+hnA!d## "(F #AA<( :}i616+"1F8F"1F8F61F F'! ]([H>o `D`{h `z``a6`T 9 ; g#?LJ BД ={iB/1F(F( =;iB #ihS``#K F =:i B"ihJ`` F`#a<h ;"1F(F Е1+"1F(FAF(F"1F(F AF(F$AF(F"1F(Fu"1F(Fm"1F(F0i2*a1FH>3o,׆׆׆+@9i "a pGFhhnA!Os#"zAA"!#3(#h9%H=7 hazhA!nCA@AA H=& hzhA!nCA@AH= O0IpF "!(F@C h0hn&A!Os ##z2FAA!#H= hazhA!n MC)Cb hzhA!nC)CW0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#(hI hnA!AA+hI0F zD4 CD@D0+ !F(hFO CECFFOs !FSF(h F(h 9!F*h9 E&(h9;Ѵ E 3ЛF  D #sa# F%0$0F j hOzuisBp= =ѣi3H>ao #{+ 3x++ 8 @Bp#++O0 ؆-EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0F#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x>O0H=FF:FFi(ۓb؆%؆pLF "! F`>##p0)F[cp#0#q@060 F+ # #0+kG`p-MFFFF*c F[F !-Lz0#`4P]E(!i%HjC "`*""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ ! 8F  DD-MFFFF*cE FHF !-Lz0#`4P]E(!i%HjC "`n(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ !I P8F  DDOshn#D$"#DA-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)Fsss"Os2F# h ( FZO0FchA0= hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F h(:hKB0zh;B;{+&B+ц1Fz USBCUSBS7~ W%0 H= 0FAhH= F5K؆؆"K`pG(H=LH!h= h(̿  @B؆؆-AFFFL&!1+Eі"1;+@8"AF F'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fczzc{ z{!{)0K+02H=V1J1K1H=O +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!bK$9(F( ?O# I#YPنEن-MFF'L (?hSrz0 "! F)##p01F[cp$#0#q60 F+ # #03kGFP?oH=O:0FB0+єL0:+єM0L BdH=k{+/sPF@`H< .p\K@Ԙ0"+#ks "I OO "^(Yb "!AH0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO ! "+H%##p01F[cp#060$H+ # #03kGx "H=shO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@نwن ن-EF 5, !FF(F8$ & F)0h'hn _A!Os#$?3zAA#"ABؿFOȿ;F !$J=V#Os0I, ~#F(s#FCrr1F(FF+030yF( IFXM(FGF(7Eډ爌نننh `pGopG-AFFFW$OBoT >DF1F<(< ,`o-MFFm()j+h+^'Fih z #i FG%FU$?Bbi*S f SF jG(ѣi+8bh,H( ۢFZ$_UE 'H=g`S GU ]F<*(=kh 0H=o m#h [h 3` jGF(УF[$_+h]EU FhQF<(=ooچφ-EFFF(7FT$oB F88FH=.OOO1 FF6H6I F1F F1[(F+}+"9F F1FF*H=9F F50'H=&9F%H=9F F J!H9F F6($+"9F F(QF@FcF(:'چ?چJچpچD-|xچԈچچv,چۆGφ8ۆKS CkGpFMU$kG(U$p@lG < ` 0 ޿pGF  0 ĿͻpGKS kGpG  0 pGF  0KXhkGpGjFGpF(8F F#(KC$P, 8 IQ`0 J` I` Ia IQa0JaO0ſ A㿁Ք(KS kGO0pG ` 0 ZpG Kh  0(<( K`č7FȹmF*(pd; +4, Z"hFI<%( 0"hF I<("hF I<("hFI< @ fۆiۆlۆqۆKh`FpGčKhpG"K`pGFF1hB 8F F )FF F8@O3F8FIFFF<` FI<0 FI<  0- 59F8  !FH= 穨vۆ}ۆ$KF Bb jpGp$KF%FjhB"J h=J/Dh1W77o 8F?F2JBٴB@CE8D@𣀳hWDG_`*J0hB`'JhB` oOW"Һ 82 V<E<'"Cr`  n*[2T*: n2 w2@T\bE ~"|2 ȍ􍈀E "B Dh$CEhE`h``Hsa3a``Z`@ DchCc`hP/``mh"\ ;`E?%*3RB;Fh10DGDwo D8F C08D;D@B0?5"hZ`hch#[+"EC%Db``k`"ch * C c` Z`` :-A#KF(Fp.F9( q*FP,E"'B(:F:$**!*!`a`"`Z`` F$*``!aaa#F! F$-MFFO@FM 0ԥH; +O T숿# .VE 4K hWhB'Dmh=' B  B6ܧ  G`W`T<C DR&T#D#CBOOC ERD#[#E=FpG˹FF08(o pG pGHpG\F OWHOB1F@H:(F$h8F0P! F,F F8P"!F FhKHldH3dd `  `o!K HddpGP"!hF- I:# KhF K K K K) ]v UԁOԁKԁGԁCԁ !!KpF FH Fx% :@&! FF FG(Fp!F*F3#4FsU&*-AF'AF48H;s )F(7BO0RFHC `!H+8 2܆ H;H9R  H;;"!hGFH;0=܆Rj܆  0H;܆ KF ^ Br jjH;pG܆-A FF(K(FF(AF"Oر{F(Bs6B$,#FFFz(FF(;hK0+@<#F"F!F8h<`(F%%X-E FFF'8F.!:%x@F:.F#'FO FBѺ*F@F!h:8 h:B'F  4'FKJKIZCÿTm۶Fih H;O!hH;K`i H  ܆܆܆-M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``:(  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`(ѸCF !2hH;5"F1FX%88{ 5;kBX%H; %݆݆7F FF , (O KOs H\0(OKhhOsdQ-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F:8@F:F$5? U,F$ F5BU :PERF@FU:(ѧBJF$ Foc݆-MmhFIh :F m0F:%1Fȿ_̿F:3(F_xF , ,t5A+FK< , ,@- #B%0-VvJwK #uLuH*FaC'(s([и s=S%:P @F:H"F@1DBSDB{$t0 02U"pD  2``5S%x$+и #IK! Os(((G( ( @XF:SFFSYF"-?@  ; 1E2BF۠ Աи  =S%:$, "vPFU7|H:FH:N%F (X HH; 0F:'{M+ HyHvX p=DHk{wTm۶Od>Gφ8F F:n( D<.+  p 8 (]UL*4+ #*4&7F (LH:A$P6--Ы+#-$473/$4o %434;Ho 43 4. |o1H(-/MOc#T=/F&44B(Hu(Д(44 $S@+o `(Н06?HU(ѱ(4$˱ I0 4[Bo 1DBܔ $۲BFdlmhno-EiL%#`#T(4*TCh(FF4TT T$T8T4T+T:+,YHv ")F;OzsXC(40+  C 4+@𐀄+4 4 IH7Bh! EWq?/ؿ#@Hؿ(4:>(4+  C 43404;,:04BQ> '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O d݆_ O-MFFFO pL)44+.+@O +404,:O04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C p434F e#)4-Д+4?|POo(4+  C M434dpG FL4;+ 6 3 0 - * ' $ !M#)4G(ڽ@H:d0&KS HpGЅ݆IK[FHDB pGAhB0hpFz L J Kp@޿0FciGch3r Fp4B$hpFJ K LB 0F!h9E`hp4hWF$ F!b(-E{F+SHEfh;)O)LJVLHE:о')K5) ) k)ܡH*CK@BHI^ 0~)І) >OZ: $ FSF)FH:MHHHH:AHY߆߆A @ކކuކ8߆K߆ކކ߆V߆Gφ̄߆`߆g߆v߆{߆߆FJK+zL'Dù#+rB(FciGch+r +zrhB6B(FsiG(&F4hpFF(!zp@ H:ڽh h3FFbhH:+i Fp@Gp߆pF#FFR0jph{"F1F(FG(opF_o\o%F"ܿ8% F `CiK`id`,I9I 9RP(F8)C-M FF.! FF9F F9c#,U FF F:Fx{"F9FH:bo(F0FF PF:Fx#RF9FHF1F8FF(#0oYF(@#{+#hH+ F烫N-M F!F`Fx"FoH[FH:Fo @FPF"(F9((FyI9x(:!(F9F(F9"FFcT4:FYFc ZFkH:FF̱#x FgI9O F:uFx*C *F_H:o o8hz ,BCiSZFXH:o O4,*;ZFQH:o\ iO 193!;#A19!!9!?4""a1F8hhc%$2F!F8hF lB4,ѽ/H:]N$2F!FF!F*H:QBb%Fx"1Fx"0F,F,6 "0F!I9 1FH:78hFi193!;#A19!!9!?4""a-z ᆀᆀ)Aᆀ-EFFFFرh$ hBo 2F!F8FhG4QF@F9S( FO4o%-MFFF Fy BF)F[F8F,*F9FH:&#!(F9GF((F9"sTFFBF8F 6ZF1F1FH:PFD, Fᆀvᆀ7F,hFk,H,, KJ;,Fkha3 I:O0K J~,FJJJJo ᆀᆀᆀG)ᆀ0F$jF!F(F4,$ F0F FF:F8FS( ѳhB ,DB4o! o%o-AFFFFx FF FAhCF:F(F1DA쿽FFFp FF FAh:F(F1D@+-AFFFFx FF FAhCF:F(F1DA81FU+-ѐ1+)#FrI  34, " I698 8"IR9/( O0O0ᆀᆀio@3 ?%?+F"!F(FO0F(F(ѣn+1+Цff-MFi?3#?@3 :` OFFx"!@#?  iH:OO3{`xh7F[F"AF0F(BFqh`H::!U)Ѫ*[H100Fx`( rF p)xIL)y)I0SEEѸ @)>;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,9.+y9ISBSA*x[*C d SF:%" R9z+yw0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`9RPIS0FAA;hD00:hSF Fx`1ᆀↀ=ↀ)bↀF"#F]-MFi?#?@F FF FH:O7F W$?#F"(*F=H:; Fa(!8H1bxsDF{` y(JM+%#y+J{h4Bј0*+Ѹ 0PFAAjYD-ZF F3F{hEѨ(a" BB+LL*D!x(Ѐ)IKj1FHcF:-6( F*+ѭ)IKᆀↀ=ↀQrↀxↀlↀFH:"#F FDↀ8 @BpFFFFF3F"(F(JIH:$ Fp(FmO4ↀ ↀFi Fi-MFiFo FFгrN"3F! F(3x+'*FahkH:GO:"iIp8@/+FbheHq:6O 0[0E 3F"YF F(3xk"XIYH8F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,8)F  FB@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#Osↀ0ㆀ6ㆀZㆀǔㆀrㆀㆀㆀ8䆀)䆀\䆀#jF!]p#!F0ahH9@ p H9;% )F#H59/#)F F0䆀䆀冀# Ip" F M0#\.#2$*;#$0Hpi!FF@="D?4$?@4 ?$?#F"!(F6(JU#!Bsty*Z@@(3B 8FO0F`"!hF"iF F88 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF *")F@Fb{#{!FC#{(FCC{Cb"F @FSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PARTFC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : aw" Oa"$0Cw% p#`&0+1 '0005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCb# tctCtt-MF HF(|,zІi@1FQF0F< @ F(Щi0F@FR憀k憀憀憀!P F0h#hkiGFpGo%pGF0h#hkiGFpGo%pGp FF&B #h6 4 F(&p pGjpGhj8" FFIl!F b(F#%`ca8憀FF F hF_F!j;cjCCFpF!FF(FFX"Il~ b"Ilx`b0Fp憀憀 pGKh+ha opG-AFIFl(COA+`5h`$+hB !F0FH4khS4 DS4D{`o o8 Fn#hBo 8BhR3 BjhB3 7FhT#3Ch hhiD)FF "iF F07Fh:#3Ch hhiD)FF "iF F0Fh Chi[hBo p FF*FDp@#h1 F # Dh𵉰FF FF FO3FF"i FFjF Fw`hF`O2Il! F(F N熀-EFhF1FPF:DF!FPF:9FPF:i6E(1k) (, `#acaf``` hK`!aba`j FGF3k# h##`ci"iS``##aca F(F<`%o 8`o"o_o -AFFFVO,<,Bol*B@(Fj}([hh] hpGFF$ FmF04,O4 F2F9Fh5]((h5uBF5nF F@ٿ#7 F`FChB!F,;,Bo+`0j9,;# F `$0R?B,;#`#h`jj2B,;` pG7 F F,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh5FPhh5BP FjopFFF F53FF!F(Fp@ChFZl hj3#FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`opq(T?,;,BlB3`j#s F`opS(T?,;,BlB3`j8F#FF#`FlO2k"F(F8@o88FF!.F%`F8#F`"FF@#F`="FF@׿#F`^"FF@ȿ#F`n"FF@#F`}"FF@F##`"FF@ F!F@hF]# ` F|0#h#@F F #h+oFuh@JFP 0h;@Bi0;j,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpG hR?,;,B]j0 p FFF)JFR?B! رKF``a 3`B`` phBhBhooo 0)LFT?BohBhB i`0ho8F)JFRhBohB hB $#S```D` F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Fcl F! Fcl F! F FFi+#lkS``c dcl`hi FfGF((F8o-EFFO U4OT<BPF#hB FF8ahH6Fk4F<熀hFj;{)! FD#j[h[kC Fq! F;i{hRkj[hkC Fb ! F'cl#Scds FF(UClH" (?F"F(FM6.ho2l);#aR2+3(Fsiӹi3l _KFh(F"kl #kd #(FG(phj+(FGoopo-EFFF'ozT4P.膀3膀8膀08h FF(h 80FF!F[hHh6h,<,3BH0cl "*")Fch H6lKH6Hk5j=膀GφL膀_膀7F FqhF2!HF H60(F#F"O1 Foh膀-EFFFFF5RFU4O<<<Bѽ`h RF1F5#H9F Fk1F5;FBF1F F-AFHFF6H6IF-1F FA(F I5(3F:F)F FAy膀膀熀-AFFI5&$ Fn[h(F5)FF@F5 F%4,F)F@F5熀HJKHO=FBh)hH6$TH6H6 "h D5 I H64膀@膀醀GφQ醀-E#H$Kk"HfVF!O BphXFX[hhH65HKD6;Fh,<,3B-H#hB IH6ah H65j1醀@膀%醀m醀Gφ醀Q醀醀8 H J K H L%DB8bhHT6w醀@H膀@醀sFFF F1F*;pbO DP< +`pooJF"ۿ"]]7FF F)F*(O3#`0,7F$ F0)F4B]o0 FFF)FF F!F2=C oJoF2c8 F)OF)[F*")M pGFF F!F*kC(oo<pF6F F!F2*FX@"Cs+`k`. Fp0%FO55F F!F2 0F*@p pG x/+0B*O08 FFH*F!F8@!@пO0FF F!F*"8 F` FF)-``pFah).``pFF Fah)FF F!F2F*F*-EFFFFO3`(FFFPFF)FJ 3F2#տ]! IF FIй FI{  FIq( FIk8 0C 0 FI^( FIX( F IR( F IL(醀醀醀醀 ꆀ ꆀ5ꆀCꆀQꆀ0 FFF*@ FF F!F*sFFFF4#"F1FC(FpsF FFFP#$`1F(F#po 8FH F("F)F8@ٽ F8_ꆀFH(!F@ _ꆀp IFF((F IF`%N FV4q(Fp5 - gꆀpꆀ 兀pF FF FF8F* F *F!F8F)Fo+3`o FF+ FX# FPo*"KOppG PFKh0#Fi+FxG0 F #!nG00 2[BrF 2H(Fp߆pGpGpG pGL h `𜈀KhpG윈NF3h3KjhB5hݹHOO9`#kB<F;`@ g0` :h IH5*jK5h`(F)F*F5F8`(𜈀蜈M놀윈, X놀%&'F ggP0$&g(Ue080F F0ñ JhD0U0 FC0r 8 FmG(o 윈8F*Fkn(FGFKh#ohH5(FL(F F8|놀-AF!FFFFP B+I3F+H5 F)I F)O50 6CDB` FFP Fi FI5F(F B FVIBF9F0CD0 CDB FF( F: FI 놀놀놀놀-MF!FFF=FP BE CFAIBH5$O5(F2/ iݸF0CECF+F#F0F@"Ci2FFx[FG ZD   ^D]D3&Q. 0 BO|p 8 F!FA? F #mG0 !Aq !&!aq&! H>F-I H5BH0 F 놀߆놀 솀5 FMkh^hpp>pB:" K-`m``co"oS``n'ggg FGso F4Fp#p NJ0`H F`F8 I4 FI1h (`@ @Bp2솀w-MFcF(F Fp2F!F(Fo솀pFM+h#` V$ pυpFM+h#` V$ pυNH(4hp<pBjFj'j#F:F)FH5$o톀톀KhpGIF hppB pGjBop8-AFO( *IF*H5kO4 F$+m!l$J5)"F#HF(!H$к$#YF#(FBF;FmFH##$#YF#(FBF;FxF( H(F>F(H8 톀톀톀 -AFjL,baaaY )F $AC,L"#+I## (NWCsBs($N( #h7hFq2Br2C3hO)F# .2[B2"##"AFIFH4O0 톀7FjC+ MKhL# "### Kx" Kp 0IFH4X 톀FjC+   2SC `#K` #"#!F pkIFH4 O0 톀-AF hjF(F((PAT*K+J|0@ tEu ErEr O##K"Fh +FU(0'FFJ0JE Eu@ BA Kh0F!Dc IFH4O0o 톀L hP##`-M+FFFFo(F"4-cx*ph7h4GFx*Ѱh4x+ѠkmFoF(o8FPId3(P#b<#dt0cd#XFlCi#dиCIh3F(F0i4d8FIFH4O0 톀Fj(ѽ@M'IFH4O0 톀mFl!N0h7hF@IH4O4 F ("9FhF #iZBZB@G0!AFAa F!iF6F(FH4D AF"e"BFbo>I(h3F8#bhh4x.Ѩh4x+1K e1Ke1K#f1Kcf1Kf0#0-I(h3(+'bhh4Fx+Ѩh4x+83F!J!I4 RH4O0I(h3(*hIH4 ####I(h3x('eԡIJJ-KIjE k 0pGFj*$kBtӃkhDm Fo8Fj*$kBtӀkh(DV F8o+sFFo(Fp#bIh3F#bph48cx+Ѱh4/cx+K#fKeKe0e0o醀QMM#MFFFFnF(F3LFI3 FF F-o F(F(:F1F Fo  @FhhhkiGchD@  pG7F F2 o hB BhDB *``h`0F2 FHFh,<,3B(FclմB FCh`Dj,F(F[hh&B *F;` F hF8`o s FFF6 FXF!F](3F*F!FppF##`FFL8#F1F(Fp@"phFk F\hF 5`)F FG(8FKIFJl(`F F8@ۿ憀phFk3h Fp@GhpFi F;hFki `)F FG( F h #` F,D`o @hhFk[i۹#I#(F ( FoF Fo%@Gp" FF Il$h``O2IlxC(`o FpFlF+ F@׿ -EFF_OMOrOzvOZxR0Z_R>ORIH3 _O M_x8F$2.п_OqxFRF7 W-EK)M''FFFOzv@J/D@F2;xZ_ > I H39 H36_OrxR".FWF 08 M KF)FxZ_+ yZ__xOzpR2J8FW-EF.MGh.Kh/FzZ__Eox0FBF9F F;F(ѿ_z$_Hbkz9FR FBFp0FЃ@F2_ObkzOzpR2_HbkzR( &9F F_OrxR.иH3WFg8FF(F `JIlC``(F'` 8憀-MFz6+ hi<{/uHoxqH?oHAF FF(ѿ_jKF R_ R_ R_0R_HB' 0RAF F(FVH3%AF F_Or06R-;(oЃm ՛0Z_ ;_0RIտ_"0R/=HH!1F-MF& ihpB FF:  !`1# C! Cz x1{ 3F;FZZC #; C7! C&A" )hU#p{,X'OFL iBo2<]8Ahpq? @P.B2cDB0;+][[[[ #"OC h!@ @A0 0C'CF ـO p1 F  *   AaA@2F F (FSEzh1i*SCbi  FA&(cB^h1 &XAFXC A !vi*hQ\h^DT!B@"!"[" F$"%p1"&2"(+h"[L# i   Fl (D D E#p3 ;B?Ѯ " #  #" #F ci@ <#`DkiH3DBF!XFXFji)j6qi(XF!hFF@Dji)jXD <%O  @A2jDAD2@  1"  Iot-MF<5FF@Du+YиV#p!h@iC!0-KF(H@=tA   +D\JCF|3tFAu3u3/&u0/0 ZF F;Fd۲/;h:F F[FR|<?#<5Po BF FJO2Z`OD0DV0p  "B\C"C<\RAXBXA00p  "B\C"C<\RA(  @ @0ppх"1F F01G"y9F F01G01" F9G`1[" F019G"O1 F01G-!9؀-%`+-0*ʿ!!v"+v"%@+-41\, F01"p!G F01"O1G F@_41+\@,޹ , F@(P)-AF F%FCiO)F01FGs~Kс"O1 F01G-zK-41+@\A,`1-&ؐ-(х"1F F01G1" F01Gy"9F F01G"01 F9G`1Z" F019G+v"-K=#ս-гؐ- -`---Чp---41\,M F01"p!G F01"O1G FA F01"!G F01A"O1G F01"0!G"O1 F01Gk , FAh!pF FFyS D0F1GB p1Go-M FF4$FDDCOt$`ZC:F# FCF(J;DFB.E F MN[0+O3F #EFAFZF FD#D 5ZF*"# F }` # FF(o #2FAF Fd(-MF FFؤܴTԄ4i3 #RF1F FCFo$VDB)F F5(4D#ZF)F F*F($]DB)F F(4D8#)F F(-MF FFؤܴdTn4 3F)F Fx !@F4G#RF9F FF o0F$B)F F(4D*F9F5@FG#ZF)F FF($]DB)F F(4D>WD-MF44t4F FF09FF/ 09F(D/Fi/%B#0UBA# Fi|p !0F4G#:F Fo oBتE!@F!XF|5;DDD5BF0FG+BتE\R3T FFFFBi#(F/Fo F/Fi(F (-M0F FFF4ش4Tm$B"# Fip !8F4G#ZF1F F oBF1F58FG=^DDS/5TpX1FF1F$1 FG FO1 F$1G$11F FG1F FO1F$1 FG(Fp1FFX1 FGF(-EiFF2hjF*FhsiDB򝀫BEwh1  @" A A  "(B \GBOrGl"DBs`tQ F  (E\GC)Fl)F F$1GhQ F  (XGEXCPO1 F$1Go(F1 FBO31h3FiZ1!F3h F+ 5,5GFO1 F$1G-h3ao-E!FF8F "F  `! 1 I## ##d12[FFO O3F*F FciF[Fd1Fպ@F O F `i@tHhCBA h(؈iH(FF(F{ F(F5Lo-MF FFFg!AF8F`RY$ZF!PF%BF!8Fy&! s,D4D F,F4F-MF FO44F4ԴD$TD4in@F!0F4G#QF F3F o$B)F F%(4D!0F4G#)F FF(*FuQF0FG$DFB)F F(4DJ4 030 ;D4PF#FF/0E;D8F0[F)F F(З-MF`1d ## FFtF1FF/F 01FXD/C 4j3CFsCFO32F!(F8GRFAF# FFo 0%YF5RD(FG4D4DE ZF#!]!y]#7"000LQFG01kX2Y"S#h24KT1Ciod1CCd1 pG悀Ci!`1C`1d1*C3CCd1 pGp1F+[ѐ1+WА0+SOcP@. CaC;+,1"%(#aO3m 5C@#a0+Or!"1pOsOsOsO s H*[Oc#Ob+!+#(#<# Fp@H1+d1CCd1 pGF51+!ݔ)є0Or+ є0!+cia# +!++Ѥ#1H*#18F F+4ظ"I(F1C:29"B"K!!<;"B"!!=">B"##@"?2C#OzrSC+a 8oʅ@BHpGʅL5*z Ѕ*Ё*Kɲ_1ppG0"SC|3JhD10"SC30"SC3L5Zz#2@JhPm@pGLerh**1*4𽱳# !%_'LCSq_!h1`11zCAC#C3C_"h1_@#h!Y4#"%# !"#!"#4!瀞Lesh++$o0KhL_pFusUI_'Op' pBO'pOsh+:+ M+h3_ pSp+h3_p pSq +hq3_q q rSr!F,hT'@_'r9' r\s' Ls4D#<CQBxMKp-M44F4t4Rh F0F!O FD[3D 4N b B;t k/=8F!(F4GRF8O3!(FG (F 1G2F8O3!(FG(F 1G 2D5(FG?DD4P[\?cZFAF(FeG(00300?DD-EFF FFB  (2F3Ft ( ќBkϼјB o O\U U cD3 3cD BDko O\U U dD3 3dD B D4LEB F0F!Or!(Fch++!o@F9O PF#QF@F(рF_B ( FoIu@FO ch++4s4R@̣QO  "k\ S@kTE os!\ J@TH*ToI -E LEh*СB$!FTBXcBGLLe'h eFq_L5AhI DB=x .xk- _'hOnNG_q_'qF'hq_hO Eѵ Fѿ_&hQ_$hQ㹽h?h_N{" DB! " DBhA  DLhDBx+#h#DB$-AUJFxUNXp0 +SH*o2h*Dn_@bo32hm_@_'Od2hOeD|D>H!rE5 H*eo Fp(FF(0FF(FT@չ𵑰FFJiFű)F8F-ꙹ)F0F- Fi@"hFiF FuemGo(@#5!DA G(#HAFF!`G#HAFF!`G-EF XF p(FV"FSF8FLG( 0D0DJz-o hBHhpG1BopG8# rF F_ 8 JBsH#+r)FL(-E$V<1o  $ . A 'A' Ѿ gqF HO0"O1(FOzp'V-A !O1@FFFFhSBrh!h[hkH1(`$ F*FH(pFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA^"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1opFF" FO1F("O1 F( E Fp@"O1pFOS"O1Os"! Fch ib-AiF.hl.{ F(!"m0FjI`+hC+`0FfI "dI"FbI@FB(Fo\KB\KB+hC+`0FYI(WJB VJB UJB TJB  C뀫CbhQhLJB#chZhHKBjF0FGIiP*Cs뀫Ccj + +(Os"! F7cj F ;+"#OCFOBF'(ۥhch FibV F< o #OrchZh$KB+H! F(nH !C F(^)h F"#"LCB!(J  + C `@w[ @x}@YsrMtMq 8FF"O1 FOd# #Oca#aa(F80j %h<+b<# `C`@b```"aca h# `L`h`Kh`L`h i 0"`o Fc khlhih `pGh8cYl `j`bpGCh\lhh_9)KJ[\Q\O!O Fg@2CFh@H`\C@%C_Bhh`C)C ),C F_#"iS`_"iSa"h`h"#iai Fj"F@@S$Sp FF[F?!?(F)D Fi03F*F F8p@6H(=omp -MF-X!F F(pa8F#0`I0OS#cOPc#bOca##aOsbO3`3h|Ic`lF0xH((FvIlFsH iXCXcpIl$FmHmIl0FjHjIl4F(8FfI hC0#FF8F+F^I@Fp"\Ilr`dlO F-&Ork`OXbkZ`i+OBrkaO\bka"F8Fal!blk3h+ o%`(F"AIF& "XF>I&8 "XFOW!(F+hk_C_*hc+hk_C_*hcC F$(F=#` -MFFS'F,8F F]F F:(=#   U U2 8&L0FBа_аOаO аaO а?ЫFH&  !FH&LP0% eL@ILP0%-- (H& y, AL@ahkj GopGpG FCi ```h`Zh`h"thtibt[ica𵋰FxF(F'F9F(FB>:FIl" a:FIl`"Ilbi`IlF`ax(F p$_`aci Kca. # & # aoL W a 憀lhiDh@X\_pG!F@i`i@!o  F!@i$@ihh#D@Ҳ_ZT8 F!F@i "F!hi , 8o  F  * 0, +J@i!V H pFF@i!F@!`i`i!`i"!`i%p@!8 FCiFXi!Q)F(F 88F F!`iRB"!`i{"!`iv"!`iq`i!il"`iFgk)F F`i8@"!Z8FC(FIF(FH& FAFhF=ѺQF F(/K.3FFO``Cl4F``FChF>hB) $` ( FFFPFF(и!"f0+гB:F1FlF(PFJO2FFl1I0`0J1Il`/Il.IFl -IFld*IDlDDD HGZF)F0F44Xw|hhĿ-MFFFF0)FQHdokOI$9(:"MI$b:"!F$!(FFEH8`(S2FAFH@I-A<"FIlOIFOzblH3IlWIlRO(FFW` #h` Oht-MhFkF hF)UGF(K8FUF"1F#| XFSzh%hOzrXFZCI+F(h!J$#J#tKFFBt)F,(F ADd F FBs,)F!5 D[ CS Jyh H$0Fo%mKn;OQ sPOzvh,<,3B p FjF@ FC|3ah H$j,J>K)Fa#iK/sF=K:F#F]o!8F F`#a<#cCI`k43 Dc`B``88<#%LDch%a!"h`"Z`J``a#k jG 8Ho  @<"K3" apG<"K3YapGKXhpGHpG-E Fo Kx xE%xEExEeȹ+GKJy yC#yCCyCc"BH&Mjn`+4! g(ЃhJ`4"Z`az"zB"zBBzaBb`"a`Zaab)jbP1Ybbc+k jG"KZ`Nj+Ј! 5F(K0bz#zC#zCCzCc0b{#{C#{CC{hCc|zK 0#0#003k+j"barJ BL:B%hJ|3+߀O`Ca"ms+R#9aoasasaS`awaS`S`aaaaaS`S``S`kaaS`ga@cJJBҳ?HJB:o|2bD*أs+MV_ek?JB&2B#:Bi+[k8JR CB"p%%a5`e`*_ f###~h|3i+hwj+?e3jqsjoj"BjFFPF?fib3i`i+?NZii[h DVi+?Diih Di+?;[iGi+?5iAi+?/i;ᅀj="PFqi%"KJFJJJ| | }C#|CC|CcJ}E%}EE}Ee@bBwRBt! (?Gh8K`#S`az#zC#zCCzCc`a{#{hC#{CC{Cc,I(,HB,HB +K %D+zlziC#iK#K`#` k+?fjf#! (?hJ`"Z`"`"`Jk+?MjM! (?hK`#S`az#zC#zCCzCc`#`2oKFXx!cYppGO0pG(<"K3"ZppGA;0Lab"baO0"KYbbpGO0pGK``pGO0pG8," F!F""p,#!"qaqAq$"cpppcrrr#%scsC-q"rss8<#pCC LFHk43hDBpXhB#S``#`C`(F-hFF<"SC LRk43h#DB i,#ah`h F h <"K3"ZpZ` FF FDxxB"xBBxBb*BzzD$zDDzDd4BA{{B"{BB{Bb" FooJ" Ka4X`ZccpGpG0hFi,%TBTA ST/) : B0%$15j0 :pF&hj@ B @xxR" [3fTph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)TF%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`oTd퇀L#hBH##`T퇀FOr!H!F@"H!ϸQF  pGpGFh(o(F*M*N(ps F(m(rsh0F#H!8 F((t0tt!@ F( FJo t"!K)F+`@#+#vK F`F(G`I 8F3s#ss;h[i+!8FG퇀퇀Qnio^pGKxpGP"KppGP"KppGPK`F0F FIH" FT퇀R yH;T퇀U "Fe epGUpGT0#T0pGpFi(KpK!h r4FKF`K``KbKCbKbKbKcKC`KCc#Cf0F+F FL(Fpo  Ćut!s1s7s퇀sBiyi xuyF&_(OV`(Jx* x!+ .4F( $I"F(h_#FOSBԿ&&k`{"fAsxh)FhiG#+b hiKmS"@+F:FG F}ՅKiUK`X8 FMiU+nbj!hp#e #e8p F+mFl+&4l(Fp@;B`(m+F"{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClk0F<0 hkjGo%pGFJ[ xppG`F0 hkh]$`6F F!FGpo%-M0yF:hF8j,B+єh,<,BR;hCh,<,BTiF F`+H A+Kx+o Fqh'H 40FF#H5j,> H "1F~ JFH#Cq"K5pHcl F Cy FUjcl FCy FHj`oxpFF(FiFi(F,Y 0 i F#`p@Ob Ff a,Yp#` Kx 1 pGF-Ao)Ekk^lhq<.@x= bE yB"o Ӕo.& @ V`"` .>3O>rE" 2CT"|[@ V@*B"XB=@BHOR,BBBB bdYdT>>3O>rE?r" 2C:T"|[@ V@*B"Xj{:B"R" B= * *A"€€>@Do Bk<!spGopG#0k ZX"BZZ̀0ڈBUڀڀp1pG pG9!d#e( ޱ{{˹KJF2FPFI  `#aN@##K`O K :" Ju`jhk``"a`z?ކpQHF,p"@/d?C??  "0<B bш @Ӏ##cd#b#LU0lB 8+@ok F(9K-M&NCԡx1DL@vZDBF $(<F% E]jB%E],Т{bh±! FX#qajB!BZ{eAsbjchB"!F@F# {\2+L@B( io ktC#kU0 p!F눛#`C눛C!Fo,!F#T0>0+k#0CpFop) h: kkBHc$Lbor b<@9@>@8@Tlm(Lebb,`U0lB ao<ok&F Ko?Ku?s???B ؔ?#?#h[i! FG е(;U 8 lB:ѐ/**o*m(ebb"`"AsO,~ p,Jh*$OODl/kp?+k/o#-Eԁq0{>zF= O %}?}Հ#{?+++JKR#0I@"H e#?O }?+\h # F O @dRsBq=е(:UU(,U$< D[9zpBβ>oJE1FDUsF#2zBՀ"a+x?+i?k{?i!#`h+ FG(!#h*h FG=kiԡz#C00I޲K Fs ՘I ?C ???? ՐI ?C?0 ՋI {?C?ՆI o?-iC?l0HOJF 1#zJ !O@1#/1??@0h-C_h# FmJIFEV1+!& r 2B݀#!1c!/:*@܀#? F$O#  $0)]Е rQ |!! pu &):іH6 !8C !r& *4і/R0!B(F1 Faڀ&0+@40#rv(i8A!!rD r( h*ub{*\Z FhSCaQXBObhZ"hZ/"0Riqi# qi$ q hVs! hZs3|h_( k2C#Lc#(0 0' n@&  #Oc*CShC Ӏhۈ ڈ I#{H@J"! Fm!pB!ۈB#{@K2IHS0+ћ 0 +SCS #{ ! %!-EFFjTj F&0sO +h%ثh.Lڈr:O "hI 'n # Cf#%0hAhJ``C``kG#h% hB>"1汨i( hG#a#+bk{ #kb"#hZa&0+%//Zrhi) hGnak{+#+b#}+%ih F]`+`#`#a,hB ?+f+]G.0k:F(F+I 0 O X*  0VED FF!FHSF &P+:F)@E&pњEKZ# PF+K)FhHO0t"񇀫""K0 0 xKOsjF! _]OsjF! էFFF F@ӿF FI FRFRF0( F!FӾH[0 @FIF# J @h 0 "T1( F T7 FF(-B(F0 F!F-#xbxCxCxC#yCcyC8  0 FFPI*F9 FK0o"8FF)FHD F8"8 FF(*F8@! F8uXx1( Y(РTXBXAO0 HCXBXAF FFH [ " T( T FF cH#DdB IHX B BB ^#[B#BbIBHu][pFF"T1F J5BH!o)p$1F#F J HIF8 0 FC 0HoE#M#$ OF"F!F HPB:F1F F(` F 񇀙R0HRE#-MDFFFx$+jCx{+-6%E#+F,FP)F0F.K]FPh;B"!FPF%K-6#J$0 F+76DCE4C{8FI:78Fh I8D#3F J K4F`$=emƆ`#[#c݆)  pGF8IK[HDB AhB0p%O4)F FKF8$toS@"P0qh@B1h HhGF8 HzSP0Fp*6Ѵ?,F5b#+ SF@hH\h1HWo F"P0`h@B HGF FHBH>####+'o&9F oFX_JF( "R FkiGF@khP CP0khP CP0R07+oo[-M}FFF # *F-IhF iF(FF(D23FXF kYFF{h(F`hrFPF]0``QFhc0FO0F`H1F FwF`hMe`o FoHo##-MFFF(NO ,!(F F`(Fȳ0F o (F)F:! FF F FFر)FBFXFGF F F(ZF)F $ Fu.5F%0Fʱ# IFX{(F[ F0oop@ x0,LxX,1 N D F%x1u]@DЙB F`pF `pG FHI"IHS" FIN  #8FgXM!x(FT@8!xH ~;$8FO( Max(F;@8axH ~o$8F(FKS C80م#0J F,"` 0 F( F`7F%#!F QBТB"x0*bxX*-x:*O0*5- 0-A%XF0hOPP+HjP8`8h@1FH@1F((p`h$#-MF FFZK/h,F.h3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FHf h9FHZ8FO KYF(FFH"FO!FXF(?|hw9FHQ~$A$%0%H%F `pG J KF &LB8FT66HH FHI"IH" FIz uăăe%#J FH,"`  Fy( F(BhOhFOr!hF;hN+H#0`;`#0h`8jF)FH8AjF)Fz(hFD(hFp(Ch`l&e%HpG L#h I KF#`X#hx:+K#`"hxDp hp&&#-E=F4%?F@FFй#9F0F$U F`;FRF1FH9$ F =5O2#=#AF"#H0SF2FIH&&&#-A=}F~2Fw F!I'?z O)F F V Fh`+F2F!FH!FoO29F H(3F"F I HObAF8F =2&&&O0pGO0pG pGO0pGpGo pGFHhBDlDBFFO0pGO0pGO0pGO0pGO0pGO0pGKhpGtKh@ht#-AFJK'L<#h B#z[h IG8 K"h` K`?DO0xt𩈀FJFhO=`Mh I8hGXF K*h` K` FI4,DO4xt𩈀L haCjG##`tKFhTi FGF FtKFhDCi FGF Ft8KFh F3)Fi FGF F8t-EF KFh FF ggRFCF)Fi FGF Ft-MFKFh F!F SF(FG #BBE)FHO4z Ft'7KFh$j(FGFc- FKmB`0Kh`KhC`t𩈀F Khk FGF9, KdB`tFpKhCk FG@tFXKh@B!FQ;+H6(FF((F2F9F H F + H7#H&7F$'R'5'E'KFh8k FGF FtKFh(k FGF Ftp KFhF1Fl(FG2F)FHO4 Fptk'*7FhXh-F$ F0iFh(HO4-MF+FO4 F*!hhhF lHn$h  hFBx+Ѹи'FF!]H`!FFZHFXHOF!FhiF!FiF"F'F:F JKhx iPFGF EA ZF1FiPF#GF+QF5H c/Br9F0FxB*Hohh6иh5*i 3FZ # HϱHK 9F   Ozs JH4H11FH H I FJ g'D-4't''(((`GφH†Q8F+F* !h`h`- hHc8 8O0 iFF F@] -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF *F1FF@F#tfFPF.F#H ͱH)F*Ozs J1 Hu Hr%FO4+(((`GφpF+F"hhhWF Kh.Ahh FpHO4$tT*F hXh1Hh8 O0 *FhXh8h hH O0H(*F hXhP!ih8 O0 pH&$ M> H H p+hC, :!,!jhHJ4D5q(zGφt*FFF@ 1FfFر#F F"#SF((F F#BBѨU=`o oHpGJhrBЈBpGd-A%F `F OqjF88F`@ Fo (F@#8Fq;( 4`(qhw FtodF8hh F@c#7Fx MjF)hq3F )hq F0dE RO0 KFh(h0" O0d "!ƺFh F@-M'F h! K[li h i  D@ [BBOAccC /+ sO0 [BBr;B22*;@+6%O F "O3% B3[FRF(#` Z`l 9F9FF e ZB8>F*/ BB O*8FZ)BF DA2DCD3 C #F>F9FG[FRF(?@ FF#D3 [FRF(?("!BFO4#-M^O `F9hF#hq(F@ B!hBoh&(o 9hq F.O O !Or@FU!hB #0н(0+cН*!(QO !*[F2lAFDh ,h (н00pCO,г O+УBSBSA$+a!FH*!F$$l!F1( D1 4zD1# #ooosd0F Hhh HhP EE0O0d`-E FFFF(QF HRO0X2F F+F(phFFF+ChBуhB F)F@ _F `@*F!0FK F pf`` 炊jpGFhXpG`X1pGF@*@pGF@)OhjFpGF@)O@hSjFpGF@)OhjFpG8F FDCB08-MFFFFF@li ?#?@3  ( & CC'K@h Fб+F;`cCvE>hAH#HH7F < ?&?"!F3FZFQF3F"!Fhl"SF!F"!F3FZFQF0Fl(((FL($hi 4@ ,  @\IJB#CT C#:D xB C p@BXCBDZ#@۲O0dFL($hi 4@ , @\B#TC#:D xBC p@BXCBDZ#@۲dKhjF(O ;D# x CO0 ppGD#@BXBB:@۲dKhjF(O;D# xBC ppGD#@BXBB:@۲dsFAjFKnЃj"h1OpU" ")FF * : FFp-MKh hOAFhOAFh|.(𱀣+ƀ#k3#cQF k6FoEiB𚀣j!Fw8F:(@𪀻o 5%c3E?O3#c  iByңj!FU(F((FFjhS'hjR'  * -jS'QF#O xF*мo3@O B phzC#c3@*ѪC!;@* `jhX!;A5*D`X! i3Fh(AF0F({0Fa^O0y!F)?n  DQFFe{8FFjZFS%(h # jYX*F kF%k-|0B i3Fh(AF0F`(P@*C;@* #`jhX:C5)D`X0F kdp-MKhjOAFh,OAFh&F/(cj[n@0++k0c(jFU!F(FFУh2F + k1FhS(kBFS(kF(0CE i;F h(̀8Fih(@ŀ@*C;ꁡ@) bji;a8FP0FMk(2BCO3ciE𓀢j@* UC+!F(F Уh+  2Fk1FhS*kS*E>K"[FFЃhFBx^FO @ Z 3c@03@0@*C;끢@* k@*jC;@* kbji!;a i;FhCh%08F(?S8F0FO0PO    FO FHdl-M F$  B<F,OAhF(<ѪHFF,-F3wѣH&0FRF,F3@HhCD`GёHM|E<FpъHpO(F8i+F!hpCF!(FhO h  ӻh*FseApH=DFOE*  TEOF%FOAh<F((i3F!xChG ^I^Hr!0Fhe#0hӣFh2F(eJzBFJHMOAhF(?E!F#p(iSFxCh(!PFh(#h ӫhRFPFr3\F7C(H\F J#3BO &FOAhF(? O hpF3H8F6OAhF(G+0# 0h0FFZFQCSDD@#F(Шi p 0 9FF(AF FjF0FlFQFQFD0Fn FOC2i 0"9F 8 K FFhs@Bd-ML#hFiF FGCli;j^Ն #h$O i(7 3@;FO 23 B.O2F2B XE*! 1Ih"F@F@pFwxBhEF!D@F }H@FoE ڭh@F(D2  W*$ &F, SEJOA F(aHO0O2^K`^K`m]N3hE%F"F!`FعWHTN3hB^#O203`OKOA F`LH4`m@3` J0 S*b 2RE 򸀪 OA FHhB+h 2C"@Yhh8F DZ`hiQ"aV(?u5SD D@F@F@F  0DBTDlD @@Fjqq@FdAFFa8F hSD)Dd+++++(-MF.KhRhiF 3"OAhF&B F4O;XF"1F(/i#F!xCh(O  #T @FFyB @F1@T  FhDREH=6d,-MFOA0=( F!FFI9&F FOA0 FX$&FO7 |I!6F F!FFPFOAF(qIPF FnHOA0F0`$hH{ FeI FwF/7OA pF(OA F(YK"h FxZ"!F(FUO#O3 FFA[/$6'=8F6OA0FH (q8F)9FF F' :IF:Hxnʱ!" F!FF(`EF FV((FqhOB0["HV(?7V(@FAFFPF>OV(0F F(F8F$F Eo  id0,>,-MO@Kh iRh 3"E"AFO78FOAFhF(S8i#F!hChHO7 Fz{%.FF+٢YBWyFB!1عY/H F(Ѻк0D0 F(hDBٲHo dDQ,,L hH"#J#``O2K`L hH#J#``O2 K` L hH# J#``O2 K`\X|TPxLHt8 M L(h8!h)q%#+` h##`8@`d-M{`0FF`+@h(@ C*kq Э   SF(F(@OA F(8*h`i 3+#;`6лh{hAFXFD;h` zh`h` 7F+#+##(h F_ #0o Oг OгO FK лDhBO #"#(F2FSFPEv*tAFHtl&g,-M FFz`;`# #0F4B1F(F(FF;/+лO /!0FF0FF 3/*5+ !F(F,{h` VF1F(F  7Fh+<>J h3+`!F@F0+=0OAF(=&!F@F.3x/+(F!F*Khu)F0F uF0F!F(FК0+hzh`h:h`( ;*,0+"#@FA(2C0FR@d7F#% K` 0(,(  ,(@#N F1h O;`q#03 h0<` h"c(1h FqGO0d`p9OAFO`RF(5wN`NSs"B'l#` #!n!1!qH#X0`#nմ0!#r F|Ax!4`p F#3` d,p FFKEd"h`Kh`chECli  @% CC@EphlFF FFgI+F"F h@lhpFElO`iObi#Fp@BؿOcBjF!O`'i=B&i5B(Ӡh#jiCCj#J`J`)F FfF(F!F0FuhjR% a)F FN!FnhkR% q8ChiMUKB@F(FpOA b(FQFbȱ!j%ihiJChC![Fj-bO08(H!o ,p OAFh$F5KjFh!"hFFF i+F!hpC%#ah*F(F%`j(bjO`n!#fbjOc `jjebk{j#b@0c#c pP%yjC%`5ijBo#b.FP%fkC%`5ikB\#c%.FdaN3hFi# 2@Bl`iOA@aO``b(ȱF3hZiXhjhao##a0IHjNO51iOAsb(.FiB&&iB1OAcc(&iB:&iBE&7FiBU`j*#BB:F`j&(FOAhj?G&jS&0+61F F!Fj'i!xCS&0h<(6OAhkG&kS&0+61F F!Fk'i!xCS&0h(61F F!F6Do d,-M>M} +h F #?FOrF!  ++OA .L `(SP,HO3 }$0n!1q!#HYn1{ H" 0FPF3%!h#hjTHv pF3OA {@F%,FdD-"-Q--+hjj9OAFhS(2F(hA(h(F F3X0 XpC O<-# 07ԑKhjOAFhF(@ȀHKhj OAFh (@ H~KhjOAFh(@wHwOB@قFFF F!FFF:PFF)F)FDPFhhOAF( i+F!xCh(V9F(FF(Oh 9F(F(DѣkBFS(@*OC3󁢊@* bji3ah!F0Ft'i!xCh!F0FgFcp8F(.HG(FO4XB1F@FhFoFj2FS&@F1F(F @*dC3@* jjh3`0B)FF(i;F!h(0AF8F`8Fd---+OAhF(?O-(i!pChhP @FoFF1F(FFj2F@FS& 0@*, C3 0@* ,0jjh3`0B)FPFF(i!xCh09F`2/( ToFF1F(FRFj2FS&Z <@*C3@* jjh3`zKhB8F)FGF(i!xChh(9FC(nK``..*OAh9F (?@.(i!pChC #E.8FoFFj2FS&8F1F(F@*8C3@* jjh3`0Bz)FF(i!xCh(l9F(f`c0+OAPFF(X/i3F!xChO hX0F^X8FhFoFj2FS&8Fr1F(F{@*C3@* jjh3`KhBx)FzF!h(i!xCh(9Fr(^& 0F{򇀀V*0+F*o BjFQ"(F@*C3@* jjh3`kKhB)FF(i!xCh>(9F(_K`  S\K`3 ">lhFoEj*FS%0F)F F@*C3@* bjh3`;hB!FF i!pCh(41Fx=`3(Feb#4000@0<0,F +<+FOvF5$0hB H%?o  O AF?OA F(?C` +J (0#S򇀪-HO#)F:F Fc f0:hOASC[ a>F(O0F;h>jLFXFYF/Fj0FF : 0F 0pCAF+F #(F(N!F  (F:(@Cli;hi 3 CE(CFhXD FO3 B*3  @C' A 3stH FrLR hO(FL##` " F+  5J Z(EјF D D hD 3CF  @C' A JCD GF3  @C' A dO89KhjZFXFYF=F8@FjF F D@F B >! (F[!+FpC &1F(F(Q 1F(F<(C&6 F4`0`@`<`(F`%RFlJh;`d-DpCV HO0p#*F8H"##V- .p FF6)FF# Fp@{$F OWkqhK ЫhO|2h 4d,pM$.FV;Zh2N$7FW;Zh2$V 4U d,# J` J`" K`h4d,h4d,p-MF&F\O"j3B  ;hOA[#0h%6`;h[#0hh)FhhD;hZ[#0:`o -EF FF>IHoJd#FRIhHСB;+MOA+hhX#+hX#0hXh1Fh+hZX#0*`\` o ).-EFFF=IHoLP#hX#03OAh#hX#0hXh)F+#h ZX#0"`_`o ).pFbF%H@gOA vFH'`G`OAhj `)FhJh+K Ih ```T``E.Y.򇀜8 M,hD(hX" K(``K`8 hdhDh Fp KhO0phhBh"B[hX6B2 -MOAFhOAFhFE(F0F"(&K!h"r'i+F!xChO thB  XF30;h "E'i3F!hxCh2Fըd( HHs..-MFpCjF_ng@OAhFHOAh}F8(Fo "dK!he:F9F9F'i+FxChwcjnY1ոXHCiKO Fkjoi\Cskb;"F!h0F i3FGC!h8FLqhihWѓB8@F*Osai3a`jGbj!nO`CfbjOc(`j7"Fh*F(F0F ~D #aE@h2X FSO ѓB32aѺXFO vo ѓBѸ0F/3gB?e~O03d.-E#MJMO`MJF`MJOd`">FKL,#`KK`OA G O0OA ~(!W<`O3W,S` `Z+S`Ѩh_AOA`F(#hOAhV#U#hV#0h+;FAFh@F]Obij#hhV#09Fh#h8FZV#0"` ( 8 @B#hOAV#p8`#hV#0h(Obij#hZ"`"V#0Z`p-MȰCjFmXYsOtN!8h1h"K3`lOAFhF!8h("(FW/i#F!xChOs_KOAihF FSd$XMU+1hRhK2Y1h"K3`/FOAFhF(ZLHHO "EK S+Rh2Os`"XFK`d  7K8S(0"[h `OcK`h:Fm F8F"3`0U,qhW<ёK!h(."(F7i#F!xCh@OsKOAihF F "h:F# F8Fd;9.LDx B\B;0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB F$pF JFh FX Jh1 LJ$h&DB HO0p*F-($({F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5H8 +ч FZGCF+hS$+h3)KB# FYCF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGGCGF.-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(F5 DdB F*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(FF-MAKFhF+O5(Fi@ ?1!?yF(F! (O50F@"1F F+Дb}**"{zA!r`oJ Bє  2 Ѵbj*`||M @ =@Ѽ bjJ @8`"AF@ :#}|PDR""jYF@s$B  $-E F FnF(o8F`h=J (`bsShb 60`304C#b+Н00.h b,0+PhE%-0B)F%H$H?O2H (OC $Ѩ acbO3a#O?1@ !? `(4`cjs``cj`#sa )F @v b @D#a./2/-M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`o({hFO0 FDBF&*FFF0FWPEѸ0DCCDF !?#?F3F ?(?@F,"F)F@FwBF!0F0(FFF8hhŊTiiCrDh , kCi!Dy Ho8jdB(,FicC)D\/8iF "!(F#+pi# F8@ɿ 8`CaK>@ p`E PaS`F`F#a#b F "IF (F8(O0+\.+oOT)F0F0FOqe F,!F(|/-AFF%NO., ,!F Hx# Ԥa+@5B(F_$ -EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(Fr"8(DB5`x +.+) i-MChF+FFS + +\н#@FYCF FiBOh B(F8 0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FDDCDF焊@FzDCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FAt!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch +1+@4OsEOs[EYF Fch +OS SC-F:FO KMLN 2B ahr8 )0Op@|)`FE-QF FchF +!Or@q+ FREٺ@P ++OsOcSE@EFG(F*F3F )KOp@u)(FE  [b2 FFHBA3QF F BF*ch +Or@q+ FZEٻ ++OsOc[E@FEHJK 2B Aƀ  a c B x8 8, cCsЦO;h+ኢi#VOs @B u;e-@Ȁ0F@ #DYC:F83B`E^DecD5CwM*h㊘BK2F9F(h*h㊘B>D QhhB ` Q` CBubh *Os@q* FE &5F;O1@ 98`(UMHO0  cBs F.⊐B:F0D~ 6⊐BcVDD+7+K9Fh\(KhCB eDDEsAOCFK~QF FCbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOu礭/cu1%)F F(5ch ++ ]-:㊦if 3DcKhB+aH QF Fbh *Os@q* FB?QF F)FFQF FEFRK&iFFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@s䨭/i?3#?@3 N ?x"0`$?H"F! (#O53`(FF"IpF(" I6("IR|($/ᆀᆀiFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1F<(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F[#z.#>F;"0F#{!0FF#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAF92FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0Ff8o EF;/+\+ci *$I0F/ȹ#hZj"[jc`#3#a+x+* I+x+o F(<&XE8XF<FF0FP<1SEBFQF0F(iz!F FXQd݆pF Fv F@(F< ix p<1B1F(F(-MFO F }Q 2OC[PB_&lF5FO "! Fw#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "iKi= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFF F)o F  " !(F.! F##x .+$A"(F0F +"_#0;I+FRF'!F(f!F}(ROBF A"@F!F+# ݸ 2$I EFF 0 +ZDI+F8Fyhm(8FX|+F I F L0 ")F0Fj$//ΆON-MAhF:F(o0FFziox *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(F>FZFPF F(BF(Fjh *JAF(F(F0##aO[;a*Or *@r F(ЅL#h3HB$ FhFH7#hHYh2 hC F H  "H@$//؆/ 00IF@ ;FiF0)F" F$F F@ 0o@FF@ IFxiF 8o(F F "9F(FF|iF(F("9F(FF"##hii0o @-MTFI@ FF(K(@A"AF(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?F_FXO3!F(FgKgH * *OrObBUBFF!F(0XHXFh  j XF1J1U!FD(F ++OsOcBҢFEv+F!F2[H2/KQFTCE[F!Fб)H(~ ++OsOcBr CFK2 Br2 [DQFh(FQ + +OsOcBE FKo*o )@%080#"#]FF@ I]F!Jwu8FqJ)F"8F>F8 F4`(Foo pFp FO(6Or!0FC+1zaىP1dيH1!X@@! z !#`i`#.`poFg F@bpG0F LFh0(F0 I0t F0O0-MFܰ @ !FXF0"Ff Fh(Ҁ ,"FAFV 8FF(9F9F_H_o $  FXF\@ VIF(YFt(@( PK` F" ` F FJH/ FF`izwѶ??iЪBAp aB! #˂h*Fd3F80E3H FFUO9F F {o F F( )i "!8F20 +# #B!r#a: "8Fli9F F ~(CH FFTo Qo No Ko Ho Na0@}0000  EE0-MF0"! FirIF@ FnHoo -iF@FMiI(FPhI(fHYo F(@ `K)F` F"qFF)F\H@o F@F(F F)FoizD 8 0"9FXFs@ BIOFo PF--+)F@H]F!F,hŖ#L@ YC?1!?%(O3=FPF=(5%hijhY *(F?9D(FY0#HoajhBѣj"jaaz* F FFs F!(xk%@= F( F(oX@0 iQ0}000-MFڰ0"!0F Fd( "FQFR 8F FP9FF@9FH\$o %F @ IF(1F|F(@jK@`!F"(FhFF!FzH7DF0h(F FXFZ(FF8nH\Fo kic (BF9F(F o dI(bI{(o QF(F'F(Ѻ.i/h "! F@{h +##B!O0 aぢa"AF " F z@ WC?!?#FPo BF9F(F|(ЭF:F "G1 r111 pG0FCK Fk##P IGF 0(Cx+H` օ#FF"Kik@ hki0FGFKB3B ̹0F`i1F(FhGF( FpLi3F0Fji hL`  FFkiù"Kik@ hsi(FGFKB3B, L Fp(FkiF+F(Fri h(` 8 F F F!FXK"Fk!F(F[mGFu F8` -AFF FFh&(FX&F6Br FlKik(F@ hkFGFG,0!ZHi+F(Fri hYFFh!?3!h(FF` 1 pG-E'O(M(NB$kh&+B<0[)h"H["L)h"HV F! FHK`C`K`O30@<FRFIF00sPFGFPPF LD56@126A7ׅ FFFEhhh2FcCoi# h(FGF- F FFFEhhh2FcC/i# h(FGF|- F -AF FF(L,Jki+IF& 9!L F! +F(:FIhi@Fh2FI&#&`0FJL(Fv(`D`(Fa( F(LL$ %2/2FF! J H, H^H#F!JH (HQ72D2 y„p2}2-MF'@xBK.T3PE7I hpF(i(2FF(h3F*F q(FE+Fօ#-AF!F8OHNL F&00FIM@II+h GFw,0FBI@+h GFe,y hGFZ, (F5I (I x+E!F/J j(F WF(F-F(5@FNA"##"##2Fh GF0F+ hG$hG=`u(F LhG(Fe2(օ؅2 -M$F FFF&F;hBZ:IX&tFihy*ey;#[E_2IX&aF(V#.JhFF(J"X&F(AF  # FK0 #kC0  H`(L F=`Z0H 9D" Ig;h5B6Hօօ2 Zօ-AF"F `2` FvJ!tIF(܀F :FmH+h[B(hF$gHz8F+ F @@0+`ј0+b!"F YIuF,n)j#BF+F@+FBF(Y# "#DIGHOF(F(BH++"@I(0`(_2h(hF(0FDF+ј0+D#@F-IG8x+#Di FرFX4O<<<CE"L"HX FS(k F(#IBF h +Fj,?|LL0L. L=sↀօ;Z 3؅j2օHօ2 -E.Kk.KF`#" F*H*I/F0(KB'H{+#!IFHF+ BF9F FhH_IHFHHUL FH&OS VE(FBF9F5F(6` (օ%3F3033-AFHFF B%$+F9FJ0F"F0F I KB 5?HH FPDsↀօ -AIFH FAF XFб1F|#%gS" ICF HF0Fz Fw(FMօ0 𵋰F!JF#IFF0H F IHF(:Fm)F(P:R1D0D;"IHFsↀօ30-M%*F IIF(@ !F(9F# F(F(@Ҁ"oI jL &B@(F^eHB F >FF $]KFBO VE@$T ,Q (! TJSIF(FF+زF FVF"FI8(ѫFSE  @FO F 00B !F#0  -L a@F^,|FFE?v0!wF0F"0IFx@FSFRFI4FK8F(  b   F:X74F6L4HօD sↀօօ-EO FFH AHH;$ FhFFBH-AHFȱ F(CAF=H5F &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBHdxsFFF.*F F3FF<FpF FF$-L F!0F)`F(ЂhB!`1$h1*F CF hB*hQh4-EFFvFF+H"8Fz(KB$! F"1F0a#bh|`5%`c``PEEO1FHj 0F cF ! yP#S`` ``` F H`+j(b#`h'F3S/O '7FO E%(/+"FR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i k1F#*FhFJ!F F?hJׅ-MFFFFF0BQFAF(FFp"9F#(FN!L FF[hXE"0BAF(FF(iB%#S```D`/ѪhB(FiQ)* J```D`FhLFdFThBѲhB Mi#0F1~F9F?hM1FH (F0Fy%{4-MO FF @!FFhF@4! bF0 FM(F#a'OS#`K`eRFQF(FRF`YF(FHF*F0FIFX"F0F IxF @>`M H0F F\ ` ׅׅ4-AF# FFF7.LH8F(C;i+@m FAF F06 FiF@F2FlFCF 0hF}@s !OO2CBR KB Kp0L-0h#@F3`` F FN0hB@q 2[O3B(jCR!l F@FRBhF\?cE hhBh"Fh1x8FF#*F FXFF8-AF(F&ULԱ" FIU5  FFnIx+L Fy"CF!F8FF5W,6>FRZh`8hCLօQ ]pGQK& FF7F@pG𵅰 FF8%T !T|T,;#0F49F5=FRZh F"r-HFQ ]pGQK FFF@pGFFF"F#(FFyF:F1F(FFH"F#!F(F F02KhF F'(+IF0i*k+%I#$IFq)abaPbFhKh\K`n KM`#ae)FjGFE[k"Fo#FGF:PׅH` 0F'(FF8##I(FF!#i++I#F0k{(FkGF) F#!Iׅ#O>KhP]-AFFF##F F&I7F%#i++ M F(FKhBѧ#ji`&!1F "j(#j2FAFhiej` + FQ(F!H##bׅP48OqJ F J KD Jh MBb Jb 2bbc H(F F8 󇀘򇀰 HpG4 pG#"𵑰FIH<Fx !0J 0:F IF$ FF:F! 1FF(F օjsↀ-A FFFF(2hF `9F@F(`@F+hH8F"h2D"`/h1F8F(`8Ft+h+0F"h2D2 "`H FFQa!!F@i`a" FIFkF60 /١A+ء72*# (` shF F hF KB ;B  hH `+`2F!hpH 0$B 0PB` 04-AFFF'/`FO1 Fv!0F!FO2(`g1F@F*h+F(hB/` FL -AF$OM+lB il"0F9Dhkl;DZ||@ ||@@@`4` -AF"!>HX=HX44W (` 81B  F, l!h!H#Ku 6-AFO FF~h #sC JIhBXBa Hjh +pB@+x+"1+R#qrrprrpppppppppprrrrp{rpwr,H(:0(s1+?nR#rrrrrrrrrppppppprrrrp{rpwr~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3siHG6h2#h\ 8F Fy M+x F$" IjK,ph<@{ F8LLh\O@apF FC-@,> Mz)xA F "LI FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@Lh\/@𵅰\(51H;+.P%$&,H.O-*K1,"!Za(J`h*ZhBhBZi*iBhB"b"aaK`"Z`~F([+ 'F(;+,$R+ 0; +U$ 3E$0,E%696#𵅰%O&K&N'J'I'H(K.FF(6#H*F"I!HtF`F!OpJF(H FhM`!FJHFH2"#!(htF(HH؅󇀰 ؅؅lօ9t<6X}sh666-MF FF (HFU$ sh0FGFBpEн0+ #<%0+F H2 + %+н *+*o 3B 0 H%0+F4G(кH6668F$E+h3(F(((Эi4H(iЀ(B(F4i%4i+j[h[hB+H+44F8-MFFFjF1F8F(;:z*O_O.OLO`O+,""p"bp"pBr"#tbt-Bqp r!sassstt!uauuu4 FO"pObpO*q@r #t`t-@rpp !sassstt!uauuu;z+##(0n+ +"(F)*4"(F)0"(Fl")F)0 R(1F RH#6pF F)a h+^FFX FiB.F!.Q(.3##p#cp#p#"pVI #&ucuC6uulH.𒀀.Ѩi(@(F$9#q##p#"cp#ppcqD(F##p #!cp%#F&pp "0F"0F)c#%4< Fpi]B(H((F/##p@h(QCh+##cp#p#pl4<(F##p#cp#p#"pz4<,,<~##p#cp#p#F"pI "+h"u"u#buukh"#vbvBvv4(Fy##pمF`x* ЂxxB"\D+ pG pGx+Cx++Cx++@x+F( F px$+ЃxxC#D( FF-MFFO FF@\E-? FI9H$h9F F1(i*FF(FF}BF,(=F@FBEFDF+`xօpFF"FF8#F1F(Fp@"p8Fx*Zx*pGxxB"DpF,(FF4F Fp*F!F&-E FFF8!HEF)F.F'PF.F   D@DF"FQF*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F3"Ixx.C#*0FIDEF0F/I=-BD0FIby#yIC#yCCyCbD#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (F!S+-)++x+++++|++3+++++++"++"yymIC#cy"y(Fjayyy"yC#B"eI"dI cK cz"za{B"zzBB#{&|C#{BbCC{(FCcVI;b|.*0 ,QIQI0F+|D* R,KIKI0F5Wcy"yHIw$0GI+4' ' ./D0F/3IBDє$ >Izyayy"yfzC#$zB"(F7I&yy"y`y!zdzC#A!B"/Im"(F+I.%*J*O#D0Fz(I5-:FDxx$IG'{D(FJ#9D(FI77X7ƆSw`c7o7778Ѕ777v777777Q8 8vrIsH#y*FqIF!S+ՀU"")0+g+!y`yyy*gA!AAAb(0XI"AFcy"yB"yyBBMIBb(FSA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*Ixx.C#*?0F$IDEF0F/I=-BDxx A!9BFHxx!B":^3F@(FJ~D0Fa!Nn톀8T8868r88ƆSw66pFm2hF/%,&s bB#x+cx+ #phFF2 F mpkxxC#D!F[F}F FpF FF F8F F)F FhF F88F F)F F(F F88F F)F FF F88F F")F FqF F8F FQF FF F4 FsF!FF0"F#eHp80KF˅K)Fhع FI/)F FJb0 I H)F F JW0IH0$Ѕ888-AF$FB!(F%Jh1F(F(F !F(F8##4O"FK1F(F CF!F(F CF!F J(F CFAF8FY!F(F熀8F FF!"Fi"KB+UNc+&(FnF!)jhihD @SB8 F1hBL3` F3h`)F^ H L(F_)F H"F(Hw5ׅ5*-AFF3KHS"PCF9F0FJy HFHFHKJ(F-FCF9F0FJW L#Fo4х8Y9Q 9#-EðFF `*FI0*FiIhF"F!@F FpF;F2F OF(F4Cׅօ8 FFtmm h#c`$ F8LLpFF,m<## FpL8 FF"!Qki#+iphph#qkhcq+hq8Fn F@F F i@i-MFF#FL00*"1FsO10FF0\+y/yhNEHj1 )DF(𭀄F:@h /-LXFh/# XF(W%e F F%=FXF[n0F1FB(Fqx.+0F1FB(Fd.FCEF)/*(F)FB0FQ  XF% l( F "#XF#7%#XFI#e xʅ194979Q8Fr(lph$d(Fy F8$8Fl FH8)Fh(-AFFFF@"8F1I([h/!8FOGQ-K2BOAD2mH0R ۲B!L0 FPO1@Fh0F0AFO2~9F(F(F(F3m $0F`BBLLLLօ p FFFHA:m;m& hl=Hp+h1F0h#V(*`1B2 HHH8 FF(FhF he`O(F8MpF FFn2F)F FF~ FpF`bT@FOEFH @<RE-=K5B  0F^F"%h< (-EFFF3+'#H\@<SEH"AFFXc|"|B"3B2 Hh8F(F(pF%iBp#S```E`pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! %F(׀"!F0Fia#`Ocz%z'GE%z'DEEzEe%DB:! F(AF ha(_Д,0- .C#+Z`(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1Q@5=F0+++ji FB+jiR+ O1F. @   O 2Lhhi (FV*L*L ;P+'L bFHO`@```by#y C#Esj ubC B* (>F8(F(FLRFYF0mh J`;`x``PhS````#  (pF FJ)FFF0F8(];((  p FFF5 FF H;h#> HT_B6H0Fh(-h -EFFF 0F $HhBظ HFZ_UE8FhxhB+iB٧9FhiFH*ihi?!8D|na@FF(kiDt -h -AFFFJ F0 [HT_B@Fh+iBjiC;R#P-(F3hFB0`:HF)F4`0 -h-E FFF  F H+h#HF&XE+hB .`H 6D%i;&FEp4FBsachg`<`{`` c6 FVO3c8(FC9H$h1BB?/(F11H,=O 2O3YBRBUEAE*ѥhhB&jjjjBBLje#S``#`C`FhXEM,hB jH" I F $hH8E  Pׅ7@u RCOC BR o j0F KFBF7ٵ((Ј #FOQ eFH #*h(h H " eF(##2F FF20 " F @Ho FFFF L FU F*F;FIHL"(F1 o( +:-M@uF@H_F,## ? FVGWO8H 4?J: F Bzӻ_2F FW F:F FO(DA2 Bl @- aA-K- EU U2*Fxj Rj R O1AQ60KdFFF2`@r@OO6BFVkF2F9F - (IJe]@q@j@@3#`Hʑd}7FF F0H%(F0"F(F0F!8@ T%TINE@BB!Q@BE"F I H H&'Dg!@Hʑd} K:FH$ph bE("TC`` #+`B")(<E(џ h4(ĕKh;`H8􇀄pG7@s%!8L @ @:E BR)F+F#H J @"@)F+F (F0c!! ~F(4'%#&Gpp"Ipp8D##u#cuKuu KO K"FK8FKIK KKKKKK:;ha Hم@؅ׅl؅ׅمօ0؅ ׅ`օׅXօօ pNFI4hB j" I h F--#FFF<$h `ׅ'=H3H! \`"H"ZBK`]؅ pG-MFF FF.NM(F'-)F Fj"HKF`HKF`GK9F`FB.*@DE-;FOE4#B_F:hD*k%0@:i0Dh8Ka=X6J7KFb6Kb9F Fh3(2)Di;1 FG$hBiBR$dH "Hh!OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33   $ ` '(K`O0D;M,h,n6F(fGF(aF(\1N#0J0I1HyF(LF*I,H+KB*"####J#I#&H]FoF9F`F@F FQFF;!0F p H #" IC H,F( H,` FDb:օh:FO1FFFP0@O2!F+F!JO2p :FF&o%DB? (.(I`_#&;+j0Fp))H 7($FFF9 KB 8](@`83%0#%0@<4 F<4@, pFF >=65OC FpF(B$O4 F<4@ @x7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F F)F FF F8FFFFo#(F"F;F1FkF #x#`w(FFFFFU,#"F1F;F(FF^ FLpF FF82F)F FDFH FpF FFF';F2F)F F5F6 F#%1J 0p 000+J+F+I,H PvF(F $J+F$I%HiF(9ѝ 0NC 2F+F"IHSF  0C IC 2F+F"H<Fh 2F+FI H0F Fp H 献օ*>X:-AMFF$FO20F)hX"8Fih K( #h4,  -AOFFBFFFuKB(h+Fh+FBF9F0Fe( Fi#+`$ FDF#-M`O1 F(qFDF'; EJ٫:F 0F+"F "1F-)JFB0@(F!F0F "F(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 0 "! FȹM!FO2(`^ "+ha#F!JHcF F0UbEfiVaL !`-MFD0FFFIH*)л+\**!*"9F@F@ Fѻдv AF8FF]+;ih)?-H&&л > !4Х 2k.++h$@AF8F0""F[FHHViha@1CЅ$@B?{?x.lh(F_MJKFcKScKcKd % 0@ L#h3 H#z ! Jch hX"(H40"MFHMFh+x#H #+pL F 0(p# H#"#%8BBLH :: ;-E2CFF0H /H.I.KBB"i)F :fi'B#iDB  O18FFF+hS "9FPF##QF28F9FH j QF8Fe@"PF I kh+h3D&,;UbEfiVaH;<酀O1 F(H :HO2#!F#H"#WF(#*s H  F iBBH FQ(6 :h;,;H #FFF@;FKh)K#!ι"#K!#JH>FH Fռ;e{ ^t 8T(F F8@[-MFF p!FFF(1F(F/w:F(kXFPIF(e#F#F F(ZAFPF:f@F{h;;lAK#" :Kn;IF(f.B+z+? "!PF3Kcb3Kb3Kb3K#ck{<0#=0cibdd.E8#b`^*Kh2l*h`jhrZ`@F FfFfki;7;F1F(F((1F(FnlnF( FnIF(>0F$Hօ؅օ_-QH ؅-AFgFF(RЀhhBJCy+Ii:BFh3@C4@ @ BA2O,L4@%0FFX EFS+X ;F2F)FoF KBFG F;F2F)FLLLL -AFgFF(WЂhy+MhBLSy+Ki9BHh3BC4B B "BA4,L4@%0FbFX FS+X ;F2F)F6F2 KBF F;F2F)FjLLLLL  IAXi(hy8 ] Hօ{F "F!F F, FI(i؅-ALh Fd(  Fh&+) FCiF#ah6H #FFX1KahB B/H O0!F(Fh(F%FU4O<<<B $Kh+ 8 @B F!%( FeF FaIF(siahH2Fi;(!F0F0Fk;;Dօ$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?Ds`opFFFF p"FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FF/0Fsi +O tj$"FYF0F:F)F0FFFOSka?kbo` #0FI (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(F K?+`OSkaOSo`ai$a 8F_F FcjB!F Fh"jDc`(F88+ h+o F]o JC o >JC !5𵅰FFFF+hbo :F1F(F$FFopFFJF FC+3F!F(FJC+!F(F0(F p2F!F(F(!F(F3c=]=-MFFFF(F F (FP!)F F - Fo  F1F KFh HF Z(0"   :D F # 1FF FF( CE)F FN")F F1FF F(CF(;F*F FF()F F-AFF$FFAF8FJ`+ohZЫkFAF8FJFXF0F~( 3o0F@-,`>>-AFFFFFF(F AF(FI(F !F(FkFA1(9F0Fe(!F(F"!F(F89FFF0FBF9F0FC(F#F*F0F(!F(Fo -MF F3(F,0F |F(DF (F(@(FI +g2(FIF`1!(F(Fր!(FJ@!0FJ8CF!0FJaF/?y7x7)?"F! cSDBњTD/) F F(" *M "YI i(@  ;!(FF(FNJ()F0F 4L0F [FTF!F0Fb(7!F0F2DH "4I (B2K#$,Կ#Fc9FD0F ! ۻ)F0F  FoF) FXF 1FQF,8 cRF0F&/#` 0PDAF(F#FFPF<,?=o:8F6QFF2?)?(?QFFFGȱ2+0(,(0FG?+?7O0'0FG?+؀|d0FG?+РXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGKT(ܠa+ 8pGBpG3Z*pGKTO10@91?"?+pGpF8FF,F Fp2F!F-AFFFFtO1F8FnBDEd`O@9FEDF#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@B+ȿ`3`3+?#`o0$H5B0 ]C@#Oh@@; 4L DB;C@۲40 0 F0M\B0K$5@`@0F FF @" F $FS +h$ FihBX pGphF F"!0F#3p#p$spp+h 3+`phFF F "! F ##p #p%cppD#`RFQF(Fp"q1F#"#v(F#Ia#"`vI(FZv(FcxD0D0"(FIHq5?%KL?P?v -AhFF"!F F#Ocpp&pBFAF`+a(FKBF qK(FI`qji "(FFKo|rC t!#"r#u!# ruu(F!sbsss"tbtaucxD;hD;`),KW?-M'O3F>FF'7%)O09FX;G D1"! F" FIS#"!q#r"bsBs"&s%t@btB@ Fqcrstt#ucuuu '`q_F\酀b?pG-MFhFO 1F 0 +;i Ka p1F8F <FiI:FH UiHGO07FH 0 BH 70BuiH 0 + kh!h2O HC3B :* JC;+>(1& 0h[ABBУieHh ch DBZIaH i_H!h@  F(NѣiZHy "hO(OFFrC e2F[D F GB Fc3FKI KH iJHR D"h  *FH_?>D#h!khDD0 0h3BУi2H !h @ YC?1!?Fi+H#"h BC h ch DB?r%KF#3 [BFYF3F F G B5[FIJH 5iHG0F ???AA?@*@O@ q@@@@@A$ADDB#h! HcBs 0F  D UF3 YFci FGkhDD 0h3B?CiHrIH iHj k8A ^AzA-AX_%,F F `%<` 8FYF,O I j G'F8F:FFI \"FH wAAAsF p%.F F (.x.+@%#x46.( FsFNM| F #x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PF5ch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FH FT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3FB-M0Lxx` Fd+CXF2> F C  0J C F(o o-MPFFFF$#QFHJXFF`iF(o 07FQFAJ`XFQFh>JbXFQFxbCFBF1F0t;i2FAFZFAF0F{j;iV#R# B;1F09j S-BA+h9jxha#@2FAFhBT,#h $G(*FiChGG4(7o-MJ hDhhDhc@c@DJhscJN"Dh"Dh@e@Dh5UJ"Dh"D,@Dh4D"@vDZ@2Di"N>DD@k@3DNiscN>D.D@e@5Di5UN>D&D,@T@4DN4VDD"@Z@2Dj"N8>DD@k@3DNjsc N>D.D@e@5Dj5U$GO?'D,@T@MbeD%Db\@,D:MT5D DdQ@)D7MqA=DDac@+D3M#5DDcJ@ *D/Mb5D%Db\@,D+MT5D DdQ@ )D'MqA5D+Dae@DhD#C`h`Dh`D` D꾤K`Kp~('09|eVD")*C#9Y[e ]O~o,CN~S5:*ӆ-EFia(CiF$3CaCiTsFCa@ TE"FE0RF-9F(Fs@8"!(F#i)F#eci Fce1!F"0F Fp@X"!!7-AFK3)Cc3#FF3EBiF8F.FE(FF!F2FhFW4Dw#Eg#`C` K`3`)Cca3CaKapG#Eg-M";3xRxC#xCCxCcRyyC#yCCyCc RzzC#zCCzCcR{{C#{CC{CcR||C#|CC|Cc R}}C#}CC}CcR~~C#~CC~CcRC#CCCc! 0C#" CC# Cc% $0C#& CC' Cc ) (0C#* CC+ Cc,0- C#. CC/ Cc1 00C#2 CC3 Cc 5 40C#6 CC7 Cc9 80C#: CC; Cc= <0C#> CC? Cchhi[iiZ@@Z@C3cDD@C@H D DO@Hc`DID@ftDOh@ D4@ D`=D,D@ dO_@/D %@DgD:@B@eDO.@DD b@D`O^@>D@ DDf'D4@ DgO T@D;@ DD+Dd"@ DcOr@*D@D0DbD@D`@0D~@eO~@/@v&D 7D t@`t@ t@ V@&D g\@O\@Os|;@DcD  f|~  OrM@ q2@ B@YIrD(c~D OH@p ]@NIuD,~b e zOww7D P@O xOvpD `DwF@>D k{@Os swD D fz@ nrr rw@ DOgu@uuOqItD&DfD@ttOq I p D4O (yZn lp0p pD D kB@ rrp O pppOr r:D Dnr rrOqIxGD jvvOvvfD $Dgv0hvv| ~@(fDTO|||Ou{DX]D,f{{e{Ot~t@(tD\O~4d~~ ~D D, jwww $~g@wD\O~~~Opp0D  DgvvvOrrx@DQs1s h;s Hs`#DcCD sss @C sDdzzzOsE s cL Dw wwOsDCsD4bs s,s sL c@Ds$ssBHxCDcxxxOuu@dE%D{ {t OqC&CI Et&Dft(ttFtbNDnܼr rrF"Ct"Dt ttOqaF pNb c@ D$zzzOsB;Cw;Dcu u{u@e7C/DuuuC.C(u.Df|||OuGubHD Fu uuOr N~rD(bpp p pHc@D,sssB N(~sD0c~~~Ott@d>C&Dt ttOqC I Jz 0Ox xq ,IWDx  Dgr jrrxz@BDOxxxOp|D `Db| ||OssU@D`s Osesv>DC@3Dcv vvwn@>DOzzz~D_@wD f~~~tr@"Dt gtOt{Dx@ XD bu`uu { U@]D$Osss s3D D esss s DhwOw wsD D kv lv vr  DO p ppzD RDcuuw~]@uDH,b~tOt~V@DvD` ~~~e~h@Dfp0OpppDs@Dns `ssL tDd`ܼbD`aVaDa@3ܿ-EhF?`(ChF(3F(C`@ ERF@<"AF(FLL=Ll;<L,:LL9Ll78L,6LL5Ll34L,2LL1Ll/0 L,.LL-Ll+,L,*LL)Ll'( L,&LL%Ll#$ L,"LL!Ll L,LLLlL,LLLlL,LLLlL,LLLlL,LL Ll  BjL, LL LlL,LLLlL,LLLliO,slKDDjiiDDCih hOs>C^ih H iiDD   KjDDO(ivhD hO~8C h  hX iJ D    JN BD DDO(uhhDbDhOs8  J XD JbD(C DDO,rlDO{<   J h\DDBD<DDDO*rjDK O|>   J ^DL  DDDO(uhDOv8 J XDsD DDDO(shDF Ou8  J XD LDDDO(rhD  E O{<  H\D   D DDO.znDfDKOr> H^D    B  DDDO.snDOv>H^D eDh   D DDO.unDFOs>  /BD7q۵[V9Y?^[1$H ^D    C  DDDO.wnDO{>  H^D  4 D DDO.znDfDKOr> H^D    B  DDDO.unDOv>H^D cDŠD DDO.snD FOu> H ^D DDDO,wlDDE O{<  H\D OLDtL,DON  DO,DzlDDvDKOr< H\D OLwL ,DDON ` DDDO,slDBOv<  H\ D OL FDONsN. DD DO,wlDOu<   H  \DDON(DDOHwH( d  D DDO(whDE O|8  } Ut]rހܛtiGƝ̡ $J XrDD ONL DDOHsH($`    J DD DO(whDOr8XvDD 3F ON B DOHvH(( D   D DO(whDOs8uDJ XD ON  DOHuH( d  D D DO(uhD C O{< H \D OL ONDvN.D 0 K    D H D DO.wnDOu>bD^D OL  DE D ONrN. 4` D   DDO.wnFDgDOz> H^D ;FJOL DDONwN.  8    D DDO.wnDOs>   H ^D OL ONDrN.D  <h C     D DDO.wnDeDO{> H^D o,-tJܩ\ڈvRQ>m1'  OL DD ONuN. @\ D   DDO.wnD  Ow>K^   H D OL D DONwN.  D    DDDO.wnFDgD Oz>G   H^D OL  DONuN.D HX    DDDO.wnD  Ow>J^   H D OL DD ONtN. < DDDO,wl DwD O{   H ^DDOL D8DONxN.D<@D < dD4DDDDO,xlD,D4O|< \C H DDONDDOHvH( D䁆  DD DO(vhD O|8F    J XD ONDDOHzH(DD4@<  DHBIH.DD< H^D OL( DDONxN.D(D<  D( D@DD< H^D 00OL DDD ONuN. <@  DDD@@O.xnD DFOs> H ^D 88OL 0(D,D(ONxN.D0@<0 D  < |DDDDDO.xnDC O{>  H^D OL8 DDONuN.D4D@4 @  D H^D OL D@D ONtN. D8  D tDDD88O.xnDcDBOv> H^D OL D 迢KfpK£Ql$օ5DD ONwN. 8<  DDD< H ^D OL D$DONtN.D<8 @  8 TDDD@@O.xnDC O{>  H^D OL D(DONwN.DD@ H^D OL DDONxN.D8@  @8 4D
 H^D OL DD0DDONxN.D<  <  D@DDO.xnD FOs> H ^D ,,OL 8D4D8ONxN.D     DDDO.xnDC O{>  H^D OL , H^D  OL pjl7LwH'4 9JN DDONxN.D   DDD O.xnDcDBOv> H^D OL ,DD,ONxN.D   L DDDO.xnD FOs> H ^D $$OL DDDONxN.D@ @    DDDO.xnDC O{> H ^bDD ((OL $ D8D ONxN.       DDDO.xnDfDKOr> H^D OL( D<@D@ONxN.D$ $   tDDD O.xnDcDBOv> H^D 00OL DONzND.   D  F DDO.unDOs>H^D D44OL 0$D,D$ONxN.D   \DDDO.{nDbDCOu>H^D OL Oʜ[o.htocxxȄnj4 DDONzN.      pDDDO.xnDfDOr>EH^D OL,D DDBONtN.DD DO.tnDOv> H^DDOLD DOHDzH(DDDO(thDF O~8   hXJ DDhDDi CiiiD j Cj  $ElPxq-EhF?`(ChF(3F(C`@ E(RF@<"AF(F @$O0$818D@) Vx@x2@>D4D1O>$&`$ @#BvE qFdD2 dD12O< $ @ DE@ B2ҋH (`O0@$ B2  0B)s430cc  vDB>D-pD>FE+DGBG>DvD>DB@DpD>FEDB;FF( 4;F(?( px3Xp3  B;D vDB>DpD>FEѠlgF ll8 ll lF B{0{OPٲFFFFH (F,eF  GG3. L.FF (G0x u$>D Hu O0$>D&`yH BBB-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0p0i۱$"aBcOBDa`aZab`\``bbbcccfed Fo8 FF(/#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#ao8oAA8FiCjkk3"cjikjGj"cjiG a8o-M*FFOD xDOsBE=,DB٤D#hk + ##` 00k0#"(%&0FL2[imto2o hZ ##`/$;?@D5-ّH3B"FFz"a ,`s#^F]Fa#`##a#jO2ch0! !K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ʀ;?@D5-+&a`OЊK#j"`#i"i ,`a%#.F#`-@Ҁ#j^`#i"i a%#.F#`-@ǀ#j#`#j2 `#i"i ,`a%#.F#`#icЀ-@#j&d^a#i%.F##`#iZ-#lFB(F#"jixQii bE `DDbE:RZFQF#iZFQFia#l  D#d+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFipaDe 0p0jccK#h+|0BvPhk(@V"ij 0(Ghc(@I##`o/;?@D5!/;?@D5,/;?@D5A"i ,`aCFC+C]CC"j*?9a6"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiaDf##`#i- "BгKh"j*Sb/?R+?@D5%.F"j*@#b"#jc"FFa4 # /?4;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZF!  D[D#l #d3/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?c+?@D5-Zf7J=2083$ nB 0JC+cfd#ceDSDJC =F8xF+x,HNO08`Czz 3 H #xF3-DDxF0-H0BHjDD-LF#K "KFFFo<"d FHFHO4 F;h^D ! F+([ HbO4[;`+C1Y+YDDFFFhFFmC#"F+F9F0FK KBѐB  Վ-Mh# FD `x)@+@B=B FFU;+ѢDD9 x+@H?+@C[ =DB1ӁB@Ё 3Eon;+CB)j1 D aE!BExxA!xAAx.9pp ]pX-H٨FFF8x@ @ @+O@  _o_C F 1 F?wDF1BgD e3DF7E7D)DUwFSIxCwCB.B@+-]\7XFQh|(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDh#h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hp`#h@F` h8DCh+Ѓh+Уh03` h8D0] hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(F-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% Z}iD 8?C[E \+ 5GD}h{a5#Fhh"F!0F!O= O\;iB # F3p!F hF`(яChh:sцP/Rh:oFFF1F^E\.уCFxkEe H-MF;mFO # FF` "K` :PF "K1F"F#+U;m.#RFymhl:m`C0s@0(OpAFP(F@F0+<(F (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(Fh+ѻhh:mBTPAFl`!h(KHh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F H9X0Fh9m(?QHkjH9HHFF$'khB *hX+40G(FFKJKF(F)F0FJFGB);F J0DBؿ$p)J0D0F+QMHF F!ǿ"iF iFH 3]v-M F'<"   $+C C$ C  2K]fF1HM : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$HH!FHC1FHHHHI-MFF@+FFFF@ PF$)F JF3XRF0F-IB('FO Dj  E #D0B2#.&}C!LB."P3kDH,I-0K*00FIDD  - 00۲ +0 0;xg\ p32ow I-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FF8`h );hDD8o 7F , F-A FFFB(F7GE(GF!F:F(FB}ٔ sFvEѸEO >vE4 3B/m FF:E "B(1F \ @h`DRE,  Y`;?|QF(FhFBhBD:BBEӂh2F2 0TD@(F4EؘEH2 0F(F<(vO0 "SCL` `S`3oI#-AhFFF FDOE 9ЬEѼBFF @eEdD4ӧB3  CCPChC`O B 00XP0AþO0pƈh : DBO0p%hch+D;BؕB0 4-MF "F+Nh V {wW,B W  BDR  DE; ?E(O2RE  *F!F0FC*FHh $ F F")F((O4 "PCXBdĮЮHHIHKI @ISĮpGp# FF FFH'F0)F Fp@"pĮpF FF FFH83F)F Fp@"ԽpЮ"pFF FF FFH83F)F Fp@"pЮ-MPO @  @ kYF0FkBz"YF4DEѽ Bw"(FIOFFF FF8FC #XC;hrX"DB Ih D;B*F1F F$ FĮ"p#FFF 2F)FH FpI"pFFF 2F)FHp FpI"" !-H` !*L"`YX%%vh 0 "HIo IF*F@8p@ hhC h3D[hB# h h3D5D[hh+D;B؟B83"D "HH, Fk2*Į JFhFh;hBDh)0ۈBF4)`ہBݻB0``)0ۈBF*3F*-EhhFB8FhF 8BFҀE ܾ#0khB,h`0 МEۦBѮh E&F,h # p D`B```pG2+ͿKZ"2ؿTpG7J2+ϿKZ"̿2pGVJhZ`xt("m(S(d(0(pGn+ pG pGOp`pGOPpGOPpG pG pGp FFF!"pRa D23D2p-MF k FFF%9])?K+2\ldM3hBF8FSFk;F`BF3`;Yx8FSFk!DF;xD-0h;xB%(F[xq*FD@D6(3h+D3`45hSFBF8Fk5`;[xDSFBF!F8FSFBF!F8FSFBF8FkzF(SFBF!F8F;[xDtSFBF8FkdF(SFBF!F8F3hSE ;I\ 3hSE 6I\33`4H3hSE /I\3hSE}2hREz!;x[xP3;DBoϬE22`y12hREb!;x[xP3;DBϬE?S15hm 4@5h ]B]A;Zx3hCDK204;Zx3h [2 CDK`"FH uJ-MFFO F;F(FJ Yx;F(FJ1D(F-MFFFO FCF:F(FKhYxCF:F(FK1D(8 F!2+ʿKCU28J FA\F)Fѯ]+;UDix]D!R= F")F:fU2[+˿Kd2cpJ-MF FFF'2+hZ*`x.*,#* *e+`b+hx)@!p$ )P!с遅遅\*q?*ŀ[*Zxb^*aO 3+`+hxbK2^*$|*/9F F^"AF F#02+˿TK2Sp#U+`! F] !!bZ*`x\) ])YF FKQFH (Fb  FI FDFO (FbKOF F!!QF%>2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`xJJJJJ7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpFO2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80sF,F F8!FGF 0\+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p35}-AF*K*FFF e F'B<"pB "B0Bp;2B+Bȿ#D#F !!MF(CD? B XB"p7Bp<3F%KF*FFF0FF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2_K-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p|$L-+G0+gУ0 *M FO F;0 .[ x.+kKxN0 *_1F# F+0 O#s1xz)]g)^L)W62xx*b*j%*X*WE<%#;p3x|+E{pDFsxq++Э +#+*+UDDDD@D30O8"0*+U;FO3#Z)O1HhҲ l)pxl(L!6Fc:*P"͓ѓBF;F !SE8p3:*ܸ3ؿODؿ#DWE8U;8;p !#FGD* ܸ3ؿ#D'F6SE8p3l)U+QF48FCFFl)FQ+qxFU)I)M)RD) и? OD D! i)tm)@a)O hDa#QF8F#B4QFCF8FFFF(FQFCF8FF(F_JIsx\3FRFD@"@ OF    I* O:2p2*"$@ p4 CFND@x$@4)w; F F <9)E"*T  FO.xl* B*L*""(F s*(FPF"4CFQF8FS""0I o  F+h t)ѫF[+5%Fih[+8F FQF]FFF![+F[[*E1_Kd F`B ` F S+Q]pGF FoAFR]pGmF F@AF F mQ ]pG#F M Oku5 F !#F$01 +.FO0F䮈" Kt J]Fs] s䮈7 F"F x x@ 07 FFJ(` x x@ 0K\D C9(Կ08W8pGOppGpx0+CxL\D۲x+"0F%&F0xB `(Fp*"* ""ѿ "ο#`FFFFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`xF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1A"˿8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8pFF7)KB J \@Fl;]v `!p@%B!`O0p"տ!xFSF̱%#F.FF jB<+F!hF#x F&0F (FlF'@ F0D7B'Fh F@ݽFAF рpCF(cCc "!hZC h 29FZCPZ &%`pFF "!FNM)F0Fo `#cp% D-EFo9K5b2$d!@FF)Oq@F!Կ''@mD K :S*0!DhD a'O0Q KpF F\d!(Fr)Oq(Fl!cXBXA0Dp -AFAJC$4%FF>JeBOu4$$S8N#D- EE!(J(Fa@m1Kxp2@m/%%RD,,%ca(FAF#F$*F -#F*F3`K2:a#Oab f`K#<"[ f{`#>`;b8d!@FYOq@FI m D!JrE.€QQųFFFG-EF&O8 jD "B ci+#kHhY+#CЩh@F!Dj #BB!@D j(??1!?o6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? >6i)D-AyF+ѽA&iDrBFܠiY+*i "ih@F!D(ijiB!@Dii(??1!?6yF+*ѽ@,j,DDhhbich+!~hci!?D?1!? 6+Bۨi!i)D&('KhFBH +H ELFfKK-AF"FKFK̲`KF(" `@F c =FnF2F)F FQ#J`J`J`J`KJ#?`pGLTPH9<-M KFhFF0F@I"42TO &F! apppqqRFIfq +2F "RFAF 2FKhMǺ<&؈p N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`T؈؈P؈K,KhP #A1JhB  L#h3 +#` H#"#`K``TD@K؈-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQF{ B ѣyyC#г6@0Fu#q#qFBFF4T:F!FPFOBFF&II:FYF FDF51F*F<)F8FMO;h+"+KhSEN0h"AF#MFFRF FLG"AF(h !h(h#;`#`3` L؈؈TPLHKh8 pGT-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*{ [2!!p!ppap#qbq4GH`Fh'F #;F`pFAF8F>HM(b"!;H(\^##p#'cp#6Hpp'q8F(Z[(Ra#cq#qq:F0Fv4+H"*K'F(FF@Fv<#;FFAF`p8Fo7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)tw ]##p#cppp41F H4;H^44!L.L-AFFB!x)ѽ)ex5C)]2))[()hHhT3+R#emu})S!âˢ㢅 )5,D":H"8H"7Hcx+"4H- #*F2I2H':F1H#.JU/F?-@#*F+I(H?':F)H}#&J/F0+- #*F!IH':FHd#0/F"HxKp"HKO*F8FFO5L؈؈؈؈CLMLLl̵L`X\ԈԈ"sF1F KB#MEq+p+x1Fl+xl,p@˾pcScX-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDlKx l4 F@hKx+Ob!FfHeI xdHQF"cHv#3`aKh^IF_H!FMܽ 3Zx2DWHM6"TI F( "QFE+?yLN7h/?}/?q/ FAFO FA0BI@)F@R F=IOb F#D#wcw#0JwFwh[5J R$ "% 4BF#&IF8"IZBF BFQF!J9FhpD# FC"O1E)DcSc؈؈؈XԈԈ4؈𵈀LL؈d騅&Mb\ K`K`"K`K`𵈀쵈-M$cOcH<`(!F{_K`_K`Hh%1`@@R! FYIOb F8O #VJDwwFhQJ R$ "% ("=",6"0/"4(#FAF8":I+F*FQFp( 0FC# (FCC CcL*K-h*1 "@F$Kh;H#P " C" FD#O1OKIhr#H;`[)DLpIH"P2`d MhM&𵈀Mb؈Ԉ쵈騅IKhKhBHq@ J Ih@oOcFF`@𵈀h1M쵈騅KJ`J`"K`pGu$ "K`pG؈pGF8K` ؈F,K` ؈F K` ؈FK` ؈@""FH o?؈L#hKJ#?`Ja`@aQ`QS``##`@οhw(8+H*MF` +hBg"om%K` F8$I F#I( F!I(" FF +h3+`DKh@ KFh `KhsKJ`BrK`K`KJ`"K"Kچ ؈|WM؈؈؈i$uK(FFK`pGu$KhpG  KF` `KJ`Ozs\CKC `MbOKhK<uK`tK )F F`@߀rKh@GOv@qmK]B(FFjKB[f{#{C#@V[B&e}#}:C#[@v@w BоB B@𣀳o-@B@)F F@4O:*@@s B{{e|F&#|vC#[ :*oٮxxF&vBg.e+x@*`+\!(F(V".JhB3H" yyC#[ +8kz++}+ k}+/H@λ2F)F F@+(~k~@ @(>Bi}+}}C#}8A! H[IhG؈؈؈nl؈\M$KOsB @s@ B   pG pGnpKFOsBdO @tF"I@s rBӲ" +sjspo~)s!ds$ iss+tjtn؈8F"F"Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubu؈E"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! Fr r؈FFB"w"JFh!4{rd+uu#",v$kuulvvv؈-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F 4$K`K`K`K`uK` F O0o&,TLH@D$$:!H8 Ԉ(()) + #@J?O( KhcH Kh#HKh H"IHk(CF(H H H ؈yM؈M؈M ؈NMM H" K` (H"K @B6؈5N("\K-M`O"YKYNhZO`F<e F#;`MK`-/'7 HLR( wDK`"AKo`>Hs":K`k"6K`|"hbI-Jh/JhB"h#`G3h+3h++2+0(F((]oL]"hbFH!hH?KHh: --@$hAo?؈ ؈؈؈|ԈTSN؈[NH†-AHF FF:!@FnF@Fcop8`*Fq F# ,D<(*FIԈFCF#IҲ]|Nhx0; +!H@@pOpFK lFK n"K`؈$MF$HjBp"I"L*h"K"I` hOb'$hJD)hF# Fh1%!J!ueu[v#vuu%vevK6`uK u(F`$ K`@ɼ؈NݳT,؈؈H@D-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF}! Fr r%uuuu u"FFD9F2F`1F(FM؈؈؈OKONh2h:*\fs\\OrREI FCH00D FAIAI@K@Jh42?I FX F'0;KD:F Fh9IJ8KD F:F6IA3hD+ 4K+ F:F2I3De$/K0J0Ihh h/H"-K`ObR+K$h[k%ObRO@s(k%Ip$%ObROs(kIc$%ObROc(kIV$%$%Ftو؈NMbH|ԈNrNpNووو؈؈وNNN-McJFh BaO9h)`JhBЊ*- "oƁoв@`"o:`RJ PL`BNKNKM KIPFFx(F?GJGJBFEH#;`DIPFFx(F)@Kh2=Hu#;`وQOO؈4؈GOkdوfوOOJh3`JhBIH@c H+ K Ih Kh+н@وOOOetو-E܁wL0##0tH "!? qH( "!6nKnHmM "!+(`)hziHVOzs+`gHfN "!0`1h)bHC#3`@W"B9F^H8#'0[Kp\Lh"!F@F0B`F VICTH#ҲQI " F]!FOH's FMHGKLIDJLHKI hcKKhJ0C@BGH FL9IEH!hIICH h!AJ@' >K?Hh?K$`=HT=K `;K2h`;K;I(h`:HE"9K F`8K`O@a5Ka`4K"`4K!F3K4HOr2K2K`2KE؈rOOpPPDPxXPP؈و؈؈PTوPNPQ؈؈,QxԈKQZQQqQpوQtووeووووfوbو؈tlوhو( (=] 8FF#h FkiG"!(m 88Fj! !F`h0ahHo8+y+ F8@IQQFCl hki㱀lU FyByCyCyCzCBzC#h FkiG&ah@Hź(ah@HQQFF(F#3`3qFIF"lF(MBI"lF(E+hki+SO Fp $oos( $,#HF Fp!HF(4F(/|$[lH+HZhl%.BH'[lD+H K%MR巆RR#` "FF(opFF FF)F jh"R$^BSS1R*0? P_@QP:P`p Pd@ 0b 0 0@P`  8`"(`"$`""`"!` pf01 0 0ExGI 59YQٕm  NPa N N N NPp N@@B'@B@0u@ @ P@D)5:@ 0uP  'a'ȯ N'P''a:' N@B@BP0u::a Neȯ:8a  ':'0u N'P''::a:@B@Ba::hB Ne:8hB  ''a NP'':a'@B@B0u N':: Ne0u'8:  ''a N0u'': N'@B@Ba N':. Nea'8.  ''a N0u''::X@B@B N>X:' Ne NX8'$+29@HPX`hpx熀熀熀n톀s톀v톀{톀톀톀톀#A톀ᆀJ톀O톀T톀Y톀b톀g톀Ch0R1=C.)D9#8 J-J%4)8F&+]'F&?ކ݆ކކ#ކ-ކ9ކCކcކ}(}}(}(}(}}jEI.9Q9+9@DI䂀1䂀4]Y3a5-3]2522}† 3 g熀Ӆr熀Ӆ}熀Ӆ熀Ӆ Q 熀 憀C熀(", *$.)#-!+%/@@@2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣykI)OGI8z!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIEݘmu񙄀IŞ}'hUh=OtUR1h̄52%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(b?᳄5=І8(HR<3<%<<@ @ 14f4'@B======>>$>5>H>]>o>>>>>>NmmmmKmmnnEqY E&&E@x}uu@x}e 熀熀FK)==<< ==%=C=-=:>Cm=R5=aօhs􆀊􆀠􆀷&5D}  +*+*=+)    뇀_84!8444,KKK~]9_^Ac *a:dxcxhgx Xx _x Px px Txix]-?XtBaWSPxhTxgxXx\x_xcxfxixmxpxtx3Dh&ǑQꆀꆀꆀꆀꆀꆀꆀꆀꆀꆀꆀꆀꆀꆀ(놀ꆀꆀꆀꆀꆀꆀ놀놀 놀 놀놀놀&놀.놀9놀A놀 G    ʉ ҉Nӆމ? / H b ~ m   و  -=UJbkwG ?G ?Sl/ J  ᇆ 򇆀 m7؇/> J  W b m}‡Ї Æ ͆ 膆  b~炀Q炀 @ @`00P]`FC=݋#D,J. Yh?u )m?w?5 󂀩C5  A @@  @@ A A% A0 A; DF O DZ e q D|  D  ! !!  !D " ",[A,[        @  @  ' q a/ q7 >  E @L0S0Z0 a0@h@qPz`@@a` a`@ap ap@a@aa0`apa`apaa`apaqa` a# a.@ a9@!aBp!aNp"aWP^@ag@ ap@@ay@a@a@aaaqa"a2 %ц 5?Em?%цm?5?E(s*K>;6"+熀&4I]qm肀U肀 ;\!k憀~ H憀5fN 憀O%憀'4&,憀6憀]=憀E憀fL憀JN憀J$)))))))) )**** *%*,*8*>*F*N*V*N*Z*_* 3h* o*u* {**************q*w*****+ +QQ9#`##m#"#~#'##,##0##4##QQ$))();4=)C)JJ)N)W)])m'c)B#))))))4))_)QQ9#>#B#I#?ꆀV#QQ ##b#))#$$$/$<$J$ i$r$ $$&$$%$$$$$% % %7%@%4Y%_g%n%{%#%%%% %%& &"&-&B&L&Z&g&z&&&&&&&&&&''4'>']'b'm'q' ''!''"''$(!('A(G((Y(d()~((*((+((,((QQQf!y]9QqPT ]׆چ9ETF^FhFyFa:&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@ !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.1234567BootCurrentBootNextPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      'hUh=OtUR1h!A ,i   +,;=[]__of_translate_addressfdt_fixup_memory_banksrequest_and_set_gpiodo_bootvx_fdteeprom_rw_blockraw_accessdo_gptusb_setup_descriptorwrite_mbr_sectordfu_fill_entitydfu_read_medium_mmcdfu_read_medium_nandwait_for_eventomap_hsmmc_init_setup__put_mtd_deviceverify_bbt_descrnand_transfer_oobphy_device_createfastboot_mmc_flash_writeg_dnl_registermusb_g_ep0_irqmusb_host_rxalloc_double_indirect_blockext4fs_put_metadatafs_devreadefi_free_poolefi_runtime_relocatewrite_sparse_chunk_rawlmb_map_update_notifydfu_readdfu_get_medium_size_mmcnand_block_opwait_for_bbmmc_write_dataadd_mtd_devicecreate_bbtnand_scan_tailmusb_rx_reinitext4fs_log_journalefi_free_pageswrite_sparse_imagenand_fill_oobnand_detectdfu_writedfu_flush_medium_mmcdfu_write_medium_nandmmc_read_datamusb_ep_programdfu_get_bufmmc_file_opdfu_flush_medium_nandmmc_reset_controller_fsmmusb_h_ep0_continuedfu_write_medium_mmcdfu_fill_entity_nandomap_hsmmc_send_cmdmusb_h_ep0_irqfdt_find_or_add_subnodeomap_hsmmc_set_clocknand_waitnand_select_chip(((((AAAAAABBBBBB$(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %x / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... CACHE: Misaligned operation at range [%08lx, %08lx] Clock enable failed for 0x%p idlest 0x%x Clock disable failed for 0x%p idlest 0x%x AM335XTI81XXAM437XUnknown CPU typeCPU : %s-%s rev %s TSTEMUHSGP1.01.11.22.02.1Clock synthesizer reg write failed at addr = 0x%x failed to get device for synthesizer at address 0x%x Failed to send command to clock synthesizer %s: Unable to request %s %s: Unable to set %s as output A335PBGLA335BONEA335BNLTBBG1ethernet%dphy_idfixing up phy_id for %s, old: %d, new: %d phy-handleregfixing up phy-handle for %s, old: %d, new: %d A335_ICEGPIO_PR1_MII_CTRLGPIO_MUX_MII_CTRLGPIO_FET_SWITCH_CTRLGPIO_PHY_RESETETH0, CPSW ETH0, PRU ETH1, CPSW ETH1, PRU Unsupported Ethernet port configuration Both ports must be set as RMII or MII Clock synthesizer setup failed %d BBBWBBGWBBBLBBELITEBBE_EX_WIFIBBENBWAGW1BLAboot_fitethaddr not set. Validating first E-fuse MAC eth1addrice_miiserial#board_serialunknowncdce913@65board_nameboard_revCannot read i2c EEPROM BeagleBone Cape: %s (0x%x) Error in memory allocation %s-%s.dtboERROR: %s image overlaps OS image (OS=%lx..%lx) Ramdisk image is corrupt or invalid RDCould not find a valid device tree Loadable(s) is corrupt or invalid ## Booting Android Image at 0x%08lx ... Wrong Image Type for %s command ERROR %dE: can't get kernel image! Can't get image type! Can't get image compression! Can't get image OS! Can't get image ARCH! Can't get image load address! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Can't get entry point property! Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Resetting the board... bootzRTEMS! FIT images not supported for '%s' - must reset board to recover! ## Transferring control to RTEMS (at address %08lx) ... ## Transferring control to EFI (at address %08lx) ... filesize Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated NetBSD## Transferring control to NetBSD stage-2 loader (at address %08lx) ... QNXPlan 9confaddr## Transferring control to Plan 9 (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdtoverlay_addr_rInvalid fdtoverlay_addr_r for loading overlays Failed loading overlay %s Invalid overlay %s, skipping Failed to apply overlay %s, skipping fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sSetting use of fallback Selected fallback option, but not set pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedfallbackUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %sUnimplemented compression type %d Unknown Compressionarchitecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageinvalidInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdoseEnea OSEplan9rtemsTrusted Execution EnvironmentU-BootvxworksVxWorksqnxopensbiRISC-V OpenSBIEFI FirmwareELF ImageInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsizeWrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... OK loadablesThe given image format is not supported (corrupt?) %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Could not find config %s /imagesCould not find script in %s No FIT subimage unit name Can't find '%s' FIT subimage Not a image image Bad Data Hash Could not find script subimage data Wrong image format for "source" command loadaddrVNDRBOOTANDROID!boot_hdr or data params can't be NULL Incorrect boot image header For boot header v3+ vendor boot image has to be provided Incorrect vendor boot image header #BOOTCONFIG Error: Boot Image header is incorrect Error: header_version must be >= 2 to get dtb Error: dtb_size is 0 Android's image name: %s Kernel load addr 0x%08lx size %u KiB Kernel command line: %s Kernel extra command line: %s Error: malloc in android_image_get_kernel failed! Invalid ramdisk_addr_r to copy ramdisk into RAM disk load addr 0x%08lx size %u KiB Second stage bootloader is only supported for boot image version <= 2 second address is 0x%lx Error: Invalid FDT header for index %u Error: Index is out of bounds (%u/%u) Content print is not supported for boot image header version > 2%skernel size: %x %skernel address: %x %sramdisk size: %x %sramdisk address: %x %ssecond size: %x %ssecond address: %x %stags address: %x %spage size: %x %sos_version: %x (ver: %u.%u.%u, level: %u.%u) %sname: %s %scmdline: %s %sheader_version: %d %srecovery dtbo size: %x %srecovery dtbo offset: %llx %sheader size: %x %sdtb size: %x %sdtb addr: %llx Error: index >= dt_entry_count (%u >= %u) Hunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkdhcpUnknown uclass '%s' in label No bootdevs for '%s' label "%s" is way too long Invalid partition number: %s Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-std/boot/Invalid option Unexpected value '%s' extlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe/EFI/BOOT/PXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootmeth_efiu-boot,distro-efiEFI bootmgr flowbootmeth_efi_mgru-boot,efi-bootmgr#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesetherneteth%daddrlocal-mac-addressranges/__symbols__failed on fdt_overlay_apply(): %s base fdt does not have a /__symbols__ node make sure you've compiled with -@ The address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeadtb_idxfdtaddrERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfskip_board_fixupskip board fdt fixup ERROR: board-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. Unsupported %s address size descriptiontimestampdatadata-offsetdata-positiondata-size%s %s algo: invalid/unsupported key-name-hint (required)padding%s %s padding: %s %s %s value: unavailable %s Timestamp: HashSign%s Description: %s Created: %s Type: %s %s Compression: %s %s Data Start: %s Data Size: %s Architecture: %s %s OS: %s %s Load Address: %s Load Address: 0x%08lx %s Entry Point: %sFIT description: %sCreated: Can't find images parent node '%s' (%s) %s Image %u (%s) /configurations%s Default Configuration: '%s' %s Configuration %u (%s) %s Kernel: %s Init Ramdisk: %s %s Firmware: %s %s FDT: %s %s FPGA: %s %s Loadables: Unable to verify required signatureCan't get hash algo propertyuboot-ignore-skipped Can't get hash value propertyUnsupported hash algorithmBad hash value lenBad hash value+ Corrupted or truncated tree error! %s for '%s' hash node in '%s' image node Node name contains @Can't get image data/sizeerror! %s in '%s' image node ## Checking hash(es) for FIT Image at %08lx ... Hash(es) for Image %u (%s): ## Loading %s from FIT Image at %08lx ... Bad FIT %s image format! (err=%d) Signature checking prevents use of unit addresses (@) in nodes Could not find configuration node Using '%s' configuration Verifying Hash Integrity ... Could not find subimage node type '%s' Trying '%s' %s subimage No %s %s %s Image Could not find %s subimage data! Can't get %s subimage load address! Error: %s overwritten Loading %s from 0x%08lx to 0x%08lx Error decompressing %s WARNING: 'compression' nodes for ramdisks are deprecated, please fix your .its file! Subimage data is not a FDTOverlayed FDT requires relocation load of %s failed failed to duplicate DTO before application failed on fdt_open_into for DTO failed on fdt_open_into sha1sha256pkcs-1.5Total size too largeUnknown signature algorithmhashed-nodesCan't get hashed-nodes propertyhashed-nodes property must be null-terminatedNumber of hashed nodes exceeds maximumSelected config not in hashed nodesFailed to hash configurationNo data to hashToo many hash regionshashed-stringsVerification failedFailed to verify required signature '%s' Configuration node '%s' contains '@' required-modeNo 'signature' subnode found error! %s for '%s' hash node in '%s' config node Failed to verify 'any' of the required signature(s) vbecompatiblevbe,Unknown request: %sFailed to process VBE request %s (err=%d) vbe,errorvbe,errnumvbe,requiredCannot handle required request: %s aslr-moveaslr-randefi-runtime-randrandom-randarea-startarea-sizeversion-offsetversion-sizestate-offsetstate-sizeskip-offsetVersion: %s Vernum: %x/%xvbe_simplefwupd,vbe-simplecur-versioncur-vernumU-Boot bootloader-versionfwupd## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedstart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Checking Image at %08lx ... Android image found FIT image found Bad FIT image format! Bad hash in FIT image! Unknown image format! Trying to execute a command out of order Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobdevicetree = %s serial addr width shift clockbdinfoprint Board Info structure%s is not a valid uclass Cannot find device %d of class %s %s is not a valid driver name %s is not a valid node path Cannot find a parent device for node path %s Unable to bind. err:%d Cannot find a device with path %s Unable to remove. err:%d Unable to unbind. err:%d Cannot find driver '%s' Unable to remove all. err:%d Unable to unbind all. err:%d unbindUnbind a device from a driver unbind unbind Use 'dm tree' to list all devices registered in the driver model, their path, class, sequence and current driver. Bind a device to a driver bind Use 'dm tree' to list all devices registered in the driver model, their path, class, sequence and current driver. changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureNo UEFI binary known at %s bootefiBoots an EFI payload from memoryboot Linux zImage image from memoryList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticfunction: %s, cpu-time: %lld us, frequency: %lld.%02d times/s cyclic_demoRegistered function "%s" to be executed all %dms cyclicCyclicNo extension registered - Please run "extension scan" Extension %d: %s Manufacturer: %s Version: %s Devicetree overlay: %s Other information: %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. extension_overlay_cmdEnvironment extension_overlay_cmd is missing extension_overlay_addrEnvironment extension_overlay_addr is missing extension_overlay_nameWrong extension number Found %d extension board(s). extensionExtension board management sub systemscan - scan plugged extension(s) board(s) extension list - lists available extension(s) board(s) extension apply - applies DT overlays corresponding to extension boards apply-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s: Cannot find udev for a bus %d EEPROM @0x%lX %s: addr 0x%08lx off 0x%04lx count %ld ... eepromEEPROM sub-systemread [[bus] devaddr] addr off cnt eeprom write [[bus] devaddr] addr off cnt - read/write `cnt' bytes from `devaddr` EEPROM at offset `off'%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** Enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Error: Cannot initialize UEFI sub-system, r = %lu Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Fdt File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quitInvalid ELF image Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext4writecreate a file in the root directory [sizebytes] [file offset] - create a file in / directoryext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx Working/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s boaFailed to update board information in FDT: %s Could not find configuration node: %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d readingError %s the chip: %d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32loopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %04xZero length ??? byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: User Capacity: WRREL User Enhanced Start: User Enhanced Size: Boot Capacity: RPMB Capacity: GP%i Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc erase partname mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc setdsr - set DSR register value wperasesetdsrspi-nandinvalid partition number %d for device %s%d (%s) Device %s not found! %s: offset %08llx beyond flash size %08llx %s%d: partition (%s) size too big %s: partitioning exceeds flash size %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect mtddevnummtddevname%s%d,%dcannot add second partition at offset 0 mtdparts%llug%llum%lluk%lluinvalid mtd device '%.*s' partition size too small (%llx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition 0x%08llx@0x%08llxunexpected character '%c' at the end of device onenandincorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition nand0=nand.0mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)mtdidsmtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable mtdparts=device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions no partition id specified partition changed to %s%d,%d delall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08llx 0x%08llx %d no partitions defined active partition: %s%d,%d - (%s) 0x%08llx @ 0x%08llx could not get current partition info defaults: mtdids : %s mtdparts: no such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, resetting to null current partition deleted, resetting current to 0 partition %s not found define flash/nand partitionschpartchange active partition of a MTD devicepart-id - change active partition (e.g. part-id = nand0,1) of a MTD devicenot same typ %d != %d Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx Device %d: %s.jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error Fit image detected... ** Unknown image type ** Bad FIT image format Not a NAND device bootdevice ** No boot device ** ** Device %d not available %s, sector size %u KiB Page size %8d b OOB size %8d b Erase size %8d b ecc strength %8d bits ecc step size %8d b subpagesize %8d b options 0x%08x bbt options 0x%08x nand_writesizenand_oobsizenand_erasesize (bbt reserved)writtenquiet no devices available Device %d bad blocks: 0x%08llx%s scrubclean-y.spread.part.chip NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobNo memory for page buffer Error (%d) reading page %08lx Page %08lx dump: OOB: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x .raw.raw.noverifysize adjusted to 0x%llx (%d bad blocks) %s: error at offset %llx, ret %d Unknown nand command suffix '%s'. %zu bytes %s: %s markbadblock 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad biterrToo many pages in one erase block bit position 0 to 7 is allowed Error (%d) nand_erase_nand page %08llx Flip data at 0x%lx with xor 0x%02x (bit=%d) to value=0x%02x Error (%d) write page %08lx nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]NAND sub-systemping failed; host %s is not alive host %s is alive rootpathdnsipdnsip2domainautoloadpingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoleth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu NET sub-systemlist - list available devices stats - dump statistics for specified device stats%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated %zX## Error: %s: only one of "-b", "-c" or "-t" allowed edit: setenv## Resetting to default environment Please enter '%s': run commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars)set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintexistssaveenvsave environment variables to persistent storage-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table types-ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-am33xx-am335xdefault-arm-am33xxdefault-armmallocReadWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s ERROR: trying to overwrite reserved memory... SF: %zu bytes @ %#x %s: SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-systemHex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent-pSpecify a filename or set the ${bootfile} environment variable ext2fatInvalid filesystem: %s Error reading config file sysbootcommand to get and boot from syslinux files[-p] [addr] [filename] - load and parse syslinux menu file 'filename' from ext2, fat or any filesystem on 'dev' on 'interface' to address 'addr' time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneKeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d udptcpusb_dnl_fastboot USB cable not detected. Command exit. run as a fastboot usb or udp device[-l addr] [-s size] usb | udp addr - address of buffer used during data transfers (0x81000000) size - size of buffer used during data transfers (0x7000000)## Copying '%s' subimage from FIT image at %08lx ... Must specify load address for %s command with compressed image Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-imagedo_bootmERROR prep subcommand failed! Argument image is now in RAM: 0x%p fdtargsaddrfdtargslenWARN: FDT size > CMD_SPL_WRITE_SIZE Argument image is now in RAM at: 0x%p Subcommand failed SPL configurationexport [kernel_addr] [initrd_addr] [fdt_addr] img "atags" or "fdt" kernel_addr address where a kernel image is stored. kernel is loaded as part of the boot process, but it is not started. initrd_addr address of initial ramdisk can be set to "-" if fdt_addr without initrd_addr is used. fdt_addr in case of fdt, the address of the device tree. atagsusb_dnl_dfuDevice Firmware Upgrade [ ] [list] - device firmware upgrade via on device , attached to interface [list] - list available alt settings dfu tftp [ ] [] - device firmware upgrade via TFTP on device , attached to interface [] - address where FIT image has been stored ${Failed to get partition driver count Error insufficient memory gpt_partition_listuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: gpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname | %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d | status: %i Error: %d (%s) Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s First, set the PMIC device! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: --PMIC max reg: %d Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx Can't write PMIC register: %d! PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read - read byte of 'reg' register pmic write - write 'byte' byte to 'reg' register No CLI available%.*s%*s syntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildonebootcountbootdelaybootlimitWarning: Bootlimit (%lu) exceeded. Using altbootcmd.altbootcmdkernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: NAND: %lu MiB Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! modelModel: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_ignorelistusb_ignorelist parse error in "%s" usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: Auto-update from TFTP: updatefilefailed, env. variable '%s' not found trying update file '%s' netretryCan't load update file, aborting auto-update Bad FIT format of the update file, aborting auto-update Processing update '%s' :Error: invalid update hash, aborting Error: can't get update parameters, aborting y Y yes YES stdoutstderrpre-reloc realloc() is not supportedalloc space exhausted (unknown)Unknown hash algorithm '%s' HASH_MAX_DIGEST_SIZE exceeded %s for %08lx ... %08lx ==> md5crc16-ccittbootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Problem No valid hush parser to use, cli will not initialized! %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands ...xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** ** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsd%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type MBR%s: failed writing '%s' (1 blks at 0x0) DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOu-boot,efi-partition-entries-offsetPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl %s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtd#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesclock-frequencyfixed_rate_raw_clockfixed_clockfixed-clockclock-divclock-multfixed_factor_clockfixed-factor-clockti_omap4_cmti,omap4-cmti_ctrl_clkti,clkctrlxtal-load-pfcdce9xx-clkti,cdce913ti,cdce925ti,cdce937ti,cdce949/clocks/firmware/reserved-memoryrootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Seq Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p bootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxdfu_bufsiz%s: Could not memalign 0x%lx bytes DFU complete %s: 0x%08x %s: Wrong sequence number! [%d] [%d] Wrong sequence numberDFU write errorBuffer overflow%s: Failed to fill buffer UPLOAD ... done Ctrl+C to exit ... dfu_hash_algoToo many arguments for %s MTD support not available! SF support not available! virtVIRT support not available! SCSI support not available! %s: Device %s not (yet) supported! &dfu_alt_infoDFU alt settings list: dev: %s alt: %d name: %s layout: %s RAW_ADDREXT2EXT3EXT4RAM_ADDRSKIPSCRIPTeMMCOneNANDRAMSFMTDVIRTRequest would exceed designated area! %s: Layout (%s) not (yet) supported! dfu: fs_set_blk_dev error! dfu: fs_read error! dfu: fs_write error! dfu: fs_size error! mmcpartext4%s: invalid nand device %s: nand_%s_skip_bad call failed at %llx! Failure erase: %d partubiCould not locate '%s' %s: Memory layout (%s) not supported! %s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%sinputoutputunusedfuncgpio@%4x_gpio_omapti,omap3-gpioti,omap4-gpioti,am4372-gpiou-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvu-boot,i2c-offset-leni2c-chipi2c_genericTimed out in %s: status=%04x Check if pads/pull-ups of bus are properly configured i2c_probe: pads on bus probably not configured (status=0x%x) I2C read: data len < 0 I2C read: NULL pointer passed I2C read: address out of range i2c_read (data phase): pads on bus probably not configured (status=0x%x) I2C write: data len < 0 I2C write: NULL pointer passed I2C write: address 0x%x + 0x%x out of range i2c_write: error waiting for data ACK (status=0x%x) i2c_write: bus not ready for data Tx (i=%d) i2c_write: timed out writig last byte! Error : I2C initializing first phase clock Error : I2C initializing clock ERROR: Timeout in soft-reset ERROR: failed to setup I2C bus-speed! i2c_omapti,omap3-i2cti,omap4-i2cUnknown modeStatus Error: %#08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd Card did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)userboot0boot1rpmbgp1gp2gp3gp4cap-sd-highspeedcap-mmc-highspeedsd-uhs-sdr12sd-uhs-sdr25sd-uhs-sdr50sd-uhs-sdr104sd-uhs-ddr50mmc-ddr-1_8vmmc-ddr-1_2vmmc-hs200-1_8vmmc-hs200-1_2vmmc-hs400-1_8vmmc-hs400-1_2vmmc-hs400-enhanced-strobeno-mmc-hs400non-removablecd-invertedbroken-cdno-1-8-vMMC Device %d not found %s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed %s: timedout waiting for sysctl %x to clear ti,dual-volt%s: timedout waiting on cmd inhibit to clear %s : timeout: No status update %s: timedout waiting for status! OMAP SD/MMCcd-gpioswp-gpios%s: timedout waiting for cc2! %s: timedout waiting for softresetall! %s: timedout waiting for ics! omap_hsmmcti,omap3-hsmmcti,omap4-hsmmcti,am33xx-hsmmcti,am335-sdhciti,dra7-hsmmc Warning: MTD name "%s" is not unique! drivers/mtd/mtdcore.cBUG at %s:%d/%s()! BUG!%s: unlock failed, writes may not work nand%ddrivers/mtd/nand/raw/nand_bbt.cToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMD/SpansionMacronixEonSanDiskIntelATOUnknownTC58NVG0S3E 1G 3.3V 8-bitTC58NVG2S0F 4G 3.3V 8-bitTC58NVG2S0H 4G 3.3V 8-bitTC58NVG3S0F 8G 3.3V 8-bitTC58NVG5D2 32G 3.3V 8-bitTC58NVG6D2 64G 3.3V 8-bitSDTNQGAMA 64G 3.3V 8-bitSDTNRGAMA 64G 3.3V 8-bitH27UBG8T2BTR-BC 32G 3.3V 8-bitH27UCG8T2ATR-BC 64G 3.3V 8-bitH27QCG8T2E5R-BCF 64G 3.3V 8-bitNAND 4MiB 5V 8-bitNAND 4MiB 3,3V 8-bitNAND 8MiB 3,3V 8-bitNAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitNAND 4GiB 1,8V 8-bitNAND 4GiB 3,3V 8-bitNAND 4GiB 1,8V 16-bitNAND 4GiB 3,3V 16-bitNAND 8GiB 1,8V 8-bitNAND 8GiB 3,3V 8-bitNAND 8GiB 1,8V 16-bitNAND 8GiB 3,3V 16-bitNAND 16GiB 1,8V 8-bitNAND 16GiB 3,3V 8-bitNAND 16GiB 1,8V 16-bitNAND 16GiB 3,3V 16-bitNAND 32GiB 1,8V 8-bitNAND 32GiB 3,3V 8-bitNAND 32GiB 1,8V 16-bitNAND 32GiB 3,3V 16-bitNAND 64GiB 1,8V 8-bitNAND 64GiB 3,3V 8-bitNAND 64GiB 1,8V 16-bitNAND 64GiB 3,3V 16-bitbad blockbbt reservedAttempt to erase non block-aligned data Size of erase exceeds limit Skipping %s at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page-aligned data Attempt to write outside the flash area Size of write exceeds partition or device limit NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read non page-aligned data Attempt to read outside the flash area Size of read exceeds partition or device limit NAND read from offset %llx failed %d Skipping bad block 0x%08llx drivers/mtd/nand/raw/nand_base.cWARNING at %s:%d/%s()! ONFIEPPSJEDECnand-bus-widthnand-is-boot-mediumnand-on-flash-bbtnand-ecc-modesofthwhw_syndromehw_oob_firstsoft_bchnand-ecc-algohammingnand-ecc-strengthnand-ecc-step-sizenand-ecc-maximizeMX30LF1G18ACMX30LF2G18ACMX30LF4G18ACInvalid OOB size valueCould not get ECC infonand: error: invalid bit-flip location nand: error: Unable to find NAND settings in GPMC Configuration - quitting omap-elm%s: uncorrectable ECC errors spi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave jedec,spi-norn25q016an25q032n25q032an25q064n25q064an25q128a11n25q128a13mt25ql256an25q256amt25qu256an25q256ax1mt25qu128abmt25qu512an25q512amt25ql512an25q512ax3n25q00n25q00amt25ql01gmt25qu01gmt25qu02gmt25ql02gmt35xu01gmt35xu02gm25p10m25p20m25p40m25p80m25p16m25p32m25p64m25p128m25pe16m25px16m25px64w25p80w25p16w25p32w25x05w25x40w25x16w25x32w25q20clw25q20bww25q20eww25q32w25q16dww25q32dww25q16jvw25q32jvw25q32jwmw25q256jwmw25x64w25q64dww25q64jvw25q128fww25q128jvw25q128jww25q256fww25q256jww25q512jvw25q512nwqw25q512nwmw25q512jvqw25q01jvw25q01jvfimw25q02jvw25q80w25q80blw25q16clw25q32bvw25q64cvw25q128w25q256w25m512jww25m512jvw25h02jvm25p,fast-readSF: Detected %s with page size , erase size , total (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYqca,keep-pll-enabledvddio-regulatorregulator-min-microvoltregulator-max-microvoltqca,clk-out-frequencyqca,clk-out-strengthAR8035AR8031/AR8033AR8021SMSC LAN8742SMSC LAN8741SMSC LAN8740SMSC LAN8710/LAN8720SMSC LAN911x Internal PHYSMSC LAN8700cpdma_process timeout cpdma_channelserror: cpdma_channels not found in dt slaveserror: slaves not found in dt ale_entrieserror: ale_entries not found in dt bd_ram_sizeerror: bd_ram_size not found in dt mac_controlmode-gpiosactive_slaveerror: phy addr not found in dt error: phy_id read failed max-speedrmii-clock-extlink up on port %d, speed %d, %s duplex link down on port %d error %d submitting rx desc Updated phy address for CPSW#%d, old: %d, new: %d ti,am3352-cpsw-phy-selti,am43xx-cpsw-phy-selti,dra7xx-cpsw-phy-seleth_cpswti,cpswti,am335x-cpswcpsw,am33xxdavinci,emacti,dm8148ti,am33xxti,am3517-emacti,dm816-emacti,am43ti,dra7sysconregulator-nameregulatorstps65217 pmicti,tps65217tps65217_ldostdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uartomap_serialti,omap2-uartti,omap3-uartti,omap4-uartti,am3352-uartti,am4372-uartti,dra742-uartti,am654-uartspi-max-frequencyInvalid bus %d (err=%d) spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported spi_genericomap3_spi: invalid wordlen %d SPI TXS timed out, status=0x%08x SPI RXS timed out, status=0x%08x ti,pindir-d0-out-d1-inomap3_spiti,omap2-mcspiti,omap4-mcspitick-timeromap_timerti,am335x-timerti,am4372-timerti,omap5430-timerti,am654-timerfckickti_syscti,sysc-omap2ti,sysc-omap4ti,sysc-omap4-simpleti,sysc-omap3430-srti,sysc-omap3630-srti,sysc-omap4-srti,sysc-omap3-shamti,sysc-omap-aesti,sysc-mcaspti,sysc-usb-host-fsrsa_mod_expmod_exp_swFAILOKAYfastboot_bootcmd0x%pBooting kernel at %s... 0x%08xN/AU-Boot 2025.01-30.40x%016zxplatformplatform not setBoard not setValue not set_ayesinvalid partition name%s: %sINFOmissing varMOREfastboot.%sVariable not implementedversion-bootloaderdownloadsizemax-download-sizeserialnoversion-basebandproductcurrent-slothas-slotpartition-typepartition-sizeis-userspaceExpected command parameterExpected nonzero image sizeStarting download of %d bytes DATApartitions not setgpt write mmc %x $partitionsCannot set recovery flagCannot set fastboot flagCannot set reboot flagUnsupported commandunrecognized commandUnknown multiresponse commandReceived invalid data length downloading of %d bytes finished getvardownloadrebootreboot-bootloaderreboot-fastbootreboot-recoveryset_activeoem formatoem partconfoem bootbusoem runoem consoleoem boardACmdUCmdinvalid mmc deviceerasingpartition not givenfastboot_partition_alias_fastboot_raw_partition_invalid partition or deviceno such deviceno such partitionunknown partition table typeunanticipated error%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success mbr%s: updating MBR %s: invalid MBR - refusing to write to flash invalid MBR partition%s: writing MBR partition failed writing MBR partition failedzimageFlashing zImage cannot find boot partitioninvalid number of boot sectors: 0cannot read header from boot partitionboot partition not initializedunable to read boot image headerzImage flashing supported only for boot images v2 and lessmoving second stage is not supported yetcannot read ramdisk from boot partitioncannot write back boot image headercannot write new kernelcannot write back original ramdisk........ zImage was updated in boot partition Flashing sparse image at offset %lu too large for partitionFlashing Raw Image failed writing to device........ wrote %lu bytes to '%s' Erasing blocks %lu to %lu due to alignment failed erasing from device........ erased %lu bytes from '%s' misctimeout-sechw_margin_msu-boot,noautostartu-boot,autostartevery %ldmsWDT: Started %s with%s servicing %s (%ds timeout) WDT: Not starting %s WDT: Failed to start %s watchdogomap3_wdtti,omap3-wdtdr_modeutmiutmi_wideulpihsicUNKNOWNlow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusotgtimeout sending packets to usb ethernet USB RNDIS network up! RNDISCDC Ethernet%s speed config #%d: %d mA, %s, using %s de:ad:be:ef:00:01usbnet_devaddrde:ad:be:ef:00:00usbnet_hostaddrmusb-hdrcRNDIS/%sTexas Instruments%02X%02X%02X%02X%02X%02Xusing %s, OUT %s IN %s%s%s STATUS MAC %pM HOST MAC %02x:%02x:%02x:%02x:%02x:%02x RNDIS ready cdc_connect_timeoutusb_etherEthernet DataRNDIS Communications Control!cdev->configcompositeusb_dnload%s: failed!, error: %d DOWNLOAD ... OK Ctrl+C to exit ... f_fastbootstatus: %d ep '%s' trans: %d Error %d on queue Bad status: %d buffer overflowfailed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in No UDC available in the system All UDCs in use (%d available), use the unbind command usb_gadgetusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No USB controllers found usb_dev_genericu-boot,bootdev-usbep%d%s%s %d: SetupEnd came in a wrong ep0stage %s %s %d: SETUP packet len %d != 8 ? %s: peripheral reset irq lost! idlein/statusout/statuswaitUTMI-16UTMI-8musb->config->num_eps <= MUSB_C_NUM_EPS, dyn FIFOs, HB-ISO Rx, HB-ISO Tx, SoftConn%s: kernel must blacklist external hubs %d.%d%sERROR musb int-queues only support queuesize 1 ERROR int-urb is already pending on pipe %lx Failed to enqueue URB to controller MUSB host is not registered Could not flush host TX%d fifo: csr: %04x %s %d: rx%d, packet/%d ready? %s %d: broken !rx_reinit, ep%d csr %04x %s %d: no URB for end 0 %s %d: bogus ep0 stage %d %s %d: Rx interrupt with no errors or packet! usb@ti-musb-peripheralti-musb-hostti,ctrl_modusb%dmentor,multipointmentor,num-epsmentor,ram-bitsmentor,powerti-musb-wrapperti,am33xx-usbenv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %pMmissing environment variable: %s *** Warning - %s, using default environment bad CRCimport failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,dfu_alt_info:dfu_alt_info,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacks00:1Unable to use %s %d:%d... uboot.envUnable to write "%s" from %s%d:%d... Unable to read "%s" from %s%d:%d... ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsunsupported** File not found %s ** part_offset is %lu total_sector is %llu error: overflow occurs no block left to assign No Memory %s: Device read error! no block left assign no block left invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Block full, trying previous All blocks full: Allocate new Directory uses extents Directory exceeds limit no inode left to assign Badly aligned ext2_dirent Invalid path It is a Directory file found, deleting Failed to iterate over directory %s fs uses incompatible features: %08x, ignoring Error in ext4fs_log_gdt Error in getting the block group descriptor table error in File System init Unsupported features found %08x, not writing. Unsupported RO compat features found %08x, not writing. hash tree directory No memory Not enough space on partition !!! Error in copying content ** Cannot support non-zero offset ** ** Error ext4fs_write() ** Invalid input arguments %s buffer ptr is NULL _get_node: malloc failed Journal Recovery Completed Journal Scan Completed Recovery required update journal finished Invalid FAT entry: %#08x FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: FAT%d "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driverDM_TAG_EFI not found /EFI/BOOT/%s1234567Loading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed EFI boot manager: Cannot load any image Can't find %pD specified in Boot#### Can't read fdt Booting %pD Loading image failed Uninstalling protocol interfaces failed Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exitedBOOTARM.EFIneed device tree invalid $fdt_addr or $fdtcontroladdr invalid device tree Failed to reserve space for FDT failed to process device tree failed to install device tree failed to set watchdog timer ## Application failed, r = %lu ## %ls [?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMSReserved memory mapping failed addr %llx size %llx kaslr-seedError deleting %s rng-seed%s/%sboardver%s/%s%s%s%s.dtb/dtb/dtb/current/dtbs///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed Cannot persist EFI variables without system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event Disk %s not ready Adding block device %s failed, r = %lu Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### installing EFI_LOAD_FILE2_PROTOCOL failed Creating event failed Failed to install ECPT linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellstargettarget-path/__local_fixups__/__fixups__/__overlay__//__overlay__manufacturerasset-tagskufamily01/01/2025_SM3_biosbaseboardchassis%s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!Malloc failed for: CHUNK_TYPE_RAW%s: Write failed, block #%lu [%lu] flash write failure(incomplete)Bogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILLWrite failed, block #%s: %s %lu [%d] flash write failureBogus chunk size for chunk type CRC32%s: Unknown chunk type: %x Unknown chunk type........ wrote %llu bytes to '%s' sparse image write failureevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency rsa,num-bitsrsa,n0-inversersa,exponentrsa,modulusrsa,r-squaredRSA: Can't find Modular Exp implementation key-%srsa4096rsa3072rsa2048invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d No valid device tree binary found at %p okayseparateembedbloblistnvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.count = %#x %s[%d] [%#llx-%#llx], %#llx bytes, flags: invalid %#x %s: LMB Map notify failure %lu This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. Unable to init LMB no-overwriteno-notifyRE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\Could not initialize timer (err %d) Could not read count from timer (err %d) %s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again once ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octettsize%c%u%cblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Error: %s No valid MAC address found. ethactethrotateethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskip[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead For the new multi component uImage format (FIT) addresses must be extended to include component or configuration unit name: addr: - direct component image specification addr# - configuration specification Use iminfo command to get the list of existing component images and configurations. Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead $demo - register cyclic demo function cyclic list - list cyclic functions bootcmd=run findfdt; run init_console; run finduuid; run distro_bootcmdbootdelay=2baudrate=115200loadaddr=0x82000000arch=armcpu=armv7board=am335xboard_name=am335xvendor=tisoc=am33xxusb_ignorelist=mtdids=nand0=nand.0mtdparts=mtdparts=nand.0:128k(NAND.SPL),128k(NAND.SPL.backup1),128k(NAND.SPL.backup2),128k(NAND.SPL.backup3),256k(NAND.u-boot-spl-os),1m(NAND.u-boot),128k(NAND.u-boot-env),128k(NAND.u-boot-env.backup1),8m(NAND.kernel),-(NAND.file-system)loadaddr=0x82000000kernel_addr_r=0x82000000fdtaddr=0x88000000dtboaddr=0x89000000fdt_addr_r=0x88000000fdtoverlay_addr_r=0x89000000rdaddr=0x88080000ramdisk_addr_r=0x88080000scriptaddr=0x80000000pxefile_addr_r=0x80100000bootm_size=0x10000000boot_fdt=tryfdtfile=undefinedfinduuid=part uuid mmc 0:2 uuidconsole=ttyO0,115200n8partitions=uuid_disk=${uuid_gpt_disk};name=bootloader,start=384K,size=1792K,uuid=${uuid_gpt_bootloader};name=rootfs,start=2688K,size=-,uuid=${uuid_gpt_rootfs}optargs=ramroot=/dev/ram0 rwramrootfstype=ext2spiroot=/dev/mtdblock4 rwspirootfstype=jffs2spisrcaddr=0xe0000spiimgsize=0x362000spibusno=0spiargs=setenv bootargs console=${console} ${optargs} root=${spiroot} rootfstype=${spirootfstype}ramargs=setenv bootargs console=${console} ${optargs} root=${ramroot} rootfstype=${ramrootfstype}loadramdisk=load mmc ${mmcdev} ${rdaddr} ramdisk.gzspiboot=echo Booting from spi ...; run spiargs; sf probe ${spibusno}:0; sf read ${loadaddr} ${spisrcaddr} ${spiimgsize}; bootz ${loadaddr}ramboot=echo Booting from ramdisk ...; run ramargs; bootz ${loadaddr} ${rdaddr} ${fdtaddr}findfdt=if test $board_name = A335BONE; then setenv fdtfile am335x-bone.dtb; fi; if test $board_name = A335BNLT; then setenv fdtfile am335x-boneblack.dtb; fi; if test $board_name = A335PBGL; then setenv fdtfile am335x-pocketbeagle.dtb; fi; if test $board_name = BBBW; then setenv fdtfile am335x-boneblack-wireless.dtb; fi; if test $board_name = BBG1; then setenv fdtfile am335x-bonegreen.dtb; fi; if test $board_name = BBGW; then setenv fdtfile am335x-bonegreen-wireless.dtb; fi; if test $board_name = BBBL; then setenv fdtfile am335x-boneblue.dtb; fi; if test $board_name = BBEN; then setenv fdtfile am335x-sancloud-bbe.dtb; fi; if test $board_name = BBELITE; then setenv fdtfile am335x-sancloud-bbe-lite.dtb; fi; if test $board_name = BBE_EX_WIFI; then setenv fdtfile am335x-sancloud-bbe-extended-wifi.dtb; fi; if test $board_name = A33515BB; then setenv fdtfile am335x-evm.dtb; fi; if test $board_name = A335X_SK; then setenv fdtfile am335x-evmsk.dtb; fi; if test $board_name = A335_ICE; then setenv fdtfile am335x-icev2.dtb; if test $ice_mii = mii; then setenv pxe_label_override Pruss; fi;fi; if test $fdtfile = undefined; then echo WARNING: Could not determine device tree to use; fi; init_console=if test $board_name = A335_ICE; then setenv console ttyO3,115200n8;else setenv console ttyO0,115200n8;fi;nandargs=setenv bootargs console=${console} ${optargs} root=${nandroot} rootfstype=${nandrootfstype}nandroot=ubi0:rootfs rw ubi.mtd=NAND.file-system,2048nandrootfstype=ubifs rootwaitnandboot=echo Booting from nand ...; run nandargs; nand read ${fdtaddr} NAND.u-boot-spl-os; nand read ${loadaddr} NAND.kernel; bootz ${loadaddr} - ${fdtaddr}static_ip=${ipaddr}:${serverip}:${gatewayip}:${netmask}:${hostname}::offnfsopts=nolockrootpath=/export/rootfsnetloadimage=tftp ${loadaddr} ${bootfile}netloadfdt=tftp ${fdtaddr} ${fdtfile}netargs=setenv bootargs console=${console} ${optargs} root=/dev/nfs nfsroot=${serverip}:${rootpath},${nfsopts} rw ip=dhcpnetboot=echo Booting from network ...; setenv autoload no; dhcp; run netloadimage; run netloadfdt; run netargs; bootz ${loadaddr} - ${fdtaddr}dfu_alt_info_emmc=rawemmc raw 0 3751936;boot part 1 1;rootfs part 1 2;MLO fat 1 1;MLO.raw raw 0x100 0x200;u-boot.img.raw raw 0x300 0x1000;u-env.raw raw 0x1300 0x200;spl-os-args.raw raw 0x1500 0x200;spl-os-image.raw raw 0x1700 0x6900;spl-os-args fat 1 1;spl-os-image fat 1 1;u-boot.img fat 1 1;uEnv.txt fat 1 1dfu_alt_info_mmc=boot part 0 1;rootfs part 0 2;MLO fat 0 1;MLO.raw raw 0x100 0x200;u-boot.img.raw raw 0x300 0x1000;u-env.raw raw 0x1300 0x200;spl-os-args.raw raw 0x1500 0x200;spl-os-image.raw raw 0x1700 0x6900;spl-os-args fat 0 1;spl-os-image fat 0 1;u-boot.img fat 0 1;uEnv.txt fat 0 1dfu_alt_info_ram=kernel ram 0x80200000 0x4000000;fdt ram 0x80f80000 0x80000;ramdisk ram 0x81000000 0x4000000dfu_alt_info_nand=SPL part 0 1;SPL.backup1 part 0 2;SPL.backup2 part 0 3;SPL.backup3 part 0 4;u-boot part 0 5;u-boot-spl-os part 0 6;kernel part 0 8;rootfs part 0 9mmc_boot=if mmc dev ${devnum}; then devtype=mmc; run scan_dev_for_boot_part; fiboot_net_usb_start=usb startusb_boot=usb start; if usb dev ${devnum}; then devtype=usb; run scan_dev_for_boot_part; fiboot_efi_bootmgr=if fdt addr -q ${fdt_addr_r}; then bootefi bootmgr ${fdt_addr_r};else bootefi bootmgr;fiboot_efi_binary=load ${devtype} ${devnum}:${distro_bootpart} ${kernel_addr_r} efi/boot/bootarm.efi; if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r};else bootefi ${kernel_addr_r} ${fdtcontroladdr};fiload_efi_dtb=load ${devtype} ${devnum}:${distro_bootpart} ${fdt_addr_r} ${prefix}${efi_fdtfile}efi_dtb_prefixes=/ /dtb/ /dtb/current/scan_dev_for_efi=setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; run extension_init; for prefix in ${efi_dtb_prefixes}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${efi_fdtfile}; then run load_efi_dtb; run extension_apply; fi;done;run boot_efi_bootmgr;if test -e ${devtype} ${devnum}:${distro_bootpart} efi/boot/bootarm.efi; then echo Found EFI removable media binary efi/boot/bootarm.efi; run boot_efi_binary; echo EFI LOAD FAILED: continuing...; fi; setenv efi_fdtfileextension_init=echo Extension init...; if ${extension_need_init}; then extension_need_init=false; extension scan; fiextension_overlay_cmd=load ${devtype} ${devnum}:${distro_bootpart} ${extension_overlay_addr} ${prefix}${extension_overlay_name}extension_apply=if fdt addr -q ${fdt_addr_r}; then extension apply all; fiboot_prefixes=/ /boot/boot_scripts=boot.scr.uimg boot.scrboot_script_dhcp=boot.scr.uimgboot_targets=mmc0 mmc1 nand0 usb0 pxe dhcp boot_syslinux_conf=extlinux/extlinux.confboot_extlinux=sysboot ${devtype} ${devnum}:${distro_bootpart} any ${scriptaddr} ${prefix}${boot_syslinux_conf}scan_dev_for_extlinux=if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${boot_syslinux_conf}; then echo Found ${prefix}${boot_syslinux_conf}; run boot_extlinux; echo EXTLINUX FAILED: continuing...; fiboot_a_script=load ${devtype} ${devnum}:${distro_bootpart} ${scriptaddr} ${prefix}${script}; source ${scriptaddr}scan_dev_for_scripts=for script in ${boot_scripts}; do if test -e ${devtype} ${devnum}:${distro_bootpart} ${prefix}${script}; then echo Found U-Boot script ${prefix}${script}; run boot_a_script; echo SCRIPT FAILED: continuing...; fi; donescan_dev_for_boot=echo Scanning ${devtype} ${devnum}:${distro_bootpart}...; for prefix in ${boot_prefixes}; do run scan_dev_for_extlinux; run scan_dev_for_scripts; done;run scan_dev_for_efi;scan_dev_for_boot_part=part list ${devtype} ${devnum} -bootable devplist; env exists devplist || setenv devplist 1; for distro_bootpart in ${devplist}; do if fstype ${devtype} ${devnum}:${distro_bootpart} bootfstype; then part uuid ${devtype} ${devnum}:${distro_bootpart} distro_bootpart_uuid ; run scan_dev_for_boot; fi; done; setenv devplistbootcmd_mmc0=devnum=0; run mmc_bootbootcmd_mmc1=devnum=1; run mmc_bootbootcmd_nand=run nandbootbootcmd_usb0=devnum=0; run usb_bootbootcmd_pxe=run boot_net_usb_start; dhcp; if pxe get; then pxe boot; fibootcmd_dhcp=devtype=dhcp; run boot_net_usb_start; if dhcp ${scriptaddr} ${boot_script_dhcp}; then source ${scriptaddr}; fi;setenv efi_fdtfile ${fdtfile}; if test -z "${fdtfile}" -a -n "${soc}"; then setenv efi_fdtfile ${soc}-${board}${boardver}.dtb; fi; setenv efi_old_vci ${bootp_vci};setenv efi_old_arch ${bootp_arch};setenv bootp_vci PXEClient:Arch:00010:UNDI:003000;setenv bootp_arch 0xa;if dhcp ${kernel_addr_r}; then tftpboot ${fdt_addr_r} dtb/${efi_fdtfile};if fdt addr -q ${fdt_addr_r}; then bootefi ${kernel_addr_r} ${fdt_addr_r}; else bootefi ${kernel_addr_r} ${fdtcontroladdr};fi;fi;setenv bootp_vci ${efi_old_vci};setenv bootp_arch ${efi_old_arch};setenv efi_fdtfile;setenv efi_old_arch;setenv efi_old_vci;distro_bootcmd=extension_need_init=; setenv extension_overlay_addr ${fdtoverlay_addr_r}; for target in ${boot_targets}; do run bootcmd_${target}; done !Device Firmware Upgrade0123456789ABCDEFcompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1hEthernet Gadgetarocsdxbimask name [message] [size] - ask for environment variable env default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...]  Android Fastbootaddr [-c] [-q] [] - Set the [control] fdt location to fdt apply - Apply overlay to the DT fdt boardsetup - Do board-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size fdt checksign [] - check FIT signature - address of key blob default gd->fdt_blob NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.$0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to addr uname [dest] - extract subimage from FIT image at and copy to LZO  Texas Instruments - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand'|'spi-nand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel) #(-27][:[]|#[]] - Run script starting at addr - A FIT config name or subimage name may be specified with : or # (like bootm). If the image or config name is omitted, the default is used. !R\248>Ž ;QQ:D@y݁>QQ򪆀y݁DQQi݁]JQQD#i݁HQQ갆!ުi݁QQ8i݁QQĆi݁QQMJ48JJJ2i݁oQQƆi݁oQQhi݁ pQQi݁pQQai݁qqQQ;';І8@ІEІ 4JІNІ TІ   ZІ IMЁ˗eAחϗU%Q]ߗӗՁ(ۗJ풁×풁풁Ǘ풁ᖁɖ풁E 풁Ձ]re!풁u㗁痁'풁q풁 뗁a$$,,44<.N0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N()*+,-./0123456789:;<=>?&!&5&%& 뇀ᦈ 쇀 ͦ+ 9Ethernet Gadget9퇀m[쇀v쇀쇀9퇀  9퇀m[퇀v퇀 퇀9퇀@@    %8퇀x퇀qf퇀 퇀ގ2QQ"ggMi5fYff5fMSFT100퇀  }  8 @whnh0 B@@WINUSB?{4866319A-F4D6-4374-93B9-DC2DEB361BA9}DeviceInterfaceGUIDTT@                  @  @  @ M 塃9ƒI- ʃ())/y-}-y,,c-/1ǃ<уʃyуу փeeуЃQԃaуǃǃ(eǃkǃqǃǃuǃǃ{ǃǃ}ǃǃǃǃBOOTSERVdKP_KCKKKJN-QOEM=JO)UdbIf)IS1Y]Vadife-L JaOI^[ZXURS YQcwdIIINddppxx-n%s nsmUoo󇀨m1nmom5m mlylPP2((00881a2b>nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ Ņ8(ąm H$~m@i݁C^~i݁c~~Ni݁NQPy݁uPQ$Ry݁y-RQRD#i݁xJQrJi݁xJQRy݁R S%_@y݁Հ-_N_M@݁MT}†@i݁JCTi݁ < ^y݁iր^^@i݁SYGy݁&NvDi݁HWxSi݁SQ2i݁]vwi݁~~T@5݁T"[=Ć@i݁eĆĆ2i݁~_i݁؀_Qlby݁؀ubbBci݁؀``_y݁؀__`i݁؀``,ay݁؀5aMaai݁؀aajVi݁tVV@i݁U@i݁a>ei݁-ـFeie0fy݁ـ8f_fei݁ـ`eci݁ـccdi݁ـd'dhy݁ـ5aMa{dy݁ـdd8y݁-ۀmJni݁怀Qnkn"ni݁怀*nQv@i݁mG#Hy݁i瀀>uZuȆ@i݁kȆȆJ@i݁JKi݁退w%gI@i݁InIIQ†i݁bZ†#wy݁}x&xni݁怀nopby݁怀qq|y݁y |s{:|y݁@|d|Ezy݁y{s{yy݁yC{s{wi݁~7~6i݁怀`oai݁:Ili݁m qꆀi݁˂wi݁9i݁] y݁yȐِ𕆀y݁'*wi݁mjE@i݁u/ԣ#i݁-i݁<wi݁KrKi݁xKK@i݁Fƫ櫆?i݁ :Dk @i݁nx͆͆é@i݁%?̩詆Yفv4i݁HLhȀ@i݁JQ}y݁}}Gy݁5GGE@i݁Ձ=YفApy݁怀Fp`py݁I>Qէ@y݁> #Yفi݁Jφ@i݁A~φφMy݁怀5as`i݁ f8My݁񬀀?M?ꆀi݁d<ÆNÆi݁-Qi݁Rw@i݁ U6Ѥi݁<ڤ@y݁Tʶݶ@i݁ UⶆPy݁uP8P i݁^󼆀ļi݁]̼ἆKi݁թKQB}B}B}ᆀSӅ4مl4؅s4օo؞Y4مo3Ӆjjj0[熀Ӆ ԅ憀 ԅ-(0ԅ憀ԅ7熀ԅЭ/28օ2&(օQ@مą% (Յ e\Յ$!(!Y%RRp 憀Pԅ(`ԅu2⅀]W?W ۅ8څ6⅀]c_ ㅀr酀󂀍酀yyey߅߅y~ In l`ᅀ=,) ᅀq$⅀88<⅀"`⅀Lp⅀H⅀eɁ<,⅀ l(ㅀ=,e, ᅀ{hㅀ:w:ㅀ [E&뇀熀熀mڅls!~ᶃd(,! Ŷ(,&"GM熀m$m9;%;::HنP_d׆ نB58نFڅդ) 8'ц(&ăMM솀9u$fVyD-HpN q]Nųᆀƃƃ-!i ȳ ĆEsRzC5ↀi󁀡"冀@9%톀@ @MS  tM}  rM}               0    2 2\a 33$c熀I4&57L7(e2NGOO6)YXE\q]8cG$HI熀LLS [a$熀v l'&熀mU/ q$9-11- $sr{]9G9 ~$E@ $׆$D@ $نBIX0ۅtޅ              x    \dh48D H       $(,048tx|$ (  PTX\`DHLPT <d,Px p ! !!!!! !$!(!!!!H"L"x"##$ $p$t$x$%%%%%%%%%%%H'L'P'T'\'`'h'l'p't'x'|''''8)<)@)D)H)L)P)T)X)\)`)d)h)p)t)x)|)))))))))(*0*8*@*++++,,,,,,,,,..................11111111222 2222(282T22222T3|444444444L5P5T5X5\5555(6,6064686x6687<7@7888<9h9999;<<< <<<<< <$<(<,<0<4<8<<<@<D< ?$?(?,?0?4?8?@>D>>?? ???AAA A$A(A,A0A4AlBpBtB|BBBBXCCDDDEEEEEFFFHHH HHHHH H$H(H,H0H4H8H<>@>D>??????????????????l@p@t@x@@@,A0A4A\AAAAAABdBBBCDDDDDDDDEEEEE(F,F0F4F8F>|>>>>? ???????????????@@p@t@x@|@@@@@@@@@A,APAAAAAAAA@BDBHBLB|BBBBBBB C$C(CDDDDDDDDDDDDGGGGGGGGGGGGGGGGGGHH HHHHH H$H(HHHHHHHIIIIIIJJJ JJJJJTKXKLLDNNhPPP4Q RRRRPSTS|STTTUUUUUUXXXXXXXXXXXXXXXXXXXYYYYYYYYZZZ ZZ\\\\\\\\\\\\\\\\\\\\\\\\\\\\\]]^^^D^|^^^^_``````````````````````ablcccccddddxeTfffgggii iDiHi@lDlhoqqqqqqrrrrrrrrs ssssssssssssssltpttTvXv\v`vdvwwxx|y8zzzzz{{{ {{p{||||||||||||}}}T}X}}}}}}<~@~8<@DHLPTX\`d $(,048<@D聃Hlptx|ȇ̇Їԇ |쌃􌃀葃쑃ĠȠ̠РԠؠܠࠃ䠃蠃젃ࡃ0l$(,0$(,08\4P(,0\`Իػܻ 88<@DHL\`dhl较Ŀȿ48<@lpƒƒƒƒƒTăXă\ădăhălăpăăăăăăăă<ŃŃŃŃŃŃŃŃŃƃƃƃƃTǃXǃ\ǃ`ǃǃǃǃDȃHȃLȃPȃTȃȃȃȃȃȃȃȃ Ƀ0ɃpɃɃɃʃʃʃ ʃXʃ\ʃʃʃʃʃ˃˃$˃D˃x˃|˃˃̓̓̓̓̓̓̓̓̓̓̓̓̓̓̓΃σσσ σ$σpσtσσHЃLЃPЃTЃXЃЃЃ\уууLԃՃփփXփ؃؃؃ ؃؃؃8كك܃܃,߃0߃⃀⃀⃀ ⃀$⃀⃀䃀惀惀惀惀惀惀惀惀惀惀惀惀惀惀惀8郀<郀@郀D郀H郀L郀P郀T郀X郀\郀`郀d郀t냀x냀|냀냀냀냀냀냀냀`샀d샀@DHLPTX\`<@ $L(, $(,048$(<@TX\``dhlphlptPTX\`             $40PTX\PX         $$$'(','((((((P,T,-/////11111111@4H4L4P4T4X4\4`4d4h4555556 667<77788888888990:4:8:@:D:H:::8<@<D<H<L<P<`=d=h=l=t=x=l?p?t?x?|???????d@h@l@p@x@|@@@@@@@\A`AAAAA D$D0D4D8D|EEEEEEEEEEEEEFFFF@GDGHGLGPGTGXG\GGGHDHHHLHpHtHHH$I|I4JJKKK(LM M$M(M,M0M4Mclock@0 ti,clkctrl#=clock@18 ti,clkctrl#<clock@14c ti,clkctrlL#clock@400 ti,omap4-cm+ clock@0 ti,clkctrl$#clock@14 ti,clkctrl#clock@b0 ti,clkctrl#clock@600 ti,omap4-cm+ clock@0 ti,clkctrl#clock@800 ti,omap4-cm+ clock@0 ti,clkctrl#/clock@900 ti,omap4-cm +  clock@0 ti,clkctrl#^clock@a00 ti,omap4-cm +  clock@0 ti,clkctrl$#prm@c00!ti,am3-prm-instti,omap-prm-inst ?prm@d00!ti,am3-prm-instti,omap-prm-inst prm@f00!ti,am3-prm-instti,omap-prm-instprm@1100!ti,am3-prm-instti,omap-prm-inst_target-module@3000ti,sysc disabled+ 0target-module@5000ti,sysc disabled+ Ptarget-module@7000ti,sysc-omap2ti,syscppqrevsyscsyss fckdbclk+ pgpio@0ti,omap4-gpio R 4 ^ G  l I    J Q  `Ptarget-module@9000ti,sysc-omap2ti,syscPTXrevsyscsyss fck+ serial@0ti,am3352-uartti,omap3-uart0lHokay!!txrx)default7"target-module@b000ti,sysc-omap2ti,syscrevsyscsyss fck+ target-module@d000ti,sysc-omap4ti,sysc revsysc fck+tscadc@0ti,am3359-tscadcokay!5!9 fifo0fifo1tscti,am3359-tscAJ`w"3adcti,am3359-adctarget-module@10000ti,sysc-omap4ti,syscrev+scm@0ti,am3-scmsimple-bus +  pinmux@800pinctrl-single8 )default 7#$% matrix_keypad_s0<TXd h l #volume_keys_s0P T $pinmux_i2c0_pins00Hpinmux_i2c1_pinsX0\0Jpinmux_uart0_pinsp0t"pinmux_uart1_pins0x(|01pinmux_clkout2_pin %nandflash_pins_s0000 00000p0t0|\backlight_pins d8cpsw_default  $(,0 4 8 < @ Wcpsw_sleep    $ ( , 0 4 8 < @ Xdavinci_mdio_defaultH0LYdavinci_mdio_sleepH L Zpinmux_mmc1_pins `(Opinmux_mmc3_pinsHD0H0L0x000Epinmux_wlan_pins$@(Flcd_pins_s0P $(,048<bmcasp1_pins0  D 3dcan1_pins_defaulthl 7scm_conf@0sysconsimple-bus+ phy-gmii-selti,am3352-phy-gmii-selPclocks+ simple-busclock-sys-clkin-22@40# ti,mux-clock&'()@ clock-adc-tsc-fck#fixed-factor-clock bmclock-dcan0-fck#fixed-factor-clock bm5clock-dcan1-fck#fixed-factor-clock bm6clock-mcasp0-fck#fixed-factor-clock bmclock-mcasp1-fck#fixed-factor-clock bmclock-smartreflex0-fck#fixed-factor-clock bmclock-smartreflex1-fck#fixed-factor-clock bmclock-sha0-fck#fixed-factor-clock bmclock-aes0-fck#fixed-factor-clock bmclock-rng-fck#fixed-factor-clock bmehrpwm0_tbclk@44e10664#ti,gate-clock*d9ehrpwm1_tbclk@44e10664#ti,gate-clock*d:ehrpwm2_tbclk@44e10664#ti,gate-clock*d;wkup_m3_ipc@1324ti,am3352-wkup-m3-ipc$$N!+*,-dma-router@f90ti,am335x-edma-crossbar@1< I!Mclockdomainstarget-module@31000ti,sysc-omap2-timerti,syscrevsyscsyss  fck+ timer@0ti,am335x-timer-1msCU.fcktarget-module@33000ti,sysc disabled+ 0target-module@35000ti,sysc-omap2ti,syscPPPrevsyscsyss" fck+ Ptarget-module@37000ti,sysc disabled+ ptarget-module@39000ti,sysc disabled+ target-module@3e000ti,sysc-omap4-simpleti,sysctx revsysc /fck+ rtc@0ti,am3352-rtcti,da830-rtcKLext-clkint-clktarget-module@40000ti,sysc disabled+ interconnect@48000000ti,am33xx-l4-persimple-bus0HHHHHHaplaia0ia1ia2ia3+HHH H 0H0FF@F@F@@segment@0 simple-bus+``pp  00@@PP @@PP   00@@PP``pp            FF@F@F@@target-module@8000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@16000ti,sysc disabled+ `target-module@22000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 04fck+  serial@0ti,am3352-uartti,omap3-uart0lIokay!!txrx)default71target-module@24000ti,sysc-omap2ti,sysc@P@T@Xrevsyscsyss 08fck+ @serial@0ti,am3352-uartti,omap3-uart0lJ disabled!!txrxtarget-module@2a000ti,sysc-omap2ti,syscrevsyscsyss 0fck+ target-module@30000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ spi@0ti,omap4-mcspi+Ad0!!!!tx0rx0tx1rx1 disabledtarget-module@38000ti,sysc-omap4-simpleti,sysc revsysc  2fck+ FF@mcasp@0ti,am33xx-mcasp-audio F@mpudatPQrtxrx disabled!! txrxtarget-module@3c000ti,sysc-omap4-simpleti,sysc revsysc  2Lfck+ F@F@@mcasp@0ti,am33xx-mcasp-audio F@@mpudatRSrtxrxokay! ! txrx)default73  dtarget-module@40000ti,sysc-omap4-timerti,syscrevsyscsyss 0Hfck+ timer@0ti,am335x-timerD4fcktarget-module@42000ti,sysc-omap4-timerti,sysc   revsyscsyss 0Lfck+  timer@0ti,am335x-timerEtarget-module@44000ti,sysc-omap4-timerti,sysc@@@revsyscsyss 0Pfck+ @timer@0ti,am335x-timer\target-module@46000ti,sysc-omap4-timerti,sysc```revsyscsyss 0fck+ `timer@0ti,am335x-timer]target-module@48000ti,sysc-omap4-timerti,syscrevsyscsyss 0fck+ timer@0ti,am335x-timer^target-module@4a000ti,sysc-omap4-timerti,syscrevsyscsyss 0Dfck+ timer@0ti,am335x-timer_target-module@4c000ti,sysc-omap2ti,syscrevsyscsyss0t0t fckdbclk+ gpio@0ti,omap4-gpio@  Z   b`target-module@50000ti,sysc disabled+  target-module@60000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ target-module@80000ti,sysc-omap2ti,syscrevsyscsyss  0fck+ elm@0ti,am3352-elm okay]target-module@a0000ti,sysc disabled+  target-module@c8000ti,sysc-omap4ti,sysc   revsysc  0fck+  mailbox@0ti,omap4-mailboxM,mbox-wkup-m3  -target-module@ca000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  spinlock@0ti,omap4-hwspinlocktarget-module@cc000ti,sysc disabled+  segment@100000 simple-bus+h   `` pp                     00 @@ PPtarget-module@8c000ti,sysc disabled+ target-module@8e000ti,sysc disabled+ target-module@9c000ti,sysc-omap2ti,sysc   revsyscsyss 0 fck+  target-module@a0000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  spi@0ti,omap4-mcspi+}d0!*!+!,!-tx0rx0tx1rx1 disabledtarget-module@a2000ti,sysc disabled+  target-module@a4000ti,sysc disabled+  @target-module@a6000ti,sysc-omap2ti,sysc `P `T `Xrevsyscsyss 0<fck+  `serial@0ti,am3352-uartti,omap3-uart0l, disabledtarget-module@a8000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 0@fck+  serial@0ti,am3352-uartti,omap3-uart0l- disabledtarget-module@aa000ti,sysc-omap2ti,sysc P T Xrevsyscsyss 0fck+  serial@0ti,am3352-uartti,omap3-uart0l. disabledtarget-module@ac000ti,sysc-omap2ti,sysc   revsyscsyss0x0x fckdbclk+  gpio@0ti,omap4-gpio0 " M 8   target-module@ae000ti,sysc-omap2ti,sysc   revsyscsyss0|0| fckdbclk+  gpio@0ti,omap4-gpioP B b K  d >Gtarget-module@b0000ti,sysc disabled+  target-module@cc000ti,sysc-omap4ti,sysc rev05fckosc+  can@0ti,am3352-d_can 5fck )D4 disabledtarget-module@d0000ti,sysc-omap4ti,sysc rev06fckosc+  can@0ti,am3352-d_can 6fck )D7 disabled)default77target-module@d8000ti,sysc-omap2ti,sysc   revsyscsyss  0fck+  segment@200000 simple-bus+segment@300000 simple-bus+00 0 000@0@P0P001@11  1 P1P`1`p1p010@1@22 2 020@2@P2Ptarget-module@0ti,sysc-omap4ti,sysc revsysc8 0fck+ epwmss@0ti,am33xx-pwmss+okay pwm@100ti,am3352-ecapti,am33xx-ecapF*fckrecap0okay)default78acounter@180ti,am3352-eqep* sysclkoutO disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF9* tbclkfck disabledtarget-module@2000ti,sysc-omap4ti,sysc   revsysc8 0fck+  epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecapF*fck/recap1 disabledcounter@180ti,am3352-eqep* sysclkoutX disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF:* tbclkfck disabledtarget-module@4000ti,sysc-omap4ti,sysc@@ revsysc8 0fck+ @epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecapF*fck=recap2 disabledcounter@180ti,am3352-eqep* sysclkoutY disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwmF;* tbclkfck disabledtarget-module@e000ti,sysc-omap4ti,syscT revsysc 8  <fck+ lcdc@0ti,am33xx-tilcdc$okaytarget-module@10000ti,sysc-omap2ti,sysc revsysc 0Xfck+  rng@0 ti,omap4-rng otarget-module@13000ti,sysc disabled+ 0target-module@15000ti,sysc disabled+P`target-module@18000ti,sysc disabled+ @target-module@20000ti,sysc disabled+ target-module@22000ti,sysc disabled+  target-module@24000ti,sysc disabled+ @interconnect@47c00000ti,am33xx-l4-fwsimple-busGGG aplaia0+ Gsegment@0 simple-bus+@@PP``pp``pp@@PP  00  00@@PPtarget-module@c000ti,sysc disabled+ target-module@e000ti,sysc disabled+ target-module@10000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@1a000ti,sysc disabled+ target-module@24000ti,sysc disabled+ @target-module@26000ti,sysc disabled+ `target-module@28000ti,sysc disabled+ target-module@30000ti,sysc disabled+ target-module@32000ti,sysc disabled+  target-module@38000ti,sysc disabled+ target-module@3a000ti,sysc disabled+ target-module@3c000ti,sysc disabled+ target-module@3e000ti,sysc disabled+ target-module@40000ti,sysc disabled+ target-module@42000ti,sysc disabled+  target-module@44000ti,sysc disabled+ @target-module@46000ti,sysc disabled+ `interconnect@4a000000ti,am33xx-l4-fastsimple-busJJJ aplaia0+ Jsegment@0 simple-bus+ ((0088target-module@100000ti,sysc-omap4-simpleti,syscrevsyscsyss8 =fck+ target-module@180000ti,sysc disabled+ target-module@200000ti,sysc disabled+  target-module@300000ti,sysc-prussti,sysc2`2` revsysc0 8  >fckQ?Xrstctrl+ 0 disabledinterconnect@4b140000ti,am33xx-l4-mpusssimple-busKDKHlaap+ Ksegment@0 simple-bus+`HH @@PP00target-module@0ti,sysc disabled+$ target-module@3000ti,sysc disabled+ 0interrupt-controller@48200000ti,am33xx-intc H target-module@49000000ti,sysc-omap4ti,syscIrev @fck+ Idma@0ti,edma3-tpcc edma3_cc  'redma3_ccintedma3_mperredma3_ccerrint<@1dABCm  !target-module@49800000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcpredma3_tcerrintAtarget-module@49900000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcqredma3_tcerrintBtarget-module@49a00000ti,sysc-omap4ti,syscII revsysc8 @fck+ Idma@0ti,edma3-tptcrredma3_tcerrintCtarget-module@47810000ti,sysc-omap2ti,syscGGGrevsyscsyss  2fck+ Gmmc@0ti,am335-sdhci disabled! ! txrxD)default7EF +wlcore@0 ti,wl1835 Gi2c@44e0b000 ti,omap4-i2c+i2c1DFokay)default7H0tps@2d- ti,tps65910 I,I8IDIPI\IhItIregulators+regulator@0vrtcregulator@1vioregulator@2vdd1vdd_mpu tregulator@3vdd2 vdd_core t0regulator@4vdd3regulator@5vdig1regulator@6vdig2regulator@7vpllregulator@8vdacregulator@9 vaux1regulator@10 vaux2Lregulator@11 vaux33regulator@12 vmmcw@2ZNregulator@13 vbbi2c@4802a000 ti,omap4-i2c+i2c2HGokay)default7J0lis331dlh@18st,lis331dlhst,lis3lv02dKK&8J \ n xx#&2&Atsl2550@39 taos,tsl25509tmp275@48 ti,tmp275Htlv320aic3106@1bti,tlv320aic3106okayPL\LiLvIci2c@4819c000 ti,omap4-i2c+i2c3H disabledmmc@48060000ti,omap4-hsmmcmmc1 MMtxrx@HokayN)default7O Pmmc@481d8000ti,omap4-hsmmcmmc2!!txrxH disabledwdt@44e35000 ti,omap3-wdt wd_timer2DP[usb@47400000ti,am33xx-usbG@+ usb_otg_hsokaycontrol@44e10620ti,am335x-usb-ctrl-moduleD DHphy_ctrlwakeupokayQusb-phy@47401300ti,am335x-usb-phyG@phyQokayRusb@47401000ti,musb-am33xxG@G@ mccontrolrmc peripheral RhSSSSSSSSSS S S S S SSSSSSSSSSS S S S S Srx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15okayusb-phy@47401b00ti,am335x-usb-phyG@phyQokayTusb@47401800ti,musb-am33xxG@G@ mccontrolrmchost ThSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSrx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15okaydma-controller@2000ti,am3359-cppi41  0@@#gluecontrollerschedulerqueuemgrrglue1okaySethernet@4a100000ti,am335x-cpswti,cpswcpgmac0UV fckcpts   &  2  > E R bJJ+()*+okay)defaultsleep7W sXmdio@4a101000ti,cpsw-mdioti,davinci_mdio+ davinci_mdio }B@Jokay)defaultsleep7Y sZethernet-phy@0[slave@4a100200  [ rgmii-idslave@4a100300 cpsw-phy-sel@44e10650ti,am3352-cpsw-phy-selDP gmii-selsram@40300000 mmio-sram@0 @0+pm-code-sram@0ti,sram pm-data-sram@1000ti,sram emif@4c000000ti,emif-am3352Lemife gpmc@50000000ti,am3352-gpmcgpmc P d !4rxtx  + okay)default7\nand@0,0  bch8 ]   / @ N, `, r " ,  (  6 @ R R true $true 7 N h  ( +partition@0 NAND.SPLpartition@1 NAND.SPL.backup1partition@2 NAND.SPL.backup2partition@3 NAND.SPL.backup3partition@4 NAND.u-boot-spl-ospartition@5 NAND.u-boot partition@6 NAND.u-boot-envpartition@7 NAND.u-boot-env.backup1partition@8 NAND.kernel partition@9 NAND.file-system`target-module@53100000ti,sysc-omap3-shamti,syscSSSrevsyscsyss  @|fck+ Ssham@0ti,omap4-shamm !$rxokaytarget-module@53500000ti,sysc-omap2ti,syscSPSPSPrevsyscsyss @pfck+ SPaes@0 ti,omap4-aesg!!txrxokaytarget-module@56000000ti,sysc-omap4ti,syscVV revsysc 8  ^fckQ_Xrstctrl+ Vmemory@80000000memoryfixedregulator0regulator-fixedvbatLK@LK@Ifixedregulator1regulator-fixed lis3_regKfixedregulator2regulator-fixedwlan-en-regulatorw@w@ ` p Dmatrix_keypad@0gpio-matrix-keypad  $ ``` `` (ijlvolume-keys gpio-keys 5switch-9 volume-up @s P Kswitch-10 volume-down @r P Kbacklightpwm-backlight [aP$ `358>Ke rpanelti,tilcdc,panelokay)default7bpanel-info         display-timings800x480p620À    ' ' /    , 6 Csoundti,da830-evm-audio PAM335x-EVM Yc hd |J Headphone JackHPLOUTHeadphone JackHPROUTLINE1LLine InLINE1RLine In__symbols__ /cpus/idle-states/mpu_gate /opp-table /ocp /ocp/l4_wkup@44c00000% /ocp/l4_wkup@44c00000/wkup_m3@100000< /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0C /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocksS /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-32768S /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-rc32kW /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-19200000W /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-24000000W/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-25000000W+/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-26000000P/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-cpsw-125mhz-gclk[O/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-cpsw-cpts-rft@520]a/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-gpio0-dbclk-mux@53cVt/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-lcd-gclk@534M}/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-mmcZ/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/gfx_fclk_clksel_ck@52cV/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/gfx_fck_div_ck@52cX/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/sysclkout_pre_ck@700V/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clkout2_div_ck@700R/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clkout2_ck@700I/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clockdomainsD/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@38M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@1cM/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@24N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@120M/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@e8L./ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@0MB/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@18NO/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@0/clock@14cFa/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400Ni/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@0Oy/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@14O/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@400/clock@b0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@600N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@600/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@800N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@800/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@900N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@900/clock@0F/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@a00N/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clock@a00/clock@0D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@c00D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@d00D/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@f00E/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/prm@11008$/ocp/l4_wkup@44c00000/segment@200000/target-module@7000?1/ocp/l4_wkup@44c00000/segment@200000/target-module@7000/gpio@0A7/ocp/l4_wkup@44c00000/segment@200000/target-module@9000/serial@0A=/ocp/l4_wkup@44c00000/segment@200000/target-module@d000/tscadc@0ED/ocp/l4_wkup@44c00000/segment@200000/target-module@d000/tscadc@0/adc?O/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0JS/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800[a/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/matrix_keypad_s0Yr/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/volume_keys_s0[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_i2c0_pins[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_i2c1_pins\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_uart0_pins\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_uart1_pins]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_clkout2_pin\/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/nandflash_pins_s0Y/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/backlight_pinsW/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/cpsw_defaultU/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/cpsw_sleep_/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/davinci_mdio_default]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/davinci_mdio_sleep[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_mmc1_pins[/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_mmc3_pins[(/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/pinmux_wlan_pinsV2/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/lcd_pins_s0V>/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/mcasp1_pins]J/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/pinmux@800/dcan1_pins_defaultJ]/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0Wf/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/phy-gmii-selQs/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocksg~/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-sys-clkin-22@40c/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-adc-tsc-fcka/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-dcan0-fcka/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-dcan1-fckb/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-mcasp0-fckb/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-mcasp1-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-smartreflex0-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-smartreflex1-fck`/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-sha0-fck`/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-aes0-fck_/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/clock-rng-fckh/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm0_tbclk@44e10664h /ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm1_tbclk@44e10664h/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/scm_conf@0/clocks/ehrpwm2_tbclk@44e10664P'/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/wkup_m3_ipc@1324N3/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/dma-router@f90L=/ocp/l4_wkup@44c00000/segment@200000/target-module@10000/scm@0/clockdomains9N/ocp/l4_wkup@44c00000/segment@200000/target-module@31000A\/ocp/l4_wkup@44c00000/segment@200000/target-module@31000/timer@0?c/ocp/l4_wkup@44c00000/segment@200000/target-module@3e000/rtc@0g/ocp/interconnect@48000000Bn/ocp/interconnect@48000000/segment@0/target-module@22000/serial@0Bt/ocp/interconnect@48000000/segment@0/target-module@24000/serial@0?/ocp/interconnect@48000000/segment@0/target-module@30000/spi@0Az/ocp/interconnect@48000000/segment@0/target-module@38000/mcasp@0A/ocp/interconnect@48000000/segment@0/target-module@3c000/mcasp@09/ocp/interconnect@48000000/segment@0/target-module@40000A/ocp/interconnect@48000000/segment@0/target-module@40000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@42000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@44000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@46000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@48000/timer@0A/ocp/interconnect@48000000/segment@0/target-module@4a000/timer@0@/ocp/interconnect@48000000/segment@0/target-module@4c000/gpio@0?/ocp/interconnect@48000000/segment@0/target-module@80000/elm@0C/ocp/interconnect@48000000/segment@0/target-module@c8000/mailbox@0P/ocp/interconnect@48000000/segment@0/target-module@c8000/mailbox@0/mbox-wkup-m3D/ocp/interconnect@48000000/segment@0/target-module@ca000/spinlock@0D/ocp/interconnect@48000000/segment@100000/target-module@a0000/spi@0G/ocp/interconnect@48000000/segment@100000/target-module@a6000/serial@0G/ocp/interconnect@48000000/segment@100000/target-module@a8000/serial@0G/ocp/interconnect@48000000/segment@100000/target-module@aa000/serial@0E/ocp/interconnect@48000000/segment@100000/target-module@ac000/gpio@0E/ocp/interconnect@48000000/segment@100000/target-module@ae000/gpio@0D/ocp/interconnect@48000000/segment@100000/target-module@cc000/can@0D /ocp/interconnect@48000000/segment@100000/target-module@d0000/can@0C/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0K/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/pwm@100O!/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/counter@180K'/ocp/interconnect@48000000/segment@300000/target-module@0/epwmss@0/pwm@200F//ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0N7/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/pwm@100R=/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/counter@180NC/ocp/interconnect@48000000/segment@300000/target-module@2000/epwmss@0/pwm@200FK/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0NS/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@100RY/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/counter@180N_/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@200Dg/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0Dl/ocp/interconnect@48000000/segment@300000/target-module@10000/rng@0p/ocp/interconnect@47c00000v/ocp/interconnect@4a000000:~/ocp/interconnect@4a000000/segment@0/target-module@300000/ocp/interconnect@4b140000#/ocp/interrupt-controller@48200000"/ocp/target-module@49000000/dma@0"/ocp/target-module@49800000/dma@0"/ocp/target-module@49900000/dma@0"/ocp/target-module@49a00000/dma@0"/ocp/target-module@47810000/mmc@0+/ocp/target-module@47810000/mmc@0/wlcore@0T/ocp/i2c@44e0b000/ocp/i2c@44e0b000/tps@2d0/ocp/i2c@44e0b000/tps@2d/regulators/regulator@00/ocp/i2c@44e0b000/tps@2d/regulators/regulator@10/ocp/i2c@44e0b000/tps@2d/regulators/regulator@20/ocp/i2c@44e0b000/tps@2d/regulators/regulator@30/ocp/i2c@44e0b000/tps@2d/regulators/regulator@40/ocp/i2c@44e0b000/tps@2d/regulators/regulator@50/ocp/i2c@44e0b000/tps@2d/regulators/regulator@60 /ocp/i2c@44e0b000/tps@2d/regulators/regulator@70/ocp/i2c@44e0b000/tps@2d/regulators/regulator@80/ocp/i2c@44e0b000/tps@2d/regulators/regulator@91'/ocp/i2c@44e0b000/tps@2d/regulators/regulator@1011/ocp/i2c@44e0b000/tps@2d/regulators/regulator@111[mii col][mii crs][mii rx err][mii tx en][mii rx dv][i2c0 sda][i2c0 scl][jtag emu0][jtag emu1][mii tx clk][mii rx clk]NCNC[usb vbus en]P9_31 [spi1_sclk]P9_29 [spi1_d0]P9_30 [spi1_d1]P9_28 [spi1_cs0]P9_42B [ecappwm0]P9_27P9_41AP9_25NCNCNCNCNCNCNCNCNCNCtarget-module@b0000ti,sysc disabled+  target-module@cc000ti,sysc-omap4ti,sysc rev.2fckosc+  can@0ti,am3352-d_can 2fck D4 disabledtarget-module@d0000ti,sysc-omap4ti,sysc rev.3fckosc+  can@0ti,am3352-d_can 3fck D7 disabledtarget-module@d8000ti,sysc-omap2ti,sysc   revsyscsyss  .fck+  segment@200000 simple-bus+segment@300000 simple-bus+00 0 000@0@P0P001@11  1 P1P`1`p1p010@1@22 2 020@2@P2Ptarget-module@0ti,sysc-omap4ti,sysc revsysc  .fck+ epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck5ecap0 disabledcounter@180ti,am3352-eqep( sysclkoutO disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm4( tbclkfck disabledtarget-module@2000ti,sysc-omap4ti,sysc   revsysc  .fck+  epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck/5ecap1 disabledcounter@180ti,am3352-eqep( sysclkoutX disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm5( tbclkfck disabledtarget-module@4000ti,sysc-omap4ti,sysc@@ revsysc  .fck+ @epwmss@0ti,am33xx-pwmss+ disabled pwm@100ti,am3352-ecapti,am33xx-ecap(fck=5ecap2 disabledcounter@180ti,am3352-eqep( sysclkoutY disabledpwm@200"ti,am3352-ehrpwmti,am33xx-ehrpwm6( tbclkfck disabledtarget-module@e000ti,sysc-omap4ti,syscT revsysc    7fck+ lcdc@0ti,am33xx-tilcdc$okay %straightportendpoint@098Etarget-module@10000ti,sysc-omap2ti,sysc revsysc .Xfck+  rng@0 ti,omap4-rng otarget-module@13000ti,sysc disabled+ 0target-module@15000ti,sysc disabled+P`target-module@18000ti,sysc disabled+ @target-module@20000ti,sysc disabled+ target-module@22000ti,sysc disabled+  target-module@24000ti,sysc disabled+ @interconnect@47c00000ti,am33xx-l4-fwsimple-busGGG aplaia0+ Gsegment@0 simple-bus+@@PP``pp``pp@@PP  00  00@@PPtarget-module@c000ti,sysc disabled+ target-module@e000ti,sysc disabled+ target-module@10000ti,sysc disabled+ target-module@14000ti,sysc disabled+ @target-module@1a000ti,sysc disabled+ target-module@24000ti,sysc disabled+ @target-module@26000ti,sysc disabled+ `target-module@28000ti,sysc disabled+ target-module@30000ti,sysc disabled+ target-module@32000ti,sysc disabled+  target-module@38000ti,sysc disabled+ target-module@3a000ti,sysc disabled+ target-module@3c000ti,sysc disabled+ target-module@3e000ti,sysc disabled+ target-module@40000ti,sysc disabled+ target-module@42000ti,sysc disabled+  target-module@44000ti,sysc disabled+ @target-module@46000ti,sysc disabled+ `interconnect@4a000000ti,am33xx-l4-fastsimple-busJJJ aplaia0+ Jsegment@0 simple-bus+ ((0088target-module@100000ti,sysc-omap4-simpleti,syscrevsyscsyss  9fck+ target-module@180000ti,sysc disabled+ target-module@200000ti,sysc disabled+  target-module@300000ti,sysc-prussti,sysc2`2` revsysc0    :fckI;Prstctrl+ 0okayinterconnect@4b140000ti,am33xx-l4-mpusssimple-busKDKHlaap+ Ksegment@0 simple-bus+`HH @@PP00target-module@0ti,sysc disabled+$ target-module@3000ti,sysc disabled+ 0interrupt-controller@48200000ti,am33xx-intc H target-module@49000000ti,sysc-omap4ti,syscIrev <fck+ Idma@0ti,edma3-tpcc edma3_cc  '5edma3_ccintedma3_mperredma3_ccerrint@\=>?e!target-module@49800000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcp5edma3_tcerrint=target-module@49900000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcq5edma3_tcerrint>target-module@49a00000ti,sysc-omap4ti,syscII revsysc  <fck+ Idma@0ti,edma3-tptcr5edma3_tcerrint?target-module@47810000ti,sysc-omap2ti,syscGGGrevsyscsyss  /fck+ Gmmc@0ti,am335-sdhci} disabledi2c@44e0b000 ti,omap4-i2c+i2c1DFokay9defaultG@0tps@24$ ti,tps65217  Ochargerti,tps65217-charger5USBACokaypwrbuttonti,tps65217-pwrbuttonokayregulators+regulator@0dcdc1 vdds_dprregulator@1dcdc2vdd_mpuHLregulator@2dcdc3 vdd_coreH0regulator@3ldo1vio,vrtc,vddsregulator@4ldo2 vdd_3v3auxregulator@5ldo3vdd_1v8w@w@regulator@6ldo4 vdd_3v3aAbaseboard_eeprom@50 atmel,24c256P+*Abaseboard_data@0tda19988@70 nxp,tda998xp 5B EB 9defaultoffGCYDEc_ports+port@0endpoint9E8i2c@4802a000 ti,omap4-i2c+i2c2HG disabledi2c@4819c000 ti,omap4-i2c+i2c3Hokay9defaultGF0cape_eeprom0@54 atmel,24c256T+cape_data@0cape_eeprom1@55 atmel,24c256U+cape_data@0cape_eeprom2@56 atmel,24c256V+cape_data@0cape_eeprom3@57 atmel,24c256W+cape_data@0mmc@48060000ti,omap4-hsmmcmmc1o}| *GG/txrx@Hokay9defaultGH IJmmc@481d8000ti,omap4-hsmmcmmc2}*!!/txrxHokayJ9defaultGKwdt@44e35000 ti,omap3-wdt wd_timer2DP[usb@47400000ti,am33xx-usbG@+ usb_otg_hscontrol@44e10620ti,am335x-usb-ctrl-moduleD DHphy_ctrlwakeupLusb-phy@47401300ti,am335x-usb-phyG@phyLMusb@47401000ti,musb-am33xxG@G@ mccontrol5mcvbus peripheral  Mh*NNNNNNNNNN N N N N NNNNNNNNNNN N N N N N/rx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15EOusb-phy@47401b00ti,am335x-usb-phyG@phyLPusb@47401800ti,musb-am33xxG@G@ mccontrol5mchost  Ph*NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN/rx1rx2rx3rx4rx5rx6rx7rx8rx9rx10rx11rx12rx13rx14rx15tx1tx2tx3tx4tx5tx6tx7tx8tx9tx10tx11tx12tx13tx14tx15dma-controller@2000ti,am3359-cppi41  0@@#gluecontrollerschedulerqueuemgr5glue+Nethernet@4a100000ti,am335x-cpswti,cpswcpgmac0QR fckcpts9HT ` lsJJ+()*+okay9defaultsleepGSYTmdio@4a101000ti,cpsw-mdioti,davinci_mdio+ davinci_mdioB@J disabled9defaultsleepGUYVethernet-phy@0Wslave@4a100200Wmiislave@4a100300cpsw-phy-sel@44e10650ti,am3352-cpsw-phy-selDP gmii-selsram@40300000 mmio-sram@0 @0+pm-code-sram@0ti,srampm-data-sram@1000ti,sramemif@4c000000ti,emif-am3352Lemifegpmc@50000000ti,am3352-gpmcgpmcP d *!4/rxtx+  disabledtarget-module@53100000ti,sysc-omap3-shamti,syscSSSrevsyscsyss  <|fck+ Ssham@0ti,omap4-shamm *!$/rxokaytarget-module@53500000ti,sysc-omap2ti,syscSPSPSPrevsyscsyss <pfck+ SPaes@0 ti,omap4-aesg*!!/txrxokaytarget-module@56000000ti,sysc-omap4ti,syscVV revsysc    XfckIYPrstctrl+ Vmemory@80000000memory leds9defaultGZ gpio-ledsled2beaglebone:green:heartbeat ?B heartbeat4offled3beaglebone:green:mmc0 ?Bmmc04offled4beaglebone:green:usr2 ?Bcpu04offled5beaglebone:green:usr3 ?Bmmc14offfixedregulator0regulator-fixed vmmcsd_fixed2Z2ZJclk_mcasp0_fixed# fixed-clock0w[clk_mcasp0#gpio-gate-clock[ BB^soundsimple-audio-cardOTI BeagleBone Blackfi2s\\simple-audio-card,cpu]^\simple-audio-card,codec___symbols__/cpus/idle-states/mpu_gate /opp-table/ocp/ocp/l4_wkup@44c00000%/ocp/l4_wkup@44c00000/wkup_m3@100000</ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0C/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocksS /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-32768S /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-rc32kW !/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-19200000W 2/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-24000000W C/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-25000000W T/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-virt-26000000P e/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-tclkinM o/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@490V |/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-x2Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m4@480Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m5@484Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m6@4d8M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@488Y /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-mpu-m2@4a8M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@494Y /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-ddr-m2@4a0Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-ddr-m2-div2M /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@498Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-disp-m2@4a4M #/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock@48cY //ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2@4aca >/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2-div4-wkupdmZ Y/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-per-m2-div4S m/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clk-24mhzS w/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-clkdiv32kQ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l3-gclk\ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-pruss-ocp-gclk@530W /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-mmu-fck-1@914X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer1-fck@528X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer2-fck@508X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer3-fck@50cX /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer4-fck@510X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer5-fck@518X /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer6-fck@51cX /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-timer7-fck@504Z /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-usbotg-fck-8@47c[ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-dpll-core-m4-div2[ /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-ieee5000-fck-1@e4V /ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-wdt1-fck@538U &/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l4-rtc-gclkS 2/ocp/l4_wkup@44c00000/segment@200000/target-module@0/prcm@0/clocks/clock-l4hs-gclkR /ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0NF/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@100RL/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/counter@180NR/ocp/interconnect@48000000/segment@300000/target-module@4000/epwmss@0/pwm@200DZ/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0T_/ocp/interconnect@48000000/segment@300000/target-module@e000/lcdc@0/port/endpoint@0Df/ocp/interconnect@48000000/segment@300000/target-module@10000/rng@0j/ocp/interconnect@47c00000p/ocp/interconnect@4a000000:x/ocp/interconnect@4a000000/segment@0/target-module@300000/ocp/interconnect@4b140000#/ocp/interrupt-controller@48200000"/ocp/target-module@49000000/dma@0"/ocp/target-module@49800000/dma@0"/ocp/target-module@49900000/dma@0"/ocp/target-module@49a00000/dma@0"/ocp/target-module@47810000/mmc@0T/ocp/i2c@44e0b000/ocp/i2c@44e0b000/tps@240/ocp/i2c@44e0b000/tps@24/regulators/regulator@00/ocp/i2c@44e0b000/tps@24/regulators/regulator@10/ocp/i2c@44e0b000/tps@24/regulators/regulator@20/ocp/i2c@44e0b000/tps@24/regulators/regulator@30/ocp/i2c@44e0b000/tps@24/regulators/regulator@40/ocp/i2c@44e0b000/tps@24/regulators/regulator@50/ocp/i2c@44e0b000/tps@24/regulators/regulator@6&/ocp/i2c@44e0b000/baseboard_eeprom@507/ocp/i2c@44e0b000/baseboard_eeprom@50/baseboard_data@0 /ocp/i2c@44e0b000/tda19988@704)/ocp/i2c@44e0b000/tda19988@70/ports/port@0/endpointY/ocp/i2c@4802a000^/ocp/i2c@4819c000"0/ocp/i2c@4819c000/cape_eeprom0@54.=/ocp/i2c@4819c000/cape_eeprom0@54/cape_data@0"H/ocp/i2c@4819c000/cape_eeprom1@55.U/ocp/i2c@4819c000/cape_eeprom1@55/cape_data@0"`/ocp/i2c@4819c000/cape_eeprom2@56.m/ocp/i2c@4819c000/cape_eeprom2@56/cape_data@0"x/ocp/i2c@4819c000/cape_eeprom3@57./ocp/i2c@4819c000/cape_eeprom3@57/cape_data@0/ocp/mmc@48060000/ocp/mmc@481d8000/ocp/wdt@44e35000/ocp/usb@47400000#/ocp/usb@47400000/control@44e10620#/ocp/usb@47400000/usb-phy@47401300/ocp/usb@47400000/usb@47401000#/ocp/usb@47400000/usb-phy@47401b00/ocp/usb@47400000/usb@47401800&/ocp/usb@47400000/dma-controller@2000/ocp/ethernet@4a100000%/ocp/ethernet@4a100000/mdio@4a1010004/ocp/ethernet@4a100000/mdio@4a101000/ethernet-phy@0&/ocp/ethernet@4a100000/slave@4a100200&/ocp/ethernet@4a100000/slave@4a100300-/ocp/ethernet@4a100000/cpsw-phy-sel@44e10650/ocp/sram@40300000"/ocp/sram@40300000/pm-code-sram@0%/ocp/sram@40300000/pm-data-sram@1000/ocp/emif@4c000000 /ocp/gpmc@50000000%/ocp/target-module@53100000#1/ocp/target-module@53100000/sham@06/ocp/target-module@53500000"A/ocp/target-module@53500000/aes@0E/fixedregulator0R/clk_mcasp0_fixed c/clk_mcasp0n/sound/simple-audio-card,cpu compatibleinterrupt-parent#address-cells#size-cellsmodelstdout-pathtick-timeri2c0i2c1i2c2serial0serial1serial2serial3serial4serial5d-can0d-can1usb0usb1phy0phy1ethernet0ethernet1spi0spi1mmc0mmc1mmc2enable-methoddevice_typeregoperating-points-v2clocksclock-namesclock-latencycpu-idle-statescpu0-supplyentry-latency-usexit-latency-usmin-residency-usti,idle-wkup-m3phandlesysconopp-hzopp-microvoltopp-supported-hwopp-suspendinterruptsti,hwmodspm-sramrangesbootph-allreg-namesti,pm-firmwarestatus#clock-cellsclock-frequencyti,max-divti,index-starts-at-oneclock-multclock-divti,set-rate-parentti,bit-shift#reset-cellsti,sysc-maskti,sysc-sidleti,syss-maskgpio-rangesgpio-controller#gpio-cellsinterrupt-controller#interrupt-cellsgpio-line-namesdmasdma-namespinctrl-namespinctrl-0#io-channel-cells#pinctrl-cellspinctrl-single,register-widthpinctrl-single,function-maskpinctrl-single,pins#phy-cellsti,rprocmboxes#dma-cellsdma-requestsdma-mastersti,timer-alwonsystem-power-controllerti,spi-num-csinterrupt-names#sound-dai-cellsop-modetdm-slotsserial-dirtx-num-evtrx-num-evtti,timer-pwm#mbox-cellsti,mbox-num-usersti,mbox-num-fifosti,mbox-send-noirqti,mbox-txti,mbox-rx#hwlock-cellssyscon-raminitti,sysc-midle#pwm-cellsblue-and-red-wiringremote-endpointresetsreset-namesti,tptcsti,edma-memcpy-channelsti,needs-special-resetti,pmic-shutdown-controllerregulator-compatibleregulator-nameregulator-always-onregulator-min-microvoltregulator-max-microvoltregulator-boot-onvcc-supplynxp,calib-gpiosinterrupts-extendedpinctrl-1audio-portsti,dual-voltti,needs-special-hs-handlingbus-widthcd-gpiosvmmc-supplynon-removableti,ctrl_moddr_modementor,multipointmentor,num-epsmentor,ram-bitsmentor,powerphys#dma-channels#dma-requestscpdma_channelsale_entriesbd_ram_sizemac_controlslavesactive_slavecpts_clock_multcpts_clock_shiftbus_freqmac-addressphy-handlephy-modeprotect-execpoolti,no-idleti,no-idle-on-initgpmc,num-csgpmc,num-waitpinslabellinux,default-triggerdefault-stateenable-gpiossimple-audio-card,namesimple-audio-card,formatsimple-audio-card,bitclock-mastersimple-audio-card,frame-mastersound-daimpu_gatecpu0_opp_tableocpl4_wkupwkup_m3prcmprcm_clocksclk_32768_ckclk_rc32k_ckvirt_19200000_ckvirt_24000000_ckvirt_25000000_ckvirt_26000000_cktclkin_ckdpll_core_ckdpll_core_x2_ckdpll_core_m4_ckdpll_core_m5_ckdpll_core_m6_ckdpll_mpu_ckdpll_mpu_m2_ckdpll_ddr_ckdpll_ddr_m2_ckdpll_ddr_m2_div2_ckdpll_disp_ckdpll_disp_m2_ckdpll_per_ckdpll_per_m2_ckdpll_per_m2_div4_wkupdm_ckdpll_per_m2_div4_ckclk_24mhzclkdiv32k_ckl3_gclkpruss_ocp_gclkmmu_fcktimer1_fcktimer2_fcktimer3_fcktimer4_fcktimer5_fcktimer6_fcktimer7_fckusbotg_fckdpll_core_m4_div2_ckieee5000_fckwdt1_fckl4_rtc_gclkl4hs_gclkl3s_gclkl4fw_gclkl4ls_gclksysclk_div_ckcpsw_125mhz_gclkcpsw_cpts_rft_clkgpio0_dbclk_mux_cklcd_gclkmmc_clkgfx_fclk_clksel_ckgfx_fck_div_cksysclkout_pre_ckclkout2_div_ckclkout2_ckprcm_clockdomainsper_cml4ls_clkctrll3s_clkctrll3_clkctrll4hs_clkctrlpruss_ocp_clkctrlcpsw_125mhz_clkctrllcdc_clkctrlclk_24mhz_clkctrlwkup_cml4_wkup_clkctrll3_aon_clkctrll4_wkup_aon_clkctrlmpu_cmmpu_clkctrll4_rtc_cml4_rtc_clkctrlgfx_l3_cmgfx_l3_clkctrll4_cefuse_cml4_cefuse_clkctrlprm_perprm_wkupprm_deviceprm_gfxgpio0_targetgpio0uart0tscadcam335x_adcscmam33xx_pinmuxuser_leds_s0i2c0_pinsi2c2_pinsuart0_pinsclkout2_pincpsw_defaultcpsw_sleepdavinci_mdio_defaultdavinci_mdio_sleepmmc1_pinsemmc_pinsnxp_hdmi_bonelt_pinsnxp_hdmi_bonelt_off_pinsmcasp0_pinsscm_confphy_gmii_selscm_clockssys_clkin_ckadc_tsc_fckdcan0_fckdcan1_fckmcasp0_fckmcasp1_fcksmartreflex0_fcksmartreflex1_fcksha0_fckaes0_fckrng_fckehrpwm0_tbclkehrpwm1_tbclkehrpwm2_tbclkwkup_m3_ipcedma_xbarscm_clockdomainstimer1_targettimer1rtcl4_peruart1uart2mcasp0mcasp1timer2_targettimer2timer3timer4timer5timer6timer7gpio1elmmailboxmbox_wkupm3hwspinlockuart3uart4uart5gpio2gpio3dcan0dcan1epwmss0ecap0eqep0ehrpwm0epwmss1ecap1eqep1ehrpwm1epwmss2ecap2eqep2ehrpwm2lcdclcdc_0rngl4_fwl4_fastpruss_tml4_mpussintcedmaedma_tptc0edma_tptc1edma_tptc2mmc3tpsdcdc1_regdcdc2_regdcdc3_regldo1_regldo2_regldo3_regldo4_regbaseboard_eeprombaseboard_datatda19988hdmi_0cape_eeprom0cape0_datacape_eeprom1cape1_datacape_eeprom2cape2_datacape_eeprom3cape3_datawdt2usbusb_ctrl_modusb0_phyusb1_phycppi41dmamacdavinci_mdioethphy0cpsw_emac0cpsw_emac1phy_selocmcrampm_sram_codepm_sram_dataemifgpmcsham_targetshamaes_targetaesvmmcsd_fixedclk_mcasp0_fixedclk_mcasp0dailink0_master