'VĎg=rjU-Boot 2025.01-3 for firefly-rk3` @ᆳ (OР iHMP  H4P  MOЍHM  H4P  OР iHM! H4P  HOР iHMp! H4P  OР iHM! H4P  OР iHM0" H4P  hOР iHM" H4P 1) | )Oo/Oo   P!:0@" РpGHpGHpGHpGHpGHpGHpGHpG-AKh h%H$O gFJJEH`B|$$DT@B|i+D ` 7CDHF !Fh a a8 DBpG;?JKFdKaKa`-EF F*M+OB*K`E00L \$KB43B"KB;B*y*KX hDCH 0!? ?#IHI5"SEr BR  NB~FIHIx\,  0%%FM #x#`0#FF9OBЄB  "F4{1HBHAG2*6$`B`A+)h D 2"`K` I"K`FPO1 0S$h@)4$#-M&NF3a&KFhFi EE 2i;h4HIBF:`(FkhF;F0iD0a,9hBPF)F#DB: Y"paI F 2iH-E"MF+h iFFDB,3B#`##`%h F#FAF:X$#hB$##`P(F-h5BO :FAF(F!B( ,#`-,-MFFFF)h0FOQAF@E,1F8F3#$  F2RZE*`0FB"8Fjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-IBI SYSTdH@% `Das U-BootXXRUNTSERVdP-y    UbEfiVa#??OopGpGpGpG@pG@#???OopG8F F)0?"3@SB#@BؿO)F F8@>?DpGpF F 0o)F F8"#F6@BؿO)F Fp@6?D_00;0 0Q@o0  CA_oveb^Y@T S@No/N-N/_00;0 0Q@o0  CA_ovebVY@T S@No/N-N/pGF o L8pG/ J|x pG6nR| |pGxpGРBРBK8Р <0((0 SzKyK 0 /4|aE _/_ РP/0 /0Od@P TP  Q:< 80QR:/l00# kl#iF#9]pGs0F[k`H F2H!H%(HHKIt,FHHw0;  FGp0k..0W..pGF H203 Fx HHH F@h. /pF i(F0Fpo!F(F(FO6F`ID|(dH@2/:/0G%@$0C#&@CC'@CcLBLBH~ )@(0C#*@CC+@Cc `-@,0C#.@CC/@Cc` hFHH (obox\/p/F=A!AA F*-AFF@: A A A A  A A AA L   pG:+ ؿ  DBpG:K Z q:-ۑ`:ۑ<\|Q :Q` D!Q;QKQ[QkQ{QQD@;@K@[@k@{@@;$K;$K˽@pG ȿ;Kȿ;K  !QN:9-`:ۑ<\|O# :SCcO$DdO%EeO&FfO'GgO(H hO)I iO,Ll`ڽ O#Q Cc@;ܡ{:9-`:ۑ<\|OC :SCCODDDOEEEOFFFOGGGOHH HOII IOLLL`ڽ OCQ CC@;ܡ.:9-`:ۑ<\|Oc :SC#OdD$OeE%OfF&OgG'OhH (OiI )OlL,`ڽ OcQ C#@;ܡ pG0HYk_ HZ H4U H8P@ORHH׻/////8 4 8 :8 pG=40J3 `pG@pG pGHG:/-AF"KI9kkIH%lH pF <k< kYAHHj"kak?HH#jbjj=HH~#iIH19"ԔwFXgkиq F=HGMF*Fh#F)!9h+ @cj `XH0F(WVH0FUH0F-JSKSJL`j EF`j )ED,KI/qF EFE(F E FFE F1ADPF Ex FFD EpDD@F F 3HF0KF/JFFSF-I AFcj(JFd]F#YFJF(FF##j#ahH%aj)?9HFx4%:(H0`h+?B; K`<h;;<;<t2q0W<:!<.<V<<F(" U-E FF FFF(( RF!hHFo F2FQF(FQFHF ;F2F1F(F(E<<-MFF+@=!HFo F'oaE:FF & +++)F "3"+FRD(Ff 2FHFFGH F(jH"!!i( 2FHF Foi@a!dbd`"  +ƀR#q9;;9;;;/:/:g:::;;;:::;;; ;"  + +khc`hE3h`8o J2FYHF"( iE`(RI iEF(E`a(#3pFFIiE !0FE1FBFaEAi/_Qi+ZF#j+O cj+H$j+A(#8cc,#c/" +sR#; <<8 <9%9 < < < < <;;; < < <; < < <;<<=1=8F&hhn`,t)F.Шh`E3"+FRD $("FH |$D9=F}H FFEF FE8D"F I HFo# }IF2F(FY=g==pF%FhV`hShPUhB Fp@F@80F6hsF FF "!aa#2F1F(F#Fk~F3hk HFhc`. F$ FpHF==-M$ F iCJ 3 @K#Fji(hF(mЫF9H/F"[_E'+,NF3HF~H 0FF0F,K (GЬiEDT<#@$h@S!I@FF6BFAF0Fw(0F M޺ih1W< E(F+FW< EFDF?hFQF0F(0ih HF&4 gfff/==0 >-AFFFF!"Q0#s 0g`#v$0`cv(FE(FE a=# "iTH/!(FE(@Coo 0Wi3pFFF HF p#Ca!F(F F >FF@"hFE @"iF6chXBXAFh@O3 DiXBXA< S/pG0FFFB"@T!0;`<<5B0D0`W?3#D 8`h+ pGB 0 FFh FFIH>FIH> FIH޿?d-M F9`زF F,FIKHBFF!FHFu-)FHFo%FHFB EO3YF@F ZFQF@F A& #D;`o???r9?%?FIH~\?PF  "5I6HF3I5HF qF`wF}F;F2F)F+HF&I*HFh"i"I&HFbiI$HF*% FIFHF%B)F F*FIHF}+% IHFq5 +!ihH R@9@F`*p????????@@F2FK` pxH/"!F#H8H/ "!F8,P@ ,DBH@/ "!FF`HHH/@ӿ"!FHBETpG!FKhpGpxiFKhBAM@ @ 'V pG-MO ( FFFFBIDM#3* D0 'Kl+Б"0+ h6HEjF!(hYF0FF4F(E!F-HE"h,KB,H$o FP&H F]$H F!H!H#+ cB+(ѣ+FHE],@h:!0FD0YF0E@ HotIH'VUU6U66HH-AF#H FFF/@!EFܹ#3`;` F,OQ(FD0`HO0Cc4`)F F;`Dx D*:`1hHE0hO3*F!FHw\IhII66opG7F0FU(Fq8+" F0FFHE F@!JC5IpFH/F(F(F**hKBH- Fp(FH.(FH+H*l@ HSK,`` HO45'VIIIII J`@` F@hFDF0FDByh%)D0FD(,F FF@hFF@Fj@7`hF HE%hC"@jCb(F9F FG(ЃFO ]F [O QF )`BhBH% 5  BE[EO eg-CcoZНB#g#0|fo FFi/pGpFKF*F!JD k;C c/1FF F(F6p#d#bo 0W FlFB k0~#bcoFFF!jJDi|i FF!F8F/!F8FPF0N3`+`9-AFFF@FFAF8Fq F/*hBAAF8Fa`"#1F F#/+`o Caa 8Fh`h`iB 88"pFF H.#F3pXxKhE(FE`0pp`hCKKh(F7F gFn(` F07(`iB08-A 0"M"L  1F z/K\CBkh+ 7D5JI( "AFHC0 O3BF)F#(PKXKdK pGp FF!FFHCFh(FICp(F ICX#F3p Fp HD]o#)FHDT>.OKKpF F"!(Fkx J##k#Fop1FO(9VsF FF!"FhD|OB"`F*FpK` K𵽰 F nعci ifiF0FiFu/F:h1F F#K`W?+=*F/Fo@"O1 F("lkC="!lC# " #)FC( ICF+ HC1(Cd(o K)UL>Fռ-A FFF"!0F#kj1F J(F^F o9F(F(WsF FF!"FhDOB"`F*Fp-E$FKFF  BFIPFD"!F(hXhF9 :hB;` ooK};(H F.(F"!Dt#F F8+d/!C` 4"FbjUJjJ!+FJDC(c o 0F7#b0F(9F2acO6KK0W;K` KF F0KF!K` .-MiF Fư+[/I0FC6F0FC`iF3F" FF(?#Fb#H."FF5p  BFOq0F8rF "e2x¹mCe `O2F0!F;FPFF0FC?d(o ge#e(FFoL;F Fk( F{H!-AHKܰ"F  N6*1#F$!>JD6 ';H.*(h!F9H.RFع7H.oر!FD{F!4H."!0FF@O1/H.(o F\*Kh(d&H.K(C+l(cF$H3F$I4#H.;(!FDF IFF@FD"FOq8F8ȹ8FCd"!F 8@!FH.Cne(e#bmCeFo K)LILSL:^L9pxgL0W;};8mFCie Frx(( F8@A!F(F8@-E;H F!-F iV\((^ei(FF)F FE(K#l1F2"# k/`(= ic@2F-7khi !!JD!k" C/! C#p@F B( @Fk"k4Pm3gmm!l["0F4po=lH!H-F :F:kLW;KFpG T d#cbpG=K` 3j8Hi F(0hF~+IH-`ihH-8iH-jH-FFk8@`iFiFFH- lH-8WLLLL-Ei FuF F0Fs((6OH-p)FDFLH-FHo(FGK"@FF(}FBH-F(0Eco 2FAFkU#&db fi6i+U0FFFFBF1F F*KBF1F F'KHZ?+FFF!H@FCb(@"O1 F&F!lFk-PIC\(HCd( FI84wFuorFpLLpx9LL0WLLLo%pG 3  Fx## b:(IH:or F߸K`#C` #MFFF" FF<D$%F;#F8ғBqӤEBqҘaFU+%FQK$FW;F-M F!FFF @!FPF@;F*F!F'FO GE(xh.$=Uh q-* pJ-p%MqE$qqh $"]h-+ PK-P%@PE$P@D732 `A @-M$ FFFCFF&F;O ZF!(FF ]Dȿ6$ȿElEL &FRK$FFFF@2(`L#9F0FJ@fh#`#XM-MFFF@7 !F(F S+ +"9F(F?DIFDHDhO0F1F!F(F@ F ;FR (F {+ +"!F !F(F $@F ,#F#FRK$!c"FG F DO4O E4BF1F??F D}+dM-MFFF@;ۺ ;F2F!F(F M@3SF2F!F(F?9(F FFFF?CF*F9F0F@F, F@R*FFIHC Fh-M7F?@>FHCH-F$ F0B70#F!(FJ@@"FHMMMM-MBFFF$ F!=J(F?OFFEAF(F?#[EBAF(F@VO8:FCF(F@! @F'HC-TFAF(F@(?O !F(FJ@8F@FHC ([4HA!F4HC F2H F0/H  F+H+H+)H (H@ PFUF>$H,&i6BVEh BٓBHVQF0FB5F!FHC5%F)FHC0Pkh;`khBH_RRRPQ6QQ66QQR'R7RRS pGFF FF\( 7HCO56HC.Fa F(2H F4(/Hlf0FB#D3F F*J*I F F0?nF$HC F LF( F(0B#5c" F FHC'ah F A! F')F FA 0F4SSSSvSS9SSFFFG*pFFT!CFF HCc"Fq(FFH$CU FpO4#TKT FH,!F@tgFFHC: FQ("H"hKBH  FnH FN H Fw H H HUUvU'VUU6U66U*FF Kh@&$!W$C4BF0FpxV.FFCXhCix+;:+9#+7 "%I`h`h.  !K0B HCO0 @=Mh-h-#iK4#1F0 8 hNch.ݣh.hgHyU8sF F,&`KHhVChkF"1F Fppx VsF#M FLId2FaCHp\m۶\*̿XhHB0W"iF @C/ 3]-MFF FFFFU;ܸvgI`hBF(@FhCYFFhCYFF iC9F2hFCFZHC(F1h(ISF"FAFSJTKFBFFRHC` "NIBF`hBnF(?ѠhCkFF(Fk4`FHC"DI`hBX0(F* "Yt0-AF>+ FFO0" Iph(ChbB-hKB)FF3A`G y!*!XhC9F!FHB" F@FLY F"FHB(ZF#H"B]8Z-A@nHk#lk!kH#kjH#"lhH!hgHahfHheHeHLBPcH0bH< "`I`HBAEF(PF]IB!F[HEFE3FXHB+,BWHB%VH,FUHBTH (20+l б JHt$HHo&GHj%EHe DHa AIA;>HB=Nh=O,<,3Bclbh 3F;F6I7HBcl! FLF FBiF#0H2*jB.H#,,H!hk@*)H)IBj,>a pG B!HBPz*8FF IXhA@- !4`h 8! F!a&FF7F- 2F9FH`hx-+ IAP I`hAHahHB '=4&aaa#  y -AF>+ FFO0" Iph(ChbB-hKB)FF3A`G Pz! B!Hz-EKh,T,N-M0<,O'kA#i@PFE<+FaF1Bq OF4OOYDFBF Er,F! # Dd! Bb #ah#HB[0  ףp= ףSblAw-AF>+ FFO0" Iph&(ChbB-hKB)FF3A`G z!*sF'H 'F(HB p"phFBp"FFhBjOzr N d# FjC I*F1FHB O0*b}b*FFIXhAdF$%F#  W%a#5B  %bHpG(hBh`hhZ` pG#h`C`HpGCh` pGphhFiBjB^h! " HBBHihHBBѽp@Hpd6c;cBcphhFiB'jB$^h) "HBcBHh"hh;Bciyk HBRah HBNBѽp@HݾHpGc6cTcȀBcZc(h K ih"X3hHFB ]`c hhhhAb-MhFh)>9 I.F(4OUoBOH HVAIFXFA"IH"8#F;q F>(FV,yhRVFM%cr  %F" F!F*FHB(FFб#FH"F#h4F)F0F;(FJKBF FLc "@!Kmc" !KlcCh)j3BC`pGi;BC`pGi23abpGj:;abpG0F F8( #ch+! F 0hbh;B!"FRhBP\chB8F hipF 8(7iroJO E@/?(F`(9iKjJjK(FhiKiIF-hKEOc1}ZFPF0GF1\/+ ! F PO1F:f ع8F4RO1UhG18(FA.R0F$/Z#}+?'SO2 P:]H0O2?I PH8F 3 vO1 P\#T#;q<``F(pV*0(F-Jh$F(  cV#3Bѧ OO1h@B(FFBhhh#p#h`chS`#S``U (F5F6h O/FAT{5Le *b7v8 A0HA .M+x+3-L-I h1F('"h)I2W('I h1 F($N1F"h2F(0hAjhIhGJ;+`H#+p09(N!H@F(KIK2hKbF F<KB O0`ehQeT{le5#-M$!F F +$+ xxu}f2F(F)IQF(<(F&IGF(2(F"I0=F(((FK2mI("F(FKI("F(FKI( KJK(FhK&FKB?%wLF/FFLofffefc~dT{5 p"!I\F(0X! F(/!dJ7I7F0(F=L F pKF)FF0F-(F*, KBJ KBFL f pX! FH!/FF KF1FFF H/lF0FKB,F FpLf s$UB3Yhx-(Ixp)*s)ѕ&!0h@0=6*Dt3F*F!FAJ%Kh+H@D(Fp$Khygpx-A*FFiKhiHhH*gH@! !Xh@-FaI`h?( B(9F\H@!@FYH*F(`WH*mFF(FhF?D0F?FPH*oF4F*|MI@DLH*cFKI(@&IH*Y(lFH*S:EI F@4CH*HF (AI@D@H*>F (>I@D=H*4F (;I@D:H**F0F(?0F?N(F?K(F)F8"@F((F?@(F8!@F&BFAF)H@8F@`8F@F9F$H@u G!HI H@hzI@D FI@?Hpxh0h9hKghkJ^Lh;h;h;h;hhhhhi9dhh)Uh* "!Xh@ 0 $+i$+$+$+t$+$+F$+_$+jp*FH@ "p#h`h/ Fh-F8+F2FahH@ .Em=m$+g$+$+ 0D<F MB  4B xH+\0F Bb--AF8H F)!@F!F0FF1H %BܽA-H O7-*H 0F 0F?5D0F?0D&ѧB"F1FAH@;%H@7,4lgBHA@)V%JHBBF @5BH@ OBH KbB;Fq]F H@ 5erurrrwrr)U70Wrr*rFFH@K!F`H@)Drr-M*FFO4K"IXh?aF(~ѧ FF%x-+!@MF/9б-?0F>c+ q+'?+  8%-0#$ ~Khh(EzI{H@ F)FxH),wIF;(5oK1FqH`) !@JhB/FgHFF<`/(<FbH@J"`Ihh?F(;/kFh@H@F(!Fh@/FChF1F<.<FJH@!F(i@FFBhBDH@ u0F$8N3h?H i">Ihh?X0h(<F7H"7Ihh?}ȹ/h0hh)ЧBܙH7!4X$P"(F@*x?* 2`23Q))FHF)x2 )[+*0MJx])F )14X$0BS\Dx])?X@rJ3 CFlM>(F>IS4BDBED5hhxg+@#/ /њ0s+)i0h <2ﮚ0n+s+H/F!F0h7D F>0>DBܦ!F'&.۵T& -t~t-t0WtYGI?7B1FsHa+F@F)is+.F<FHp+#l+@O//hQF0h;L ,D)F"F0h;F`"FQFqH?O $-(!FkH?(FFhH?")F0h;OEF pxbK)FaIbH ?4,_H$_JH ?ZE6I;H ?R 7H?I.I6H ?CE3H"2I>h0h;U/0h h<(!;F(H<(;F$Hhhxh+@/Aѫhxg+w$N)iV >4 ,jX$h 滇t uy{Yuqx{&u.urJuPuWuTu_uluԱuuH P?3hHZh,F?3hHh ?3hHh ?3hHi ?!FH?3hHi ?,3hHi ? 3h{Hj ?,3hxHYj ?0h; FuH?tI">FH/h? 3hai"lIhh>Fȹ/"Fh?R"FFh!F?KBF;F0hdt̻"]Ihh>F(]ѫhxp+'0h;FVH?=VH?:E0AF0h;;FNHݻAFLH2?a+"Fh?"F F(iAF?:F#F0h;(;F;Hd+(Fh?F0h< (;F2Hͻ"1Ihh>{Fع// Fh?p!FFh?k<0h"F9F0h_»F!I"hh>XF(/Шh?OF0hK./Fuuuuvv-vDv[vrvvvMR?vvvvw$*$*$*+$*$***-AFF")FFFh*#h)ЙՆZ #h##`1F H?3#h##`)FP#jF8FF0iFH?#H}:-M*FFF@*^h4"0FI>(Ih>FO 4%h"0FI>F(p+x+%2 RO FAF8FM6O 4O UFO TAh"FnH?FHF,CF+(>bF=1F(F>px!?9#F1F>\CC"F1F,4B=3xs+c+i+O4t+&"(FF F)F>H?f!F8FF F&&&6IF02H?J瞹FeF)F,H?<_!F)H?5$..F_Fذd !FS$$H?_FH?7$B H-?{(FX7y.$7ޓ~ ~*~@~I~i~~)v~~Kh+H ko` 7F F@+F"!F0@Bo0*$ F"!Xh?>F0#?F( F H I? FH $ *-AFFW I"Xhf@hCF:F1F(FFA`GO0|{FFF. 8FjFH?R  Fhh?FFH?D!F8F*F(FH R0H?& ]8shFFF>FH.$F"hh?FH %.ۮB ")F )F H?45- C@ pO6 \r* 0lH?$O1Xh!?lFF H?!F6 F@FH?  K`xFBhlH?clաlH?H? FMhChhRhH?Dˀـ*6 eh,<,3B  Fj!Xh?FF6 eF(!FH?Y *sFF(!Xh?zF0FIH?=$. Fh?FoFH FsH?% FpO4/*sFF,!Xh?iFBF0FIH?$ .Fh?FF( Fp$F(H?O4/#\.*D@x08pG3+O0pG-M*FFO4 FDKBKhAKhAKhF8s$1FF:I;H?$!Fxh?0!Fh?+Fh(Fܸ!Fh?FF_F/(')F;FFFF)F$H?qGEO!H =DGE  K`K`K`KH?K ^*H  H?8<}*V/-AF+FO5(F!ph?!Fh?Fh*(F(F5F@{9F5F!h?!0i?~!Fc+ #NF0B >1FFIH>% #-MFS+FFM!ph?K!Fh?F!Fh?AFh(F@F!0i?4F8FF8k)FPF:F I!H>'8FFF!FD E ЫhC`#L|F(B >!F Ipi=(ѫhRF#`!FCFcF(о#a*-AFO0Xh!>!Fh>FhS(F!h>!F i>F@FTHk;F"F1F(FIH> )FF(*-EFO5(FXh!>!Fh>Fh (F(FFs1FFع!h>i&bFD!FH>FF'D;+ܺ 2FIH>FIH>%#!F OF  @F" 04FAFH>+0-E*FFO60F@K@Kh@Kh@FF@{Y9FF(R8I_h!&!Fph>!Fh>Fh~(F,+Hٲ>M*H%DD K K` K`, !H"H !H>,F'KB#F)F4F(Ѻ%D)FH>#F)FF(FIH> &{,#Q_XCH4J S P-A*FFGXh!>o!Fh>jFh(F7@FF8k )FF8IH> !h>I(( .F i!>BF+F9FCFIH> F=OztO0#x F**O 0>,,xh> ,O3$@ x*+!0>$+Cx{+0FF;}+# p(۹+FpG pG-MFFFF=F4Lh BF(F!h=(T h=EOeh>PFF8FF F=-G @ 8 (Կ  (̿  C1FPF|1FF8Fw-! #XBXA  B  BBB  4\E)FH> *FFh(F(3 H \ (hahho#O0(F (KS H> Fo,:F$ N(FV{=D9FF(F=" F4,O0,*FFO0]h"(F/I=? + hi(H>aCl $H>V#!H>O/аh(F/h!>F(FF@)FH>5 $&, ,)FH>'r1FJ!F#(F)FHGNZw"K`KhK`pGKhK`KhK`KhK`pGKhK`KhK`KhK`pG @ O0MFA`)FFF(`*FOa/hϱx I(F(hFH>O6$DDJ3FFH. I8F}(Fx?0F!?!F"F H>l!FH'0F M&0W+09Kh#JhY`ppG#I/*D?pGD8 K Mh,L (8(x y< u -M'O4>FH}0@#FF;u d F P ieܺvкs Qh;JB s(f(H0+7d!8FAL). (8(u-Bp=+F2F!F)H>)F Ff)F&H'&;0)h@F<8*hF0AFHBD>PF(@F@@F)h<+hDE3CD(DFB8F !B)p  RF)F@F ,(O0 H}@}%9X8HFF' x1PBPAK-``h"!>FH>[ F8d$F  Ozp=}F 8$)FH>>K F`@}:px-M}HFF'!>F.L !hh>.F!h>FGFpLEFnH>LP0=3 LpLP0=) Q (eI(h=|Fp!F:FbH>! F.AF@B]K^H`>$EAF[H>LP0= LLP0= ( FOI(h=G:FF!FpLH> F!BF@ CKGH`GH>FKGJ`GK!`FKGJO5` ##"0DK`DKpDKpDK`AKBJ` ((% F&  Р ۲B6 Н0²S >S+y FRp#&NO 3p##sp 3pN#p0 00qsq:3JXpxτ…9^e   VF PUU+D? 3B_# > _D. 0+D? 3By " (tS+M@#J`JHp#"KpJhBH3`+@~"+*q!"+jq𱀂xN :Ҳ2` "+qx`@(@|H+pO@q{H+y  O-*rtJ@y+pO#jrN"+r1 +r +*s"#ks #s~#&s+t#+p kpY#O psp 0T0.Dp F?D*U6#PJFhOJ`@)hFG"IK`>?)@@BKxB#`0AKhG,S*) F;%"KH`)F FK*F)FH=)FH'c!FH= K`$  px09:*-MFF:|pKhKh!F A\;F)F"F(F; K5D`Kp`!h 1F= KhD1F=FO0 D}($*L!Xh= `!hH= W* 3: FF!H ]O0rF+F;!h=!Fhh=/F!h=~H=H=W#F&%DB$B1FH= <F=:h@F=5D #F=/`U4O0nᆳޗ-AF+F*!8h e'!xh=7K!hDh=0F !h=(#F8  -`+D- pO0 *pF5!h .2!ph=!Fh=( -#h-##x-#FF*S:- D#FB+#FF*3:O0p FF)Kh)Kh!F)H=*-!!h'H=$&H(;($O;x-+.kBD!h (`h9F=KhD-!H!xHH=B K` K`- `.,D- p .+F J_H4*F O0pG*F O0pG*-EFF&h o!`h=AM!Fh=9!Fh-h=3( H /  x< O0Ƈ-M*FFXh :V۫++JO`hR#='O!;hh=;h! h=4FF'E$-#hhBЦVD8+F"FAFH=@$BF9FH=: F-##xb\绲,D 7O4$ׇ܇8 FBFB H= cAh)@8@H=H=&-M*FFkݧKx[x4 50KxKKKKh60KBhhx40<(!FkhYx.53Шh=Wòx-+;0!=L_. h=D_x-++0!=9_. !(i=1.6!hi=)"|I <hzH=O4 FF40r+i+m++"mI <F(@ԁ ػ @ȁfH=Y$w+$.&$VF_OB$\ 3!F 23(*!F20 30S!FFOK!F(;F LJLI ,(F!F GH=4Os2F60)F 6(02F)F=H=$6^ESEE8H=5UE*#K4 p5 Zp!K` K6 KKK`K`KSEE2F)F$H=6#H=FF$2F)Fq(2F)FH=$6^E605UEFFD<840@,=rvl26.4#2F80)FwH=k)FvH=g1FuH=c$6^E5UE?oFF80#6  @C2F)F80(eH$3F8*F_H=3#$ 65ZE kZH=&3۲SE?4EFTO;;xCE[EC3\h*FLH=# ;BEH=GK7B # ~hDHfs@=r*Q@)@08J9N_2F! "5H=-H= 32J*))F0Fs.IE-KF,H=籈E @)т)F0F + #I$J+F))F0FI# l"I < (.Q8h4a| X>:)9HA<XnYF=sFFF"= FB0`x-) PRxB"!= ` p #`O0-M*FFF@G[hxKh Kh KhKhKhKhKHKFphHx<(1sh[xx+-Ѱhvkh 3ChCj w-[j+hr-яH  #7w->/V'!=oGF#r-7/ V'.!@FF(h <(l-@΀ #O338kh 3,UHh ( S&E-6 BݹBF1FSF F'kGRFAFXF(@  E0jBFSF1FXF8 1F1H=+( E8AF-HS(=B4SF2FAF FjG[RF1FXF((F H=X02F_jAFSFXF.1FH=QFH=  E6O0\XTPLH`d”Ք ,?F0F r- ?zw-?r K p K` K ` K` K` K` K`K`d\XTPLH` FFRFH<6jHjHaoH<*MahH#5!(FBH)F<!yH<H<K!iJH)FF< H &}J:K IH*F Fi<~H sJH :qbhyKDyJB򘀔fPwH .Fg` O jdJH :SnH `(eKlJ(?.F:Eh0@fH M~eH I6TJ:4bH A8PJ:,_H 9*^KKN -F2F:ZH *,2F:&6-\Дgp7A2C1FPH<~?KFJ/F:h03ACAH .  FAFFP!F@H<]+0+0ЋiF3H%2Kh0iF=iF0H%/I x/H% .I x.H%-Kh0iF=iF+H%*Kh0iF=iF(H%'Kh0iF=iF%H%$I x$H%-8F!h E-#Obah3p!`hF( HMh,<,3B pl H>KlB+FbhH;j,<0WXJ*-EFV( YhF@ih)H;$ FhkZjj j!H;GoFOA@9F(OA9F(F )FhFk jG1FhkjGGE(F 0F H#H;QO4"<c%78 *-AFFW I "Xh @hCF:F1F(FFA`GO0~FF)F#%O0pG#0 FFJ 9,H;F F 0 ! H9 | CH;,F٤*FF[hx-*[xa+!<5,'&BK>HhOd)!b)c)O0%r)t)*^"O *X"O )&F*M"F!'(H    RE[xC  YFH; "F!FH;(FH;"AF F"F z B?zH 0 C 0h HBtyidĥ5-MFh#FFF 'F^F ;-`h x-)4!;A*F!>4/OP" !V:H9:7K8Hh; s)b) c)O0t)+S '+OF#)dF+EO PFM !;4FI;7H% ;GtP"!H9l۸9]* 8`1 H%;F"FH瀣yʦ9Φ0*FM/ 0 M0hh%FȱOa FJ;"!FH3(kh x IjF8#!% p #!O0Ȁ '*FYhx-( F%%p>. (Ff+O?+#F::FIT8(EO5瀣p!F"<,S_.x-.iF F%!o.a.f.нp@ ǽ"),FH% p*[h J# 8@ ]O0-M(FF}Z(^&O FZK#x-+ F.I:F(A6BO6B>  RF ?(D,="Or!0Fr%|:F)F s2xI+F*YF FI;0F:s5-1F F%:  H;O0 }ODF  ǩ)U0Wѩ-EF!} FF!Or +CjF ( !} "AFh;) xFBFù!F (//0JOq ;s. h$ h 10#FJH;O0};:-A*FFO4MIXh:Fй3+hh (w. b(i$ F"@H;Z?Ihh:8"A9Ihh:F8"A\3Ihh:"1Ihh:".Ihh:F,H-K-J%FO +OB(H 'H - :!,!X$H; 5"Ihh:F(.ݮhh0F9F-i (:F1FH;$(F eF۲r#)FH; |İ:bZkZ&|| G>-AFFT I"Xh XChBhCF"F9F0FFA`GO0$KK!F"FKH;Z "iF[hhhChH;w-EFF&FEih$H;[4F F #9F(FF(FjhH;I  Z#RF9F(FFFkhH;5@F:(7Bۺ o$Z# !H;O O WFӮ!*7F Kh H; ! 0IXh:FlhZ @3,!FH;< H; HYh;!Fo (0h-~Q~** \hZ !F J(!F H; Kh+H;O0YhH;h_0FK~F2" IkF! h*P(F +hca0"oK*-AFFW I"Xh Z@hCF:F1F(FFA`GO0$0*FH$BF0$ F 0*0\h! F;(!FH;<H$#J)FFH;)RFJ,ObI H>O4K^L9t00WY-EF2HFFF$#/J F(N+H$F! ((&K'Ih;&O *F ( >N*F (H$I8`0 *F (*F (V) o Fo ^L9t\*"H$|б!;!(#w FX H;t FH;n$HO4Kɰt0*sFFO4 Fp"XhF;-F"hFh;F(F#z0F#F H;9$ H F( X H$ # ((ױF KFB : )8! F>:(F8!?-M*FFO4 F^hI0F:9kF(@pF;=0Fx+x+]:+Cx+"F0;)Fx+ѺV" ; 0x+x-ѺF;50Fx+x-9F0FF!#0=9F0FF 0+CF:F1FpH:m$7F&FFFlK%O iKFSF9F0F}aM+hcH0FaI9(?#T:0Fx+?Hx+C*h !##fF(*h!FBAeFBH:0F@I9(0F>I9(0FM\l|hh9d d @,P,,HHHHHHHHHv8@FH:2̷Ʒշ1 $BȀ-A1F+OhQ!<1F +H:8F9H((63FBF9F$H:1+7"H:!LH:1)F@(#!(H: ! 1 !H :@F9N(0F9I(!FH:LivǸ-EFF F9')FFSH:o, F, ~B(, (W,9io~([, FCH:M ",!h>H:A "/U|"sT#6U!chF;+4J5JR# 13H[:"@F9( HSFBF)F+H:)F*H:, ( 'H:PF9(0F9(ClpF(( ()F FT#;p.u$)UF "!hFiF F0FiF~ cClhFjF(ClGаq ?$?Os"F(!FH:zP#-MFSH:n1QI@QJ F 1NIOCMHNK F:V1SJH:P FGH:H%FOEO1CEAHM::?H:5 !=H:.0WwK]չZr&,F F#, DCl(( (/7EiF Y 0h,<,3Bclj FhB F(clhBIkW"( FK`pHp*FFO0p"IXh8HKx#H9 "I`h8(H9""}I`h8P-zIzH9"qKxvH9F"uI`h8{(sHwqI"`h8oF-nH(h9gFFjH9 FQFgH9 FEcI"`h8KF(@-ݠh9EF4F()FZH9 !h96 9FBFTH!i xS+&E+QHF; +R# SSSSSSSSSf;ڲ *=H9b$)F;H9\3hnA!AA]##"d  E%%"0F0.HS.H9>$,H99$+H94$)H9/$(H9*+F"%H`"%I`h8 p@~"!F(FKp@bZ=5;FX ]mx>X1ƺ́+;?SmVp-M*FFFFj*0!Xh9[-F*ѱhO 8F 9F RF(H+F9#FZF XE *FQF"H9 $L! F(- FH F h ?YFD<(BF 1 qB FyC K@F`1hHO0.Fpxb*sFф FFhh9!FFh91FF Fp$O4*Fф pah Fi-8  O0*-AFF4O4-[xzl+ s+?!ph94F?!ph9F4&F/4FV?x-*)F@FZ.I`h8k-H9$ F%FF'H9&I`h8U%H%I`h8N/"`h9#x HiF!WFH9/H2F(XH3$!G9 ((R]"<@WZױp$ N M+h0hB#3`+`p#i4h0!D Th0!D J-M*@怘h*Fh_hġ86F(#mLmI#`8{F(r#FPF O50Fz-f"8FF9}!(c\H9 $X:!(F8O !hVM( (hOl("h(` 0Ii`KIPKJ Z`F(!#hGJ9#-h" UbhRFhYFta(F"hBцH8H80(؃HiAF2F;|(F mF@F0F(F ,wI`h7F(Ti[ !F<D?4$?@4 nF G AF(F$?CbH8H!F(F F\xi0(WH86O4WHF80zAF(F#F Fi@F}LI`h7(U#iJJ{`JKB HHq O4^F BO:AF(FhGFxh$7~Pi(׮(F&i 0F"#H8N,/LS'Pcq[5 |N| 1WHR:-AFFT I"XhLXChBhCF"F9F0FFA`GO0t-A "%KKFKHK84[  &F*0 iWh < "iFl H;F8 ,&FF KRF1!F@FH8=*8* 8]hI(FF@)F H8 F Kh+H8O0ZhlH8Mb|)Kh6(H8O00F 9Fqh#H8;hhF[F I8$0FLBH8 !F0F =!FH8(F #!FH8= %H5;hB H 4)FhF8m)UF KFh5H8PO0(F /F"`hF8F(FBFH87o 7 (F!F"!F H8'(F3h I[FhF8*F!FhF8 !pFKh6H8O4 Fp*"`hF8cF0FBFH8o $"hF8N)FF0FF()FH8 F6-AFFT I "XhXChBhCF"F9F0FFA`GO0&O``F8h FF H8 ` (`0;h HYh8 $h+H0F FUw" $KKFHK8sc  . F iRhj"F[hH8Y &8 FF!F H8D, F1+"FF H8@88*F!FH!F8@H8-C>𵑰" oF(R 0Oi 1".K .K i[h*K+Ish)K*Hj)K8h"F'H)i"F&Hi"F$Hi"F#H$!J"H):F%JH):F0F0"FFFH~&FB FHhhr6 3ʶ9HYhwF1~!F@FH8=*8* 8]hI(F=FP)FH8v F o M(h( H8iO0 +hZhFHjH8Z:sFSFZBhFZAFp, Hj86 F%(Fp!FH8+,ѱhH7d "phF8FhB2iBڌF2i H8FDF(бjHHpssFSFZBhFZA:Fp- Hj8(FA$ Fp)FH8FFph83FiBiBH8{F(бjH,FhF"FFx.8F? Hj8(F$ F)F H8FFhh8F8F1F(HjT"hFh!F@Hj8` F$ F"hFF`F@Hj8D F$ F-MXI h)G*?"~F(3eQHj8#(FNK(!!MJMHF(F"FFIH(F"FFFH(FFshh"h:B;њh@H$ F=IXh7x(;K;I;KI` =I` +B #h;#`#h+"chTo #o+phBhB\#h3h+ #h;#`B>6 A2F)D(D6"h1FtH*D7E  >ch;c`hAhBkJkH70 zch"h;Bc`خhAhB_H7ch{sh)N] +'s\ *$bhR@Fc`2)D6Z&`&B@F&B#'Bu 67>F -6 (6 ##h;#`#h+ah)?U6J7H7 ch"h;Bc`FC{+?C/J)h*+ YH`,H,Ih h`B` +'KS!`.#h3ahY1F(F6(F6F!h``BjAj+I hBH3h`BĿ#`BJR#` N #h;#`JH7j ch"h;Bc`0W@4D4{hBhB"T@i6chjFD#h)F`i(?®ah"h#` D"{fh#hB"ѣh;B6f`ڱ!hv.Hr)D(D6w#h1FT"h H*D7#h3#`>? W#h!T"hH*D7-AFF FF6"F! F8#%a#s`~F.D#hah+B yB *EѽYa`T"h!H*D7#h3#`-A 0F FFHhFIN3+F pAO1K`K`K`K`#`8F6COb)F# F-0.0!6 /4'*F(+x vOñ!+:hrK)FS"6;h3+̿3FF;`lKhBnJ`h3` F:hiK`,FF6fFw(BAo6F8F ,F~ (F$([ (YS !**************F((*(2E##7H#p`#+pO02Hw;!F(FF+x +Ѥ!F(FF@3B  .#8F#pI(,DKD;#3k3q3#` 0%(D4@4<4g`gH4Dw"KFpH4#hC`appGhZ`x(O0pGhxpGJ8?pGT<H7O ]H7E. "`B```aH7-F*-MFF:Kh\H78H$ F$iO:K['h]AFH747BAF(h68H7Fo(-i$'t<٤_&Fx I\  \[_(Р=XBXApGpG-p FChhFB hd`e10F+ `0F#hC bhTch"h3c`Tp -AhF+|x*yZ"`xC#hc`;K J5PIZ5)F Z5Z0 D  DOZp(F5/+FSFbhShF`9 и +0O c )+## O796R&0 F h F (.a+_F!.F52=!F5Op0F0!XY\F!0[YB0Fx50XY(K`(+Ҁ@Ȁ[ h/@Ȁ+%|<x<4=F!&F!0S'0B00F;0<7 0S'0 F F( *kIHp%Xx0+(;#  D# [/(F5^ #+T(DBp!(F(F7Kh{o4J`FEF 5>;h C (FDNF(I5;h(F&I5(F 5 7h(F I5(F5 0BF6pF;!50( HX6LK8 0;F43+6=)UF3|<-MFF"!dO8O %'  H KpBFF9F HOr;"! H!H!B9FH|#` FhG?F; +@ ! 8F+F8F@'D!ixJBwH6=F? "isKB#hx+=%(FfKbh p*  F"iGF/y)qAYFO /@R (@ۀ ! v++@9 +@5F"+@<>\#л|※;@- c! I_C #i FGGh?U (?R FG#!? YFb FhGF F#iG,O²\F!C i3a#i FGò\FZ_(!1 FhGQF)?({(1$!h  i2 a!$!QF! FhG=<11+-! Fi3ahGh FGCF}(# FhGGF'(?ch"AKO ` +Mch=H6#c`# #`J#[  &S FhG!& |G FhG!# FhGFH:)?tch+"K` +?oj"K`#|/?K E?'?Ϯ!?~EѪ|< K! K##Kh]11--=8M,h\ K(``KaC`#`` 8t<+8HV ! "6FH FHI!FH q H! H q HK F`8!g=-AF$Kh=k-9)F!H6F(H$\ , 0# 0 F5OFFH&!FH%F6b4FBp5@F59zl8FA"O1=(KQ pG pGIK [H0pG|00 o 00pG KF H0 R0 0 o 0 k cpG80 ~C#80pG pG 0IFX00O\C<0KF j hz0hZh{ h 00t0 ]H` Yp°)Fw )$FN(h0H6 BpsOr g@I H,1F6$(F $F)U0WO2 !HLFd a ) pG pG pG pG pG pG pG pG pG pG pG pG pG pGy8 D:"8 8 D"  ұ Rh2"J`8 IhR"8 8 0` pG80 ;#80800pGpGpGpG !l@J30%FF ;J;` [   >C '@@@pv @ @ &C _8F <!!R  !4C &@IAqd @ A $9C _1FBшB H5(F!J3) |  0Wgfffj pG"8, ,PdDPHLFa 0 8@80;#80KFhr H"b /3]@ pG pG pG 0 CsC 0pG H8d w! H IFx/ LH!"hH ` [px<3JH hF  H52F H5H5 0H5 ].FFH5 F4 m0Oq~@  I K J[`<( D( %!0 =v  pG pG pG pG pG pG pG pG pG pG 0H#3#s 0 0#3 0/.3 pG#FJ1:FH5c@,2pF( H5T$ FpN4hB)F4($h=="K`[`K`pG== DF("!r$`d` F8Fhj[kK(F0)F H5O0 KZh\`#`Kb``h 8`P==X#S``#J`hC`B` pG=-AO )bH58B_HR0x[E2ДQ-ZHG0F%Oz1By&ok1# p F D9F," %!"&!;xDj#C&!2&!) )1 3BF1F(F(۸@+7/O O4oг $$Bp3"F1F, "1F(FA1F H4@$"1F(F2co$i-MF:}, F&?(`"1F(F(7x1F / '(F:F(ր:F1F 3yx!#rq "A"! ;yyZr 3z#ssz*cszsx 9y"zC'1+"!(F#<0`@/p/jѕ1+@##d`/g+hn"A!d##AA(F#A(x(F(&p, F(EO3c& 'hOH 9BcۘH0"F4DE8F 3ad@Dd0&`azp a 9BW&O 9BWۉJhC#`KhBe#J` ,@4S@s@h#,9i8Fbc1+.+hnA!d## "(F #AA ( :}i616+"1F8F"1F8F61F F'! 9([H4 o `D`{h `z``a6`T 9 ; g#?LJ BД 3{iB/1F(F( 3;iB #ihS``#K F 3:i B"ihJ`` F`#ah ;"1F(F Е1+"1F(FAF(F"1F(F AF(F$AF(F"1F(Fu"1F(Fm"1F(F0i2*a1FH4co,$=@9i "a pGFhhnA!Os#"zAA"!#(#h9%H3Q hazhA!nCA@AA~ H3@ hzhA!nCA@AoH31 O0IpF "!(F7@C h0hn&A!Os ##z2FAA!#H3 hazhA!n MC)C2 hzhA!nC)C'0F p`-MxPNF\hhB FnO$3kzD4 CD@DD#hn"A!Os0+zAA!#Z(hI hnA!AA+hI0F zD4 CD@D0+ !F(hFO CECFFOs !FSF(h F(h 9!F*h9 E&(h9;Ѵ E 3ЛF  DMw#sa# F%0$0F j hOzuisBp3$=ѣi3H4ao #{+ 3x++ 8 @Bp#++O0 -EOF FGFѰ G&?)F F k{F+@)F F+ L0+M0+ (Zк +h9(FjGoQk{+B "!0F#3p0)F[sp#3q0@0600F+ ##0k{F)F0Fa+h9ՔB0ùL /.ݔM HL @ !x#x++ ++Ѹ  ݔM HL @ !x46O0H3`F:FFi(ۓLpLF "! F``##p0)F[cp#0#q@060 F+ # #0+kG`p=-MFFFF*cp FsF M!?-Lz0#`4P]E(!i%HjC "` *""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" w;ѧ ! 8F  DD=-MFFFF*c FF !-Lz0#`4P]E(!i%HjC "`(""p QFRbpObpOBp* q6 F* " " 0 %rGȱ PF" ;ѧ !w ~8F  DD=Oshn#D$"#DA-Mx FeI ư WH *F'?&?2 hzhC#n\ CC@CUK3`0  s`Y0`O3s0)FsssDOs2F# h( FZO0FchA03 hfzhF&#n&C0F@F FUA1CA@AOr& ( h9ո?azZ(Ox #:F1F h( h9azB( #:F1F hv(:hKB0zh;B;{+&B+ц1FzMw=USBCUSBS7~ %0 H4  0FAhH4 F5}"K`pG=(H3LH!h3 h(̿  @B=-AFFFL&!1+Eі"1;+@8"AF F'r%`"1#s#1+cs'P+(AJAK!QbF#"c !B"ܐ"(Fjczzc{ z{!{)0K+02H31J1K1H3 +!*ё*a6Lbrr+!*ё*!r.!% 3 1#60zѱ%0+#%0#h(FhnA!CAAA!bK$9(F*( ?O# I#`Y:\ZY-MFF'L (?hSrz0 "! FK##p01F[cp$#0#q60 F+ # #03kGFP?oH3O:0FB0+єL0:+єM0L BdH3k{+/sPF@`H2 .p\K@Ԙ0"+#ks B"I; OO "^0(Yb "!AH0[cp601F+ # #03k8HGF(sh ?(?Cs`"@FO ! "+H%##p01F[cp#060$H+ # #03kGx "H3EshO4b#s`Os#0 139ka3!;#A19!!9!?a4""O a/s@=a -EF c, o!FF(F8$ T F)0h'hn _A!Os#$?3zAA#"ABؿFOȿ;F !$J3#Os0I, ~#F($#FCrr1F(FF+030}F( IrFX /(F )F(7Eډ=F BoS @B0-MFF2WF$,!24F0`F00F `F0F,!2oF(=FJ'8F!XFPF@FPF0F~8F [F!F8F( @F(G$ 4B0FWPFT,%JKR(`S(B(pC(@UE0FB !F8FV% jBF@FI5>>-M'F"F[&B AF0FX@Fo5 I2!F(F2(F2VFB7!F2Z&Q'@,4 F2(F F2;AD@FF(@Fo  F>>-MF#FF Bjx+xC#BrSCu#`c``)yxOpn D xpaOD+z @rO D @rDyoyO plDypb:Dz0 0 G aa#bd[Dd&e>Dbe abbb048<@Defe'fgffk|##fj|RLCCfj| Osf!F G5x p%sF2BAC H#DB x\ *! FpY-FO0|+"I2!(ѣ|+|(O0 <+-M) [FFFFo0FF(#} #~@+F:F!6 |+D|+A%}5#Pp0~ *иݔ *є b:Ҳx*)هp0~0+иݔ0+є(#+܀0+F:F D(њO5x"#@EB# I )(!Dx A!A B3P۲#o%moj$Y-AF4F8HA3||H3zzHC!3#zH@2 bzCR@3@20P 3c{%{E%{EE{EekИI2=yEI26(U?eI2+(YEZE)FH3b|!|rH3"}M KIFK+FH(FN.FO/FFAH3f#~~I}K~HF3\a}}{H3W ~zJ  F)F@ F+F *FtHtJtHtJ3?tH3<#0 qH35#0_oH3.#0lH3'#0jH3 #0gH3#0YeH3#0bH3 #0`H3$0 ]H3$0_[H3$0XH3$0VH3$0SH3$0YQH3$0NH3$0LH3%0 IH3IH3%F&GO'0&?B)>Л ;۲+Aj=J2 JC2z<Կ # #5HR 3&5E;4`0W#4DUeswIX{/Ph6Nf|Y<+7<+3<;+ (F:F0H35B-H3 (F)F)H(F#F'H+y'H[kx+xxx3DF1F2(< ,`o-MFFm()j+h+^'Fih #i FG%FU$?Bbi*S SF jG(ѣi+8bh,Hl( ۢFZ$_UE 'H3)g`S GU ]F1(=kh 0H3o m#h [h 3` jGF(УF[$_+h]EU FhQF1x(=oo|Q-EFFF(7FT$oB F88F1 ` Fo V ?VF9F1;(.F jb```j3b o-AF0 FFFF#`Ba aG`a abb](F1w`8 F$ F`$cbbFرFU$?hBѠh F S 8F3F6ho8*(K\ pGl+8 F!(FF F8@Bp2[!F(FomHY(xF(FFij+"#aD$pG:B3pF Fa p+сi1 )؁a !a!ɲ)P]ɲH"ЎLA Dɲ+(S,рP β."4J4JQ\TҲ*1J!T9,рG,р(F:۲+ؤF۲+!(F=,O!(Fɲ[!(FyA,1!(Fs>,=$ɲ(FjN,?|O3=<@?t~!H, 2!(FWC,4䲤K#DIwwmww8FHQF JIY~ F!Fhl(F F8o"FIH24oBO4,,-MF(O OvEvД1+%<+!<+<+3F" B@SqBC4C_B_AT FFH26xF)ѓ)2 3'T"!@!F8KhdY90n FA1#hA!AAA)`( h`0"`O3`  F# " F ?Eo Fh Fkhjl)h\(ڴ !H2P"!I1#KKF( HIF1( F)FFIyxay -AHFFFElFF)٨"15B bl;F FAx&F -AIFclx+XєP0#P0&'9F" 9FF" 7H/Fblx+ ٔJB# FxC.# WJiP#?`(hn#A! S1 "Os(FAA!#"alH&A^++єP0Cs0&ElI#jiB + #3#bD$pmh(FKhJl hk((Fl)* 9+a K0hN+Ozw'zDl0hY1VB#h FKhJl h9( F: 1@0`i+j >hуhhXBXApG pGFuD`A``1F(FF5m F`'aG`0Fh``#iբh!hh`h?1!?D o L@$yiFh@h?1!?DB#iբh`hT #-MF%O@@;`[&0BZ&0S%@ kK FG(K`5>>>>-AFF$( OX%0BW%0S$k 1FG4>>-AFF$( OX%0BW%0S$Ck 1FG4>>F$ONW%0BV%0S$kG4>>0+ 0Y pcppGFIFFF1` FI10 FI1  0- 59F8  !FH22 %,a!-MFFF$\\Z%0BX%0S$ѽ0YD!lSBSA4 "B9FXFG4I 1[ >> -AF F$, OB4, *FX$W$g( >>m cS+@A2FK F m@pGF' Խ@ R 0Խ@F)  0ս@ Ⱦ@[KF !Bb pG"0+BF DL R 0 F@տ  0ս@F F@ȹ 0]NF ! _ȿ0ȿSp\B DO3!(0@ ] pd$x1K H @z ( B " 3  Q  0 DjpG ` 0 ˽kpG8FM}(h FlG#+`8> ` 0 @pG F(j# FGpF F(j F@G Kh  0(( K`>>Kh`FpG>KhpG>"K`pG>FFGhB 8F F,)FFH,'F FF(JB$P, F8HH` I` H` Ha HHa IaO3(?%~ }}~q pG 0Cc 0 H2 :-MVI Q` SITH` SI` QIa0PJaJFOHFFNHBAFF iYFF dQFF _AFF HYFF CQFD >$%  0a(_P,QL"^huhB% D:P,hDh``EZ``DKhB=BKhu`*7P DhB0h``p@h ԰h)DB6MB%"ca#a``AX`YPH !@`h2C``T29``D20`pG""h`` oOQ"Ҋ 82PT0=B#!@bh Cb````*[2T* n2 w2@TPB ~"|2hBBh"Bh40?<-M 0FMtKJhhC  5-N%4ZPhBhBChhh#`D`ZhBZ`0%30iIBpGh'z*GCEE`sa3a``BY`Qk $+ ث 83\"Ph `E#F+[3T++ n3 w3@TRBث |3?#~#Bh"W//hۃh``F*qa1aD{hC{`thOW' J h=J/Dh1W77o 8F?F2JBٴB@CE8D@𣀳hWDG_`*J0hB`'JhB` oOW"Һ 82 V<E<'"Cr`  n*[2T*: n2 w2@T\bE ~"|2$? ?4<?,>??E "B Dh$CEhE`h``Hsa3a``Z`@ DchCc`hP/``mh"\ ;`E?%*3RB;Fh10DGDwo D8F C08D;D@B0?5"hZ`hch#[+"EC%Db``k`"ch * C c` Z`` :-A#KF(Fp.F9( q*FP,E"'B(:F:$**!*!`a`"`Z`` F$*``!aaa#F! F$4-MFFO@FM 0ԥH0 +O T숿# .VE 4K hWhB'Dmh=' B  B6ܧ  G`W`T<C DFVHE% " FI0й,! F0FF F1f?F)F т Q%(F!F@H0V(lBlH!F@80F(4?8F0P! F,F F8P"!F< FhKHldH3dd `  `o4?!-MFFoFmF&FZBѻ3(FI/6. llNS``# FddVHOB  "(F10%H @ XFE/H%5-$ho(?4?K HddpG4?0> F,0%P"!FdI/lKKKKKP"!FMI/UK"K#K&%l F+0#bhIH0l IC?;7/13;, !!KpF FHFx% /l&! FF F(Fp!F*FA#4FsU&*-AF'AF48H0 )F(7BO0&FH `!H8 gK H0d.  H0W"!hGFH0LV&  01H06 KF ^ Br j1HjH@0-E FFF'8F.!/x@F/F#'FO FBѺ*F@F!h/~8 h/B'F  4'FKJKIZCÿ\m۶\Fih H0!hH0`i HN J -M 8+F Fhы3# Э F#!Bb+f.OUFF+hU/hhz``/ (  zhhE,+`EѸ%B#;c 8k7FJ# 3>Z%`(ѸCF !2hH0N5"F1FX%88{ 5;kBX%H08 %%/7F FF , (O KOs H,0(OKhhOs?0W-MF# F/F( k#3`3F?B4B0J`#F$0U,C+*л  F@F)Fi-$4` F;FZFQF FF M`G.!@F/a8@F/jF$5? U,F$ F5BU /SPERF@FU/(ѧBJF$ Fo2-MmhFIh /F m0F/!%1Fȿ_̿F/(F_xF , ,t5A+FK< , ,@- #B%0-VvJwK #uLuH*FaC'(s([и s=S%/ @F/"F@1DBSDB{$t0 02U"pD ;``5S%x$+и #IK! Os(((G( ( @XF/vSFFSYF"-?@  ; 1E2BF۠ Աи  =S%/G$, "vPFU7|H/5FH/1N%F (X HH0t 0F/'{M+ HHX =DHF\m۶\)U?*8F F/( D<.+  '&(F(є4+94Z$x+F ) %!xa0* ZxA) 2Ҳx*%30ֲ .١A*١a*J;B4#*4# 4#4zCO0Pt '&%O A_ )U-MFFFO pL)44+.+@O +404,/04B o0O34PF6F(s)є+4 +$ 4BX#DB*4 $%4444뻔)4+4+ݳB3FFF8F 4v[44/D+DD4$4D () ( (ѓB (ј8$ DB8$[4;۲B7  o$A$- 4+#)4Q(4+  C y434F n#)4-Д+4?|POo(4+  C V434ApG FL4;+ ? < 9 6 3 0 - *M#)4G(ڽ@H/A0&KS HpGIK[FHDB pGAhB0||pFz L J Kp@޿0FciGch3r Fp4B$||pFJ K LB 0F!h.`hp4||)F$ F!4(-E{F+SHEh;)O)LJVLHE/B')K5) ) k)ܡH*CK@BHI^ 0~)І) ;jQF8Os`j+0FCCCD#`ꉫCCc` i;I,.+y9ISBSA*x[*C d SF/(%" R.+yw0~)yA )  5By-)2BXF([%%`siIc`;jd8Os,`._RPIS0FAA;hD00:hSF Fx`1 <hFF"#F]-MFi?#?@F FF FH/7F W$?#F"(*F=H/ Fa(!8H1bxsDF{` y(JM+%#y+J{h4Bј0*+Ѹ 0PFAAjYD-ZF F3F{hEѨ(a" BB+LL*D!x(Ѐ)IKj1FHcF/J-6( F*+ѭ)IK <h0WFH/#"#F FD8 @BpFFFFF3F"(F(JIH/$ Fp(FmO4M,Fi Fi-MFiFo FFгrN"3F! F(3x+'*FahkH/O:"iIp.G@/+FbheHq/O 0[0E 3F"YF F(3xk"XIYH."F/+FbhTIUH+/*FahRH  lG"K+YF FDK(/+FYFbhGHRFYFSF1 2D*+/*Fah?HU++/*Fah:H:I,-)F  FB@"! 0 +ЃBш+/?q)Fbh,Hj1 2op(D+/?])Fbh#HV0+"#O4s0 iћ0 PF0Oc#OsE$[aE cF#jF!]p#!F0ahH. p H.% )F#H5.#)F F02# Ip" F M0#\.#2$*;#$0HpM-i!FF@2D?4$?@4 ?$?#F"!(FU(JU#!Bsty*Z@@(3B 8FO0F`"!hFv"iF F-8 -EFCxxFB"xAyBBxFBby%C#yCCyGHCcFIBBO0"AF ")F@F9b{#{!FC#{(FCC{Cbo"F @FtSEc~"~aB"~BB~Bb#C#CCCcBBє)0( -B"*0BB+0Bb,0BC#.CC/CcuӔ100 5B"20BB30Bb40BC#6CC7Ccu4O0 {EFI PARTFC~~ B"~BGB~C#'CC! CeA!" AA$ %.B"&!vBB v#B lv"w!Bw"! : aw" Oa"$0Cw% p#`&0+1 '0005C#2 tCC3 `tCc4 3B"6H0BB7tBb!BIAK0#L M0CN0O #{b{JC#{!FCC{tCba# tctCtt-MF HF(|,zІi@1F1df?6&?@6 ? +? "[F!(F(F_#FQF(F(FWcx"xayB"xcHBBxBb#yC#yCCyCc\IBBQF FjiWn"8F8 "9FPF-h#"QFflQ P0T`C#R CCS CcU F&V FFW Ff^C#0 7F1+Юff>QF0F1 @ F(Щi0F1I0HFA!J0KAAAaSF2F(FBPFkQ P0UC#R CCS CcT B"VBBWBbZCQFsY X0C#Z CC[ CcB3  IGNOREMEFm Fi8F1l+F"iD0F( ;F"F0Fl O0O08oiF H )FO01D)F1@(8 8i8!F16!FQs#F"F F( bi# FV:CXBXAp-EiFF!F[ F1 C?3#?@3 # ?E$?{`o 7F!F0F:(#mSE@FO0 t< F(Д!0 FB""0BB#0Bb*`)(0C#*CC+Cc3k`i`{JF ! .I,-Q"I F-h00@ [O@H@d7 60RC#P0"-@F: ȀF|-Mi!FF[ 1t%D?4$?@4 O *? QF0F `.(FH.FH.EH.EH.P0hB7F F`5(Д!0 $`H("0 FHH#0Hh%0F&&0FF'0Fc{`) (0,C#* CC+ Cf- K+. KK/ KkkBF)F{hH.N100 5B"203BB40BbC#6HCC7Cc./!F H.+ H.&~u-AiF F[ !F1D?4$?@4 $ ?(?:AF0F|`p(F )F8-xhK F7Fo-Mz`iQ0FP F@ R0F@@S01F@`81t1F@1lf?6&?@6 ??*"?F{"!(F;`(F;hH"!p;`JU";h&!"ơ!aji1F:! !(FRF(FєQ P0UC#R FCCS 0FCcT B"VBBWBbZCyh#Y0Cb{Z0#{XC#{CC{!FCb[0F# tctCRFQFtt#F(F:(Fo7FI0HKA!J0BFAAAa{h(FE F100BFA!20(FAA30Aa1{hEc~!~~A!~RFAAAa#F(F(0F-MF(`)0FF&*01 FF+0Ff00 FC#2 7CC3 CcJ~ ~C#~CC~Cc3I0HH(J0HHK0HcOQ P0FC#R CCS CcT UB"VBBWBbi14E W ,W*VBPBBPB  !@# ZB"$%&'~ZBEt)rє1 05A!2 AA3 Aa4 B"6BB7Bb ()@ +!, -A*./ $I"(F"G-FF"0EA !H0 8DB0 H"49F   B Ppx75Q2FD]"qoLoIoF E# pF#KpI#p #pP# qA#KqR#qT#%'q\# rMrrrMsssvMvvv wMwww sCiF;" 0! B" #0$P%P&P'PCi4P";"001 B2 305P6P7P F#I0CHJ0 0K0E,0/0o"() B* +:F0FLPMPNPOP-P.PP0QPRPSPT0UPVPWP%tetttXPYPZP[P8-@ @B-MiFF[ !FFF1D?@ !?F"F!GiCp!F1D?@ !?F@(FKo  F"F!)CFZF)F0FSF:F)F0FF(:F)F0FF8F'(F$O4s#F"F F(O0p0h !0 %A!"0jiAA#0:Aa$0C#&CC'Cc+B#(FF8O0-MiF!F[ 1"%D?4$?@4 G *?  "U#0F Gri;$?F+F0F:F8"F(F8@ѿlF0h#hkhGFpGo%pGp FFph[hk3iKQ)F F3ip@GFpo%F0h#hk[iGFpGo%pG-MlF+F 0. #HJHIl.$BEIl(ۃ!FCF(9o ("FCF(F8IK4(_@F  SF"F(F1I8osB(6B_PFBAFPF&(ڨFIlKFF [E)Z/ZF;F(FIorBF$ &B  B_@F!P F0h#hkiGFpGo%pG8F$khB 8(hD(&4F0h#hkiGFpGo%pGp FF&B #h6 4 F(&p-A%M`FF+FJIlBݴo5`o  FOA`*b0`(2h)F8FEqh0hDF51Bq`$48F$khB 8(hD(&4pFF OA*(FHF1F(Fu(F Fpo  pGjpGh[j8" FFIl!F b(F#%`ca8F@F F h6F@_F!j/\cjCCFpF$!FF(FFX"Il b"Il`b0FpBLm_JR\@+9 X_Jh_ $Y /KXCHO@_@B6n FE*G*0_2#Y K* FF/@B00_?6nB*FFC*0_0_#Y/08Fh!F@hziI*@*9o$A+Q#mm Ҳ/Ңr*(o8ҲF`h8@q@B`h8@F4F`h8@ch_!1H/^H6nlsiFz+ FЗ+*h$#hFh(hiB і*ѿ_O0  IlU( I+@_Oo<poo}8FF(F6`` 8JIF` mOs`OsFC` "Oq F 8L_O %`hYh;C#CCC|SCp#_CQSh;CCCSC_c`Sh[;CCCcCp#_ `+?_O`88F _(` 0 8khm_@COlh-h_OLS! FJ#e! FJ2_s ѿ_ Kcf_K0_K#e +D|1s38F F_O@3! Jej2_[ տ_K#f_K0_K#e8 +<11?-MFh F FhF!0FiFh-J@R-@- -1-ojA+R#I/=-4$o7---+0O#37 ,@-IH,a=-@Bе:ҵ @iB o$ F s+`!FW/?(dݗH!F D/#0jZE-\G-eћC#CC_0*F9F0F MropDKB KB ؀KB&ЀKB%o~KB%@`_O@ "#exK! F2\2_ տ_qK#e$%% +#@B@@@@_@@@@_`!F8D/B-0CCC-Cп_0*F9F0F M#PKC#_0AF(F/EFF)F F/)F8F/C_@_ ?/!FF)`0_?0_/J/M+F`!F(D/Aɲ)CC_0(F1/F 9F`/O8AF/(0 GCJ#cB('"FIH+O4Mb^,IkZ'@/,0g#`F"O YFEP/HF8F/_ _#S`FYQE?F"  @zoOzs"F KILH+j@p_O@C!0F3e2_ +z_:K83e-OcC#6JC_ 3JC_ _O#0_ g+S_OCg!F'H.-0@@@__ CcC_C_0_OuQ_O# |1+#_|QH!F D.8P@@__!H1^, @`5n6npl FBFV4O<<<B p)F F(k8?0 ?!F@ F8!"F(F)(F8F8@ -M0FFFF#0xhgF(@P! F(׀O24Ccc,bc `Ca <dcdabd[hZlCh[lwdh) + H(*(;ks cl Ccd9kU(`[hkIcl CcdF(x a3hk3j[hlIcl Ccd4(c`k4cc#d` FFh.:[hh+DѸGclC@cd(F FGF( FUF&#lkS``clc&dh3`cl i,##aclՠh$#` F3hj+ FGF(лi+ FG FGF(@o o o oo 4#$FhFFFJFl_ O3(F#oO08F(MCl/Ԁi0%hj(,#j[hXk0bj"YlH`bikhPkj[hk0j#)lȱb#hiclCScdFpcl%(F8i+)lp(o  FMal* FGF(osF({Cl$ Fp" F2F((F.hF(?ѨiklCkdi#(FF(1ѫi3l+!(FF03ic(FFh!(F/Fklս+j[h[hZ+(FIh[j+(FGF(kl(F#kd(FGF(iC+j[h[hZ+(FIy" F(лoOhpGhpGipGipG@jpGjpGpF&U4O<<<B0Fp FkD<<0 FFF(` o P4?B #<; `pGhki42B #<;` pG#`P4?<;<BojdhdhB `k-EF#FFF0V4O<<<Bo :FQF`h*FH`h*B@(FkpFFF F*3FF!F(Fp@˿ipG@ipGhkpGj[hXhpGj[hhpG]Cl i+k43XBXApGFpGClCCdpGapGbpGAbpG`pG`pGapGF#F!FF(=)!F(D"1FJ'iб+l1F]FR = F!FO0!/plF F1F'!2FF)F Fp@-Al FF9FF' #F:F1FXK(3F:F)F FA/!ɿ#B?F!pFJ K LB$ Fp0F!h*(D4IK[FHDB pGAhBH0-MFO &KL\'=FB  .F 5Ѹ0FXF XC+(FF7(F.FsFFFFFH*F F#poO3]-MH0܀7M8LFF #`0F63I 0FFd% BDF B *'5D B CBD4(*(  0 30F"lSջ[F!F(/;`24-AFF$%F,(F F FH#!FF8FcF0.F F5FF-%pFFl9cl F0p( #hl[T4_<=<B ((F1FkpGKF  F J37h d(  oOA@OaF  lC]F!WF KlFˍ(FpFT ~*FF@6.pF й F F Fwp!FN@@ 08F F(` `8FJFP0h@8B Ch[hBi0FF+K# `(C FF(B! 'F(>1k) (, `#acaf``` hK`!aba`j FGF3k# h9##`ci"iS``##aca F-(F<`%o 8`o"o_o -AFFFVO,<,Bol'B@(Fj}([hh] hpGFF$ FmF04,O4 F2F9Fh* ((h*!BF*F F@ٿ#7 F`FChB!F,;,Bo+`0j9,;# F `$0R?B,;#`#h`jj2B,;` pG7 F F,`0-EF#FF0!FȹZ_,=,SEo :F1Fhh)FPhh)BP FjopFFF F)3FF!F(Fp@ChFZl hj' #FS/,:,B0O0ljBF#7`K FFo0(R?,;,BЙlB+`j#s F`opq(T?,;,BlB3`j#s F`opS(T?,;,BlB3`j8F#FF#`FlO2z"F(F8@o8sFF%SO,<,Bo"hB F,`pj8FF!F%`F8#F`"FF@#F`"FF@׿#F`@"FF@ȿ#F`P"FF@#F`_"FF@#F` "FF@F##`_"FF@ Fi!F@hFl]r# ` FO0#h#@F~ F #h+oFHh@hJFP 0h;@Bi0;FF@8UO,<,Bo FXB F<`@3jj,h`3bc`iFkj[hiKG0#kjS``#b#cFj[hhGFpGkjF J``bcpGjF[hii G(j[hj F@GFiF+#j[h[iSFj[h[j+ИG( F@Gj[hiGFpGhR?,;,B]j0 p FFF)JFR?B! رKF``a 3`B`` phBhBhooo 0)LFT?BohBhB i`0ho8F)JFRhBohB hB $#S```D` F8 F$ho8F(VClS]Qhi+G! FMF(D FF(>cl F)F Fvcl F! Fncl Fz! F` FFi+#lkS``c dcl`hc F`GF((F8o-EFFO U4OT<BPF#hB FF8ahH*Fk4F<hFj;J#! F#j[h[kC F@! Fi{hRkj[hkC F1! Fcl#Scds FF(UClH" (?F"F(FM6.ho2l);#aR2+3(Fsiӹi3l _KFh(F"kl #kd #(FG(phj+(FGoopo-EFFF'ozT4P>>>+R\Ҳ_p ph((RZ_RZRZRh((RX_RX`RXh(( _RX oF F!]7FChjFF`kh;+   0#`00hBRمh@Ni,%%BG-E iFF F!F&ӼF&"F&+-EFFFF"O2##(FFFPFF)FJ 3F&/#ӿjF]! IF FI}й FIx  FIn( FIh8 0C 0 FI[( FIU( F IO( F II(2GUc0 FFF%^@ 0 FFF%d8FH F("F)F8@ F8qFH(!F@ qp IF F((F IF`%N FV(9(Fp5 - y FhhhkiGchD@  pG7F F2 o hB BhDB *``h`0F2 RFHFh,<,3B(FclմB FCh`Dj,24\2ZFlFF,  F#FF1F(Fb( FFsFF? ȹh,<,3Bo FhQ(F'F(2F FpjhkhGo%pGFmAh) F@) o% hk[hGo%pGo%pGTh;](8 ox8 FChF,,G( ۰d !F(F8@Jox8o%F%hF F F"F F"I IIjFFFF:F1F(F <#0#FYhkh K@ @BCCC" F#cFOzp'{" F FO`'l F7F))(&ao+ F Ea 0*,1[hP1hF%O01@#"~$ F!rF(&FH( (KS HpG  #0#d0 F#" H#`p)FNѢABAAj@,Hd)kL!!CBB@r#(F"F0'yOzrF!(FbCF&iF(FF8Ro d '0F'XBomFp!OtoOzr FJC!F&O(F{pS`o9B H(IoE,6Ozp'm4F,H(6om@0c#0#" ] #0#Ch+ )##" ]#-MFFFzF@hF`(Fz(jiB&H'&0F Fao(2FAF FPFFEUF(]F-4""!i boٹ## FHF- F( H'9F*FBbo /DѸ"#0##Or# ]0JAh}B }0 ?$?!FP(ѕ 0BoI 0Bѕ 0Bѕ 0B"&(@p)F F}!+ #"!0FjF%- ?%?)F0Fp K*F F }p#oFEChJ?C|BF} ?%?)F`F(@@Op(Or)Fy0+JR#Ka`B@0RBR^#C3BOPpuK((bB0j00pZ*#k0f0 i /D g [0#00[0#F02x<"<D*L o02 #CR3#0E/ 0B0 iD02 #CR38# 6#([CSR6#FՕ0Ѽ3#"F F Fл#000#iKG [CSR(#0 00h00x0&0F }0l"D330(I#0o o?@@#"Fž!#"!)у#"-EFF'_ i0"#!(FC F(? N1F(FkF(F F-M} o*FF&?1BhKDJB ٦H'o{ F }f0ўH@ HOh/58F!F*F90!FF*)H'[o+i[FO F !FS;0F*F  9YFH'7B k 0# C˲D#tH1F(F~F(і 0B0DEQFjH'{ 0+ՐLC  "OP zFF J_* (њE Ж0RHeIF0NH'O4?+?<0#"F(F(e#000O O"x!(F۲ҲF(W  O't!(F۲Ҳ{(8я'FOZFh!#(F۲f   _73/ќ"!(FOh+?Ԯ0SE#"F(F@FSF"!(F8F(нF?1c;lBhihB(!FB8FauFpG-EhFF-@ĀyIwI#1# Fa#u$(@ FD(@O`&(y FFF(#of#a F*F)F F FvF(i F#r0#h FhSK@+ #Os#*F@(0+JKc`@8GN 7#"0# F)(L)#0##hbhhREOCC F(3+ ۸WOzp&)F(?y&0?vj#xsbaF(?z(F #cs#a#Jahd0B2b`%n) F &F)! FF#k+ 0F&zd &Y5#0omH'o^FFh[hCSCbb FL0`H'oz! F(#0-MFl`h(@~&0+_%0P+o#40## "1F F`F(@"TS#3d0*F`#1F Fs`AF(@ch"+1Fd0 #3#s`d0 F`)F(@bhhuiiOcdHd'eOb:*Hvxz| FhF( 1K#hJhIp#(Fb#kP+ F(F&7F! FF(@E#k+ 0F&(zd &qsOB#a#b`d0cJb`I\IQ#0!SC"#gfch! B+FW@'i0cg/5O C|CC'%3  #G /C]CU7=D(5OsO O BԿbgcgB*,.024g`ckZ "2"1F F`r`X#O3d0"1F F`IF(@#O Fi0F(@ Fz FdF(@2bhQI*W7#P0d0Fb F1F`(@3#3# '?`1F# F``(@;hcyhSE +@4HO3KFc`SHjbhDCSb.K!dB+O G'?#l0#@# # Ft``S`(@‚iոhBjCbOSORj#jN@'xwKB?H' M#xJJJJ5@s\l/@@@@@sCs5KyKw"V<;B6O S+V<;@ кOк_к_#"!o F!f } +O O7#1#d FDB"C!F(#!CHOH FBD F(Ѻ_## FabhKB@߀V<1+@!of"0 F17#O 0d0"" F`A( #0@## G(?"``S` F#(~<S/B`3 +`haJBaJ R#00 `Qa|@ OzwxC*F~C`1 10Oscgg F#CsboF13!;#A19!!9!?a4""a&aoB+@Q*hBB2Isab0 \0W &m_ +Iڲ"BT I&ym#IC^R&o#`OV<#+ԮO#0##KH$@#`# G*? F`S`"(0CE?  + uJ R#C ! FboI0B: mH&mOb01jJ FGbHGjHb" F!o@&`KCE1F_H& "X<;Bh < EX<, C B@XH!&FPFF8QFH z( Fo}عFO #h F[iSE(SFDFBiB F1FBi#H&-:'8F-3-""!i oSC # F FH&h- #0#  F HOzq F(o Ѿ_Ch`OzsBhh_R;FpG pG8hFB FB)@Ck+:ИGB;iKD)_"cha_JchbBsahj_;#)ۿ_ch`_!ch`_Ocha_chbBsbhj_;*`i(8 8RFhi(Fi+УSBSA_jhakh[o_ jC3_jhSgjCP8##3(FG(!+(cj+ II8@!@wZ2-MF FFF%nFchl_@F%dٿ_O2chZd-@h_chb-_khOcOsyh  *: * CCCSՈTC@CNHCsCB B_chbJch[l_X@1_bhSd,zhVXՒch@#k_`chk_;ach[k_{achk_a- $%P hh^CpC))0Kj+ !!)OzsE8F/hchD_ @p8 *.jh*@&(逿_bhQdbhl_DaS̀LBBF(0F gE@BC680h{_chahhSC_bh! Fb`*h)hZCkh+ ##~F(@! FJkFh_O1bhPkh_bhP903k[h_bhB!3FFh9J)F9h(BCN :,@,F( 81@`F9 @F*F?!?chh_CsC _bh`ch0_C_bh0h_chahhSC_bhb+F:Ůom PFk_` %&bhl_9$y%@Eom _bhD8(@khfh+k'h'D%F3h_7W(F%zk %ah_G*bhl_Db"jLAQBFF(FEѱBҦ  %ahl_:ѿ_!bhQdW"0_`h22&&o O O kh_!bhPchh_# _bh`Jd %Iom Fo Ao > FFhh3nFF3# ?*F!F#?FF+FphF#k FG_&ch! F^`(K+h Fh_O3bhSd_!bhQb_bhSa_ch`#j;chl_ C3D#b[ZCCCS_bhd8 cho_J" K K9 ch_!bhP_ cha_ch`po h` K`a`hC`i* #S#CCCCSCC`OsCa08Fj Fkj!*ћi+d!F%( F 88F khFb(FL`b"IlKccedIl`c"Il( fIld#IlhPo Il~( J 8oK 1Cg -AFF(FF(F!FF(F&3##n #dd00FX02AFQ cd(cl(FPcl;`k+shCSs`AӾFqF  F@K pGhk$hF`GhkdhF`GhkhG𵏰F FFFJF!%$ K2F;F)F F9(h> CSFkFh#`pFF F#"F#AnGppFF F"F#nGppFF FF>E5 H%qo Fp(F2F(0FF(F+k@߿𵑰FFiFű)F8F()F0F( Fi@"hFiF FuemGo@Ǽ#HAFF!`G#HAFF!`G-EF XF p(FV"FSF8FLG( 0D0DJz-o hBHhpG1BopG8# rF F 8 JBsH#+r)F( Kp z  Kr ~  LvLj wJ[BJw~ vBvzBrxBp01+ + C۲C## pӲ#KQB&qaFO0O7F"# F *F 30p `H#H  (-MF F$$F(F$ B 0+ hPH%3omlq F7G(($1 ` ;F:F0!HQ FGoCpq;K0"BO OF@p"# F :F 30 )H#H   (۝p0*й0ճ hH%0 hH%#P!FHQJI# hHJIJI?b;_ w?[JIc?S-M+O PF$O PC5)\HBY!RB(F(FF,1WH S!#zF(ZARF8   B  BFOP(FH6GF8F}۪ I@A(FPTDhRD`B؉v8F(d#FRF#D:F#(FPG lo iFg-MFFP;(6)@#Fh40TFO(F,@(𙀸#c#40#Fp*(t(FwAABEO09$4#0#"F(F 0Fh,2*[E&D <$!R8I@B[ B8F(FF(O!#0 1"F 0 1(F0#cTA$2F#GFhF(,iI@Aoc FloO63Fk#l-MFF'SiF$!RTjMkM@%h#"@FfI 60"!hFE#  0 "0# FiF  ( 0iFD !0 FD[0%"@FHI 0"!hF#00 0#0#iF F3%7 /Ѩ o O ",I (~1~B~D1а"I (0"i101B Մ qOR"a_۲+0 d1" !" ! #ݷ]7𵍰FFF!0"hFFs#0#iF F!5p_iF G 𵍰FFF!0"hFFP#iF F!60p= ( FF!0"hFF1 !# "01'+e0 є 1#0 FiF! X iFB  FFF!0"hF#!v a !q50 iF2F F p.F0D[۲0(F iF D(iF( A1 D pG-AK111K!L1K:P1KFD1KpH1K81#,w_e"!(Fax#h`3SC+`#k`s`ikiICka0hlYki#ka!)!jivIBkaaO`( ib"i B Ob*;"2 {JkajciR ObP k"R uJCkajei Obp "r oJCckajgi OR " hJCC C2ja"ZI aJ iRC@3ka2#0XK0# 1#aiWJ@X")F:341 #[h)F FG41#h)F FGk[0x@FlEJEI%[80@0##phcaO@cc`##;Ke;K#f;KcfiB$1C$1iB$1C$1iB$1C$1iZB$1C $1i O@cOSc`h1aiԻhki#ka81+dqqfє 13+۲ 1++Zo:ONKNN1Lp`JCFeIzʹ63h+ 0hRh!hH$or:0$:(.ЈNJI*F1F FG(# 1h1JB !B $! FG(q!y+Љ+п+Гi7 Fh#(1#xFBF FHqGI@A F41y+#! FDq:G(۝px' F?(q#BF! FHqG FK[x 1I# 1h#a0 (1)3K3K FG(**Н*#!F FHqG F+|'H1k|1h1h1#i11$!J"<!J"6!J"0H= FyOCFBF!Hq FG:.w$w"ww w0W( pGpjFF0X_0kacC#C_ +a#/@6F F#)Bomp(i_ #kpFFjcC#0CX_ +a#@6F F#Bom+i_hi_p #;FF3 8@tT- E?8Fz43`(Fo -MF]F:8?8jBO?@0F?@XSBJW 0ED+H$O0"F@F=;,<!<$)F@F sh0Fd CCs`OC@G 03+(#8_O3 S`0( h_# _ `i_#S#_a0@pj FF F3HF55!(FFi#j!(FFXi#a!F(FF0j#X Fp-MFF8F%4(X+FgJgIlUݶo$Xo 0FOAp"0$(ЫF$(YF8FK](OK$$(DVF&YFNH$($t(@.F(8  3E(88FCI!FP>HO1F HO0"O1(FOzp"^-A !O1@FFFFhSBrh!h[hkH1# `$ F*FH#2apFF F "O1"O1(FzDC(Fp@ "O1o-A?F FFFh )j;FAG7iA&CN.*FF FA]"O1o-A?F FFF# )!0FA`GA#3 K+3F:F)F FA3F"O1o8F/F%(F8 F(F F( FFl `( (F FI+ FIFC FF#F(F Iw( F( Fo24hk opGpFl F($ F%I(F#FxZ !J#l,Fo% p%B V%jFY h#FFFX<#hbhh H#5 J IjRhRhZ*h!Fk[kGhkkGo%pG"hk[lGo%pGhkhGo%pG8FhFk[h;G)FF F#c 8o%hklF`Go%pG-M} Fh"FIl#h+o }x+#` 1FB# P+A+hEhh[hB-l#\C% CD[i+LgHZp;hj+)F@FG(h0@9O Z0hjBѐB/қ0+ $+#[iXոh$  0E ћ0Bћ0E0Xkxh(x (AF 0+63nQF@F $F 3O ": 9h"E0yh)@F 7 *hhh)W!qoqo oqoqoqo o o oo o o o ooYhk+?J F)FG(Yh[k+?>)FG(Yhkop-AhO $ pB ѧBih`iz`*zp|EnxB4pFFKBFXPB(Կ  JBXYB#ɲ!p+`0Fp (OԿ&&&vA#ɲA#ɲ-EF F~l"hh#F,,OA]i;)hRX)՗h   SF!F(Frn@D@!F0F h8F( 0@@i`BXAB)WhoK@ S+B*0(opGFpGK S+B0(opG-MF!FmJu F(J(o(F!FX`dJu 07(` F FbFO hh0Q_hgE+`O `zwD`zF = D@۾@FF8 =)vFF2!!|kD@ADAF,$$  6tDtFOjEOjwE,  l2 FFF) FF8F ' |E'WnGWf '$ |E'nGfo1-E FFF, O FXk 0VhhsOw5F!cBX\B0d˹9F(F"@#D9F(FF0Fp'#@*-E FFFFh|hPh+9OwFF, O T!cBX\B0d˹9F(F@"@#D9F(FF0Fd'#@N F)#DFhFXiUhhiF ;|D1F(F#"@@C1F(FuD#` -MFFC'F,8F FMF F*(=#   U Uj(FF(FQF(F!F0GF9jq V,dBH D%x!(FFo%o-AFFF`iS8F4Fѐ$05j8FFiAF8FGF3j{u 8F(1jKD%2 8"WL0FBа_аOаO аaO а?ЫFH!  !FH!LP0!L@ILP0!- (H!c X AL@ahkj GopGpG FCi ```h`Zh`h"thtibt[icapFF(F_#"F#!jF(F)?o p"Il` a"IlZ`"IlTbi`IlMF`ap(Fx_`aci+. # a&#   hiDh@XXpGoDi! F F@!o  F[!@i$@ihh#D@ZP8 F@Ei!(F "F!(F , 8qo  F%  * 0, +J@i!V H+GiFF8F!F@!8F`i!`i"!`i%@!8 FCiFXi!Q$F(F 8pF Ffi!0FVB"!0F|"!`iw`i!ir"`iFmk)F Fp@p7F FiFF FhFb FO1ha(F 0 (KZi "`Zi`pGiKZiR!" Y`a` ` `Y``ihFkF{icGF]#F)hjh hH! Fo#F JIic1F(FGF(E#F)hjh hHo#FJI B 8F)F(F1`hC`h`#` 88F "FIl ` 8c -MF0@Fk F0F,hChıB(FkhBѫhSERF!F@Fpl`;hC0FMGL+FFihk[hGpG0i%h$jkdhdhq,h4F0`Go^0pGo%hh޿hhFkFiFGFU3F)hjh hH! F3F JI(FohB$;`u sFFFjFq F8H1F+`#`p-AFFFFq FF@F9F"H! FAFFR;FhRh hH!;FJI{l 8FF(8F+`8F'F Ch#$+`7`8FVF(н  -MFFFFq F0{F@F1FHH!n FAF7F?ѻ=YF F(9KF/;F&` Cl 7F(@`FChF[/9hSE;$`瘱R3FhRh hH!3FJI &FFF@FF(.!\0+лBRF9FF(@F  O2FFl1I0`0J1Il`/Il.IFl-IFld*IDl+ja+a;#+w" IlIFl OF(bCFIl=й+j$S&`Hb8S(0kcb F#boo F      F$i! Fo%-MFiFFF(F h&Fcj i 3#Oh@H3E(F#F"F9F-AFiFFFF0FhihdjeC|C10 -M FFFFFiF(F!hh@H1OI  +ihi`0l #B$ sj2FDi#D#+FQhho FFrF(FqFim>`shF#fhcfqh @$eh($ekf$ehh$e8(o% pG*h!`D`*!*!p-Mh8F8`ع$Pj@H4@B XhFBXwB'hBFhO hB h7(D`hD%6.FO .\E(v U0j,F,vD  ,Ѭ,ID 4 Fh[h#`hh#YCK[X+ o `pG4p FFI h  p(F!F0F4!h))FH o F4 hkhG pG8hFk[hKGF (Fc#r F8o%0hFk FŰñhE0@G[hOrG(KF*FE0o%3z"yF#0d##q  F AhahSh"h+OR[B@#``7 0FjhF0`(F BihH qo0#` I  F0@hF 0"h !FFhF**) Fo@ "PCKXKh@h@ @ "PChK)Xchh) CSC@`@@@CCC8 FFu!1 F2P)Fb Fb8%!pFFs+hFk;v`kc( h+(FG(p00;iiD?1!?B `c8F FJhi+i+!FDB(F8@! KDB@KF)j F@Կ-AFF(jF(FhFaCjC#h@H3SCCbb!SCaKF(Fjm(F!kh!J  5J!@F /\Fp!i(F)AFFFFع;}C#o(F#IC 0k3y[ KBr I##3q Fo    Y ]Cl! @8FFi f8 " F `8FlnFnfl{ ! J ##`Ked#cK Fcc8@@I ߝɝhk$hF`Go%pGhkdhF`Go%pGhkhGo%pGF"Fi#obn#ecmFDce$"nDBݣm "!(F ;'m(Fj97 /o cmbn3ce!agi@wDCBhkhGo%pGp FFF$egFe(Fp@FFFFi{n9nC;-;B *FBF F@οp FFFmBؿ5m*FBؿ4!F0Fp@ƿF FoF+0FoF/'8-[- 7-An@m##o m!nH0##g 0Fg {gK'D[]P#K-g@-٥A +R#eeeeee˛f-Xm-Ѱi/Fo7'D4B FD)))ѕ1A(F1@b #an`m#t#oF m!nH0#jA-F-E=-"C-D r'q0F1zD-DiF[0W9*:J+[i!iB#ce#o#eNiF1+Ban`m#jF0Fq7%) )o109#Cɲ{(9)?c20#Cɲ2 iU2(F1b(FbH --Z+WR#לYY-Cg#0F,0Fdnm)F#Un%eBܮ0F0F;3hFkic+m*n)o#B+e !i0FG&0#cgm;SCjn+ekmH#ke-(FDF(?0F+FBmmF0F 0F+F0Fbm!m(#megDn eB8FL F(FE(8Dl Fi@!YDl F2i@!N0)%xp0)Ѣxax%0xBa CB* bxx%0BRB`* %0bxC#xCCC%0pcxCpxp#p-M FX` }F,#xB+cxM+!FH o!|}H(#}hHHc}Hh}C#"~CCb~Cc"cB"p ؙK# YFH ZE *@𱀻л @,  GvB@s[#sGvk[B@s[#sCDBn DB3F**@ {{B"2 jjiOC# CC! Cc+@ʀ hz zC#"{CCb{CcD;O #x+EB$EF "F+Fѓx+fxx2B E(.F8F8 c +&vwD4*?L#YF7H O0 )_ D3X)g D3`fx.. 4;[jDxDx8Zj4SDKC3iB E ٘E,5F 8FF#F %uw44Dq4nZ YF V :D  Dc YF AD ; mz+CFhzC#"{CCb{CcD#B! Mg&F8F E DDDkj D3 YF6DF F F"l3F`"! mkF1F6 JaFFP!F#F Fh! F t"(F FA' 8 FyF!0)F`h8@kF!0`h@ؽ7F]!FFFJc !FR J+  #" FI 0   pF1F F$F F!F0h& p"!F(F+sFF$BpV$!4-MF(FF(F @F(FImFxUF)hjh hH[ F@FJIvFP-F)hjh hHFJI p|FP-F)hjh h{HFwJwI!FZhh#F(Fp`;hsI`{h`l((F݁(FhiIPF1F0oPFO2_I#F0F1F! t+0F"WIF(UIf0FSIaй0FRI\(@0FOIU(|0FMIO(x0FKII(&&9F(@EF(#F(@|!(FF $,F_s+4##(F h(F' 3(F -  ""HBth1F(FG(FChh"`./(&&&   $R/24bfpDu|h"pBBR`h'0 #;C ZD0 xND DC C _B 1 C_ DDDA !9C_C C_1_p!_t1_'(F[IpFͱF)hjh hUHh"pBBBh"pBBRh"pBBBFKJKI(F@,3h':D8F0tGp0+D!8F0GODR!8F0GC!8F0GC!8F0GODR!!8F0GC!8F0GC!8F0G# ahJYB3+t+PB !#^hC"!8FhGAC"8F0AGC"8F0!GC"8F0GAC"8F0AGC"8F0!GC"8F0ᲘGC"!8F0G@!8F0G#@F8F#"@8F #@F8F@!8F0G@#h"@8F#@F8F#@F8F=iziT)ؾK@FS;+ظI!񢁢S;+򫀱H@(FH<,򐁫I@! |%D!8F0Gl%!B+BBBAB*A B ABB+9iBQBB*ABIABFAB!!Or8F0G@"!8F0G@"!8F0G@"!8F0GOr!8F0G@"!8F0G@"!8F0G@"!8F0GD!8F0GhKOQ8FhG$FeNOR)F8F3hGIFH!FEH)F08IBH!FAH?H !F '40;*h;KB ,)ѫ+&7K6K 5K6H *F#F1FX!F#F0F ()J:DHB@!vEF1F"H!F!H{!HS+F:F@F -BH!FHh 2FyCHa,Hv#9[:&ͽYͶxF F93FF8F2((0B58$D(d$d@)FbHL#"F)FB  HYh?1F Hi!:FaCH31F g@lhkhGo%pGhk$hF`Go%pGhk[hGo%pGFh}#` #8F}hhhX_hii#< C_hh P8#-EFF_ h 0FX_h[};E@_h 0P`hhi!OyC+3!f`hhiyCN!X_"h0B_"h0Ph}h%C[} %@_ "h 0PhFphFlʚ;8FF(F4 ` 80FjFF!(F(hF``(Fo`} 0#`oF Fhe mFPhk+`;h;1F(FG@F Fsh+ѳhk`{h+(FGo0F#lJI##`!F(F00F#JI##`!F(F08#F`F F1Il8*F F8@"hhkhGFpGhhkhGFpG8F$khB 8(h(4hhkiGFpG8F$khB 8(h(4p FF&B #h64 F F(p-A%FM`+FJIFݴ_5`o  FOA 0`(2h)F8F[qh0hDF51Bq`$lÿpFF OA}FHF1F(FL(F Fpo _ FhBhch R#0O2@_h A# FhBhch R#0O@_h A# FhBhch R#0ho 7FujFF!(F)?Уh h" #`0o𵅰F FF Il J FH F``E` F.;F F!ۿp IF`$N(FV0 Fp4, = FF#FFF#v"!"w#!bw !Bc~+@У~+=~۳9F@ g`Y `"(FAea+!* ѐ*!*a*ڼO +!*ѐ*!v.!w3 0fvv!oo pGChFBF(@il~hD$nCOs FD@A*hAYF0F H FpB +Fo ``ooh) D`ۂhB#`pGFh0hhD `hhpGpGFFFTmK O%?CD"(Fl"F9F(gpi~hA!n*FCA3A@A# Tm8 FF6*F!F8@0¿FF*iF(FFo Oa(F[ 0iF(FF," CA I 1h0l_Jh alC _h ahi_7l_hcDyE@_hH4 D d Y_l#psCS#CCC_h(FQ ,NpF FBcjDchBѣ{" jdp j(B F@"KIH F@,a0!@ F80"!(bb FI hH3XX_*BBB_ h[PpGX3[X_B_ h,N8E Fjܱձx,I 0kBo D 8!FDo8F(L)Jj+GBh'KBCKx+@ѐE xB;Hy yC# B4ӔFPxB-(+kjlhi[#!bD0bc yIyC#I#hLH3X3[X_Bb_ h FP! F 8oo!okTg,N-ME`Jj hLhDOBFB(Fdc`GdX0OHS_k(l?1!?DR)l_0rFDD_0DKKC_ B0',N-MP#KCL|D|REF FDY谪( A+_)MOPHp?!?DZ#d+ѳyyS#і 0*C03x!`[ [C"C1sx +2  .3xc Fxr3x"7K`#l+ FiG(۔1#13x+sy*HK+#01x^2x#***# yyC#+P#   K0" 0@ Kh_+h)_ J+h)9_CC_*h9#d0N4NLyyS#P#   J3x L ( #+mx[+fE`0+h9_+CCC_)h9#d=KSKh_+h_O!+h9_CC_)h9#d/EKh_+h_O!+h_AA_+hPF#dRPFo"5KDp4K`yyS# P"3yC2xL3($*xxR"ѓE+h9_+CCC_*h9#H0"D Kh_+h)_O"+h)9_CC_*h9#H0+? F_l+0N(N$N|0hFi,%TBTA ST/) : B0%$15j0 :pF&hj@ B @xxR" [@Oph3FS(/@ @B6j >@ 0(0@B(:F$0վ#O 0" XF0`Khhȹ#FSTO < B?`h"FR(?@;@3B$j[F2FQF(ݷ[F2FQF(ݯXhl[F2FQF(ݡ0+@9ch"h #O p2q3ppppchOh!O 1qO OZrrr#h[i+4xN.ch3y  D3q p#p # 0#0  #hhiG00000 0xxB":Os0+@h# FJ#FSTo > Bod!*1~B6j+ hhSx+ ѓxC#lCd\/*уjG Fd!0iPFG*_1)@~ I!+5h*h /:F("+'h+a._Xk(ZЃj +V1FGF+h+M.KXk(Fj"1FG!+hph*9+(+ Si{F)@OF%3CT(@8@BЅHPB l@800+@k(Ck+MGo^"F`0 [(?x0+>i NpjF F+: k+7Haj@(bdJd` jKG(cl"lS``##dcdca10ԢhC1010hC1010Z"iC10pFoF0(QcBo0 pG-A F ~F)Eh+BFRT? ; B''am e("bab ` Fh(,0pGcj"jS``'bgba+h[i+ (h%,b0F~Bj!j@;@Ei *hQal@;ooF`0+3ز`opGChisL#h[h K` `H##`o@O@L#hBH##`@OFOr!HN!F@"H[=NF pGFh(o(F*M*N(ps F(m(rsh0F#H8 F((t0tt!@ F( FLo t"!K)F+`@#+#vK F`F(G`I 8F3s#ss;h[i+!8FG=NJo^pGKxpG3mha2m2 22+?tr9 FXڹ* њh_`aiYjZhBjC!ikh+3b./ж?(O6i^`i`{Cs`h(?+inha22iZh*2++dOp F(#FFT# 3@ F0FDH#mO`9Fe0F3(#m` fH`hx KHpx Kp`(ho RI@0% K`K `K`pGdO`OXO8h!hFGF`OQA`@ 4 `8h!F(FhG$ F8!bh F!aKhXhB``Y``K\"h{hOpNF4hT\!@ F\"!0`fK(F#`K!F#b Kcb Kb K#c Kc` F Fi#3`(Fpo hOI`Fmh[hGlh[hGmKhE mmhhG#ecmKh9lamhhG#ce F j!Bh[jHȾpGc@#FFF7@08Fݴ_+jy[yE%)F ,Dd F8$OT-MiF Fh(F 8M$08OC$0#6Jؠ`a a8i!#0@` 0`i+a0h@xa0D`h`{`` ( !K!Mp)F0Fdo0O`9F0F e(0I`Kx`KpxpI`qi)IpJpK#aH ,ПpٟMFFNF3h9F\m h3he`l!Fh[iG3h!Fl"hiGF @HֽhO,LA"! hC" H OHO3#` K Jh[ma"H >(\YhOT0 F!A"F!j!H0cjFB(F h0S"bbh!F(FiG@K#aOSc`(F``? FA"hF!"j*Oah)LcjBK8FTF"0H .K(F`>",H X")H  'K(Jh[ma"&H ($K0F#ag``"H  -'-":pbbh!F0FiGHH$O5=- KJh[m KJh[maK Jh[m(\YThO==OpCiFihri3i*+&I&J+F(mhhGF0"HC Fp!I(mFe(H7oKari3i*+IJ+FlhhGF@H(FIlheHK"Fa(mmhiGF(ٟ`ypG8h!hFGF`OQA`@ ) `8h!F(FhG$ F8!bhK"!hzlOFmh[hGlh[hGmKh mmhhG#ecmKhulamhhG#ce0i#00pCi$Ji$LhF1im)Fh!FhGF H Fp(me(HoKJa1iLl)Fh!FhGF0H(FlrheHK"Fa(mmhiGF(۠ɠ`y1Ҡ-AiF Fh(OpiK( 8rKOp9F0F doiL`AF0F e(i`Kx` KHpK p K` T۠ҠMɠp FN F3hF\m h3he`l!Fh[iG3h!Fl"hiGF p@H/plO,FF F@ҿ-A jF Fm-6Kh+3 ?'?"AF8F{KS5B Kh[!hHH 5-bjahB !hT!F0FG" bbh!F0FiG mHoHOаL ?#? @`F !snPUSBSm ?$?" F hD{H"!`h mm ?$?" F h*"h`h m8M,hl!@ dF$ F8"!(`P-OQ@ Q(OR)FlO8FKF`KFbKCbKbKcKC`(F]FH F"K`(F8 -mlOpmFF ?$?1h" F#|J0Kh[mah"`hE mp#lO-AmFyF ?$?1h" Fchovkfȹm`8FAFg{+ BF9FH"!hn m|a|2FA!|AA#}Aa B*nmH"h"h`h*C F*"KF#a@n@߾8Fno, ݴ_ - F)F ,Dd F8$OT-MmFFF ?$?" F1hchokfй\`PFYFg{+ ZFQFH^"!hn m|c|C#|CC"}Cc"fi*gf"h`hK8F3ap`* -M FF F AF1H"`nM"!Oon)hkjB(F2F#o|3D#g0F0FFnPFB"nmHn"o3DfnBKBF+aOSk`0AF`n0l"jbh)F8FMiG8F)h`0 BS0 ?a1-M],ĀEo0F^moB "F,Kr`3a@n ]MԽ_(OU| ?'?H(D:;FFFnXFPE "nmH"!`n ]n*FDfo9F+Dg0hKu`3a01Flh[iG01Fl"hiGF(HTlO ,-MmFFF ?$?" F1hchokfй\`PFYFg{+ ZFQFH"!hnI m|c|C#|CC"}Cc"figkg"h`h1F8F:*pmFbF" IhF G|%? H1h"(FrkhJcfcmhFa mp8F F9ef8 pG-AmF-"!F!H' W%? XH˲B#7 / H1h"(F$kh Jcfcm!a5 m0@Hl@#FFFUK!`CpOK!hpO8FFl(O2 IkB#rC#O2Il^C#`sC# 8 zGzVD$BPўՄzzD$BG\{G{ֈD$B>{G{D$B5ՖzyB/ќzDyB)_{yB#y(-`@ T{HyBՔ{yB ќ{yBX|xXBXA  FUO,<,Bclj'FW4P<BClOk0F<0 hkjGo%pGFJ[ xppGtOF0 hkh]$`6F F!FGpo%-M0yF:hF8j,B+єh,<,BR;hCh,<,BTiF 6F`+HC+Kx+o Fqh'H60F)F#H5j,> H$1F~ J_FH#Cq"K5pHcl FCy FUjcl FCy FHjtO=pFgF(FWiFi(F,Y 0 i F#`p@QOb FZ a,Yp<#` Kx 1 pG=8F-F(Fr4ThIl^Il] 8o4IpF F(F0!lFp& =+hjhhHp0FpJI4(FT"&@4#sCs@4d`L?!mlY8F !F#i_+ (Fz b_# #aF#i_ (Fz IH8@A-MFF(F#q(F4LAF(F&Fи G@FjF8!ml8F(Ff6(FTB_: ` FQF(F{F(𬀁#l_Jo B@#(F\2>:T p_\2+𭀚^2+G'_'@F 0'RG_@F pI 0_]"# #CBs_ 0H0_+|+ &##_0]2+ O@r" 0C 0l(_#>4#4l_տ_Oscb_sb_#1#h#c#`_Oc #aF#i_;8F z5 TPFLPFbF(?O8d`g=;F)hjh hiH;FhJhIGwY'V"# C:C { _# #aF#i_ 8Fz  l_!8MJA51@CCAE5O EOJ5 ;@C@C55_+ z d  Eci_ @4_#.CS_@4ű(F7'I(F@\`!8l8&0+hjhh Hj@4LP0#sCs@4"@4#s@4SS/B!ўBci_ Hq H>'SoP TO}?@BF FFFh_8Fo  @o oomh_#i_As1`+p -MFF 3TBFcF8F AKS"0FOs@ B(F)F|6 FS3CCrCCzh*C3_5_#5zh*@$_/ 8F 393 40CCC_5##FEEEh)F@D$+5C35+@4_o  3D xHCsCC_5?YB??XJBSD*yFPF__Cs55 #`C#@CKsCCC 5 F(a PF?JB??XSBQDQF5_*D@O4_ +\#BE8CDB5P]#Z+?a5#3YO dBFPF W PFF0}#b 4_  п_# 5_O2XF%9io x-M FhFF3X2!BFO@O Or*k`ѳHTF F0@+0+^+׀+@$ ,Kܴ<, ;$#BԿi9I#,МH$##T2@$_QHCHCHCHC!HCs/CsIHAHACC;`$#)Cc 04B" ,QvH$F0)C#O а@!аV.3F#BFFFgI8FdFEԿi.3F#BF_IFF+ РF.3F#BFWIFF .3F #BFSIFFRK .O'0O(03F #BF8FFF%TFF$4 O VEԿi/7H$4H$Ozp Tr0D$0$C#@#2B&дI@#Bд<ڴд6$vio)дo+@4#.C@4++@4#sCs@4LP0#sCs@4C@4#sX2H$Y@< ) 0##ZF)FPF F(y/9#F 0OZF)FPF9 FDD(VDFC#' 0ZF)FPF F<&IOF%43X2B#o9p4O tT4d-C-A FFF3F*F!FA-EFF F F0p5+A3Ozs *B,9S h H?om J I *F!FSF@F /-M FxFF(3F*F!F($M0h ih*#FO4Jh@$@"@CC_h hP0N%7FDl1F`h8#wP= 5- F"%`)F" FOzp F)F"@ l8Dl"%h F F(8@"-MFFFF): x+7FQYFF x F O)F"x3**F0FFK]=+a5)DdbBE(BF8FDEGD2FAFHm FO4lKhpG|Jh3`pG|-EFF.FR_+x-+ =!(FFx)F6H? >?+f+]G.0k:F(F+I 0 O X*  0VED F#F!FHSF &P+:F)@E&pњEKZ# PFB+K)FhHO0yK0 0 xKOsjF! _]OsjF! FFF F@ӿF FIt F};FRF0( F!FӾH_0 @FIF7# J  @h 0 "T1( F T瀣7 FF(B(F0 F!FW#xbxCxCxC#yCcyC8  0 FFPI*F FK0o8FF)FH F88 FF(*F8@!^ F8uXx1( Y(РTXBXAO0 HCXBXA?F FFH _ " T( T FF cH#Dd@I2IHPKHh@3 B BB I_yB#BbI@I2Ho]_pFF"Gr1F BH!o)p$#FGr1FHAF8 0 FC 0KHh6H)Ftowy$GwF"F!F H?B K Hh  :F1F F(` FyR0H4w-MDFFFx$+jCx{+-6%E#+F,FP)F0F.KEFPhv;B"!FPF%K-6#J$0 F+76DCE4C{8FI78Fh& I8D3F J K4F`$esK2)  pGF8IK[HDB AhB0D\Dp%O4)F FKF8$toS@"P0qh@B1h H#hGF8 HSP0Fp*6Ѵ?,F566 SF@hHh1Ho F"P0`h@B HGF FHH 66'o&9F oFX_JF( "R FkiGF@khP CP0khP CP0R07+oo_-M}FFF? # *F-IhF _iF(FF>(D23FXF YFF{h(Fb`hFPF0m``QFh0F0_F`H1F FwF`he`o FoH.o$ ) -MFFF(NO ,!(FF`(Fȳ0$F o (F)FZ:! FF NF FJFر)FBFXFGF FK F(ZF)F8 $ F5u.5F%0Fʱ# IFX{(F  F0ooEAp@ x0,LxX,1 N D F%x1u]@DЙB F`p-F `pG FHI"IHS" FIN aCDD 8FXM!x(F@8!xHY d 8F( Max(F@8axH@ d 8F(FKS C8(#0J F,"` 0 F( F`7F%#!F QBТB"x0*bxX*-x:*O0*5- 0-A%XF0hOPP+HLP8`8h@1FH@1F(b(p`琣|O!D -MF FFZK/h,F.h3+=Tr0FO3!F x.c.j. O3!F xRB#x0+cxX+;K"F9F09HOO0#xY+E+0;+cxF;۲0J"f;۲+!FO # Bкx .*  џ*н F(зh9FH h9FHZ8F1 KYF(FFH"F!FXFx(?|hw9FH0Wd!AW!t!!!F `pG J KF &LB8FT6G6D FHI"IH" FIz FEG!#J F0,"`  F+( F(Bh瀣OhFOr!hF;hN+H#0`;`#0h`8jF)FH8AjF)Fz(hF(hFp(Ch`O"!Fx"FFH ZFH F" pG-E FFF1H?F(HX!F-J,H (9OAFPF(. "9Fx ` 0+0@AF0#BHI-FHO~H??)F Ho##0#0W,###F FKz Fpp\(H HHO###-MMF<FFH$Hh$ F M G'?8F6FF0F7F@BFIHL0F4|F @ 0QF =UDFQF ;FF2F@F0BH$Kx:0W#,O-MM]FFkF(LF8F(B8FyoF@ 0 < DF  O%?F+F:FPFBAFHOb!(FgF5(P Kx!0F F MNoo!$O$O0pGO0pG pGO0pGpGo pGFHhBDlDBFFO0pGO0pGO0pGO0pGO0pGO0pGKhpGOKh@hO#-AFJK''L<#h B#z[h IG8 K"h` K`?DO0POOPFJFhO=`Mh I8hGXF K*h` K` FI 4,DO4OPOPL haCjG##`OKFhTi FGF FOKFhDCi FGF FO8KFh F3)Fi FGF F8O-EF KFh FF ggRFCF)Fi FGF FO-MFKFh F!F SF(FG #BBE)FHO4z FO:$7KFh$j(FGFc- FKmB`0Kh`KhC`OyPPF Khk FGF9, KdB`OyFpKhCk FG@OFXKh@B!FQ;+H 6(FF((F2F9F H F + H7#H&7FyY$$j$z$KFh8k FGF FOKFh(k FGF FOp KFhF1Fl(FG2F)FHO4 FpO$*7FhXh-F$ F0iFh(HO49-MF+FO4 F*!hhhF lHh$h  hFBx+Ѹи'FF ]H`!FFZHFXHWN!FhiF!FiF"F'F:F KKhy iPFGF EA ZF1FiPF#GF+QF7H c/Br9F0FB,Hohh6иh5*i 3F #"Hϱ HU 9F  d Ozs J1H>H;1FH H!I FJ $3J^L$O.%$C%]%[90W8F+F* !h`h`- hHa8 8O0 qFF F@[ -EF+F_hhhF $ F Fh!FFhiF>Ѩi!FF *F1FF@F#tdFPF.F#HͱH)FOzs Jo H| Hy%FO4`%]%[pF+F"hhhUF Kh.Ahh FpHO4$O:*F hXh/Hh8 O0 *FhXh8h hH~ O0}%*F hXhP!ih8 O0 pH&$ M> H H p+hC, :!,!jhHB4D5% *FFF@ 1F Fر#F F"#QF((Fv F#BBѨU=`o oHpGPJhrBЈBVpGxP-A%F `F OqF88F`@ FF*/ BB O*8FZ)BF DA2DCD3 C #F>F9F][FRF3(?@ FF#D3 [FRF(?("!BFO4P#-M^O `F9hF#hq1(F@ B!hBoh(o 9hq F.O O !Or@F?!hB #0н(0+cН*!(QO !*[F2lAFDh ,h (н00pCO,г O+УBSBSA$+a!FH!F$ l!F1( D1 4zD1# #ooosxP0F Hhh HhP EE0O0xPtP-E FFFFx(QF HJO0X2F F+F%phFFF+ChBуhB F)F@ F `@*F!0F F pf`` 牊F@)OhjFpG-MFFFCliOA!F@j 03 FD CliO iYF 7 (ki>0FnFZFQCSDD@#F|(Шi p 0 9FTF(AF FjF0FFQFDQFD0F FOCi 0"9F M8 -ML#hFiF FmCli;j^Ն #h$O i(7 3@;FO 23 B.O2F2B XE*! 1Ih"F@F@pFwxBhEF!D@F }H#@FoE ڭh@F(D2  W*$ &F, SEJOA F(aHO0O2^K`^K`m]N3hE%F"F!`FعWHTN3hB(#O203`OKOA F`LH4`m@3` J0 S*b 2RE 򸀪 OA FJ h3+`!F@Fm0+=0OAF(=&!F@FX.3x/+(F!FO*Khu)F0F uF0F!F(F8К0+hzh`h:h`( ;*,s0+"#@F(2C0F^XPxP7F#% K` 0(,(  ,(XP#N F1h O;`q#03 h0<` h"(1h FqO0xPtPpOAFO`F(5wN`NSs"B'l#` #!n!1!qHX0`#nմ0!#r F|Ax!i4`p F#3` xPO(p FFUKEd"h`Kh`chEICliE  @% CC@Ep|PPFF FF+gI+F"F h@l|PpFElO`ixObi#Fp@BؿLDx B\B;-0 hiehS -"DCC3#Ca#3a0 h[j` h[j` h[jC`#8FJFh FO08Jh"F)DB FQPpF JFh FX Jh1 LJ$h&DB HO0p*F-(QPP~({F۱iZ%kChYBhD:F)F0F(O0j+#s h:F)F0D()-EF FCh ++]бo!F5H^ +ч FGCF+hS$+h3)KB# FYCF FiB'h B(FDBRF9F@FG(akh+ + +*hDYS[xP\ H OsBد FGGCGF(-MFFFŠi;?2F?"?F2F ?(?B F 7F BF!XF{`(FO0AF(FM DdB FV*FFFXF@EѲDBCDF!?2"?F2F ?&?2FXF(F"F1F(FF-MAKFhF+O5(Fi@ ?1!?KF(F! (O50F@"1F F+Дb}**"{zA!r`oJ Bє  2 Ѵbj*`||M @ =@Ѽ bjJ @8`"AF@ :#}|PDR""jYF@s$B  Q-E F FnF(o8F`h=J (`bsShb 60`304C#b+Н00.h b,0+PhE%-0B)F%H$H?O2H (OC $Ѩ acbO3a#O?1@ !?i `(4`cjs``cj`#sa )F @ b @D#aP(((-M?FFFF/F?#?F3F F ? *? BF 7F)FPFsRF!0F{`o({hFO0 FDBF*FFF0FWPEѸ0DCCDF !?#?F3F ?(?@FD"F)F@FBF!0F0(FFF8hhŊTiiCrDh , kCi!Dy Ho8jdB(,FicC)D)8iF "!(F#+pi# F8@ɿ 8`CaK>@ p`E PaS`F`F#a#b F "IF%(F=8(O0+\.+oOT)F0F0FOqe F,!F(?)-AFF%NO., ,!F Hx# Ԥa+@5B(F_$+-EFFFO O#FEFx&K;`(/*\*FFxF/)F\)FSF F8 DEхB L#<`DF;#x%F +.+kx[.+ѫx;(F"8(DB5`x +.+)q-MChF+FFS + +\н#@FYC.F FiBOh B(F8 0ШZFAFPD(a#skh+< +6 +(hD/00OAG/Y/+pC 0+h 3C# 焊@FD,DCDF焊@F DCF+hC$`+h#`  0(h00C3 0(hZ!R)hZCRx۲ 0(h00C# 0(hZ"!R)h 0(h00C 0X-AF FOxO,kh ++ CFOcB!F(FF (FAt!F"(F)4F;FpFFL!F(F4(F"F1F Fp-MFe ÊHah )!  !  AC%ѻ лch +1+@4OsEOs[EYF Fch +OS SC-F:FO KMLN 2B ahr8 )0Op@|)`FE-QF FchF +!Or@q+ FREٺ@P ++OsOcSE@EFG(F*F3F )KOp@u)(FE  [b2 FFHBA3QF F BF*ch +Or@q+ FZEٻ ++OsOc[E@FEHJK 2B Aƀ  a c B x8 8, cCsЦO;h+ኢi#VOs @B u;e-@Ȁ0FX@ #DYC:F83B`E^DecD5CwM*h㊘BK2F9F(h*h㊘B>D QhhB ` Q` CBubh *Os@q* FE &5F;O1@  8`(UMH!O0  cBs F.⊐B:F0D 6⊐BcVDD+7+K9Fht(KhCB eDDEsAOCFK~QF FCbhF *Os@q* FB)F Fsch + + +opE*FQF FK@uOuPI)cu&1%)F F(5Uch ++ ]-:㊦if3DcKhB+aHC QF Fbh *Os@q* FB?QF F)FFQF FEFRK&i FFFOzBv#i F( h [RhA `J`ch +Y+Z +opKZFAFSAF FBBEF0i;F Fy( !F!c;Dch +)+ SFOc[E ]F(bh ** RFObZEFCFJ@{O{ K KE׬ 3oѬ@sPh)i?3#?@3 N ?x"0`$?H"F! (#O53`(FF"IpF(" I6("IR(QP)iFF%(Fhh֊AisC9Qh )$ijDB(Fu*F1F<(#hsC;`hci h`{Ch + 1`ÊjKCB##aiD(`#h[h ++OsOcBKiFa [ ;aax+;ai 0-M#F<1(FFbih+bijbbx)z.*IF"x '@,?a#x++#*D,0a BS/RB۲њE,,<1x"!F@F#41CFF+#{@F[#z.#>F;"0F#{!0FF#;q7F;x6":p,1+@х,!<1+@ }iF&kF  6. Ui6 .! 1) & &  ?RAFo2FiF@F(F%F(?AZFb+#,1<-MF FFz+x.FF5/+\+0F8o EF;/+\+ci *$I0Feȹ#hZj"[jc`#3#a+x+* I+x+o F(<\XE8XF<FF0FP<1SEBFQF0F(iz!F FV2pF Fv F@(F< ix p<1B1F(F(-MFO F }Q 2OC[PB_&lF5FO "! F#`F3yBFApp2+Ђ3F+" F3i"DssZC*: #F 2 * 20"w{" F"DwPw3 C*#6w0[ "5r%p  +E@#pu(F232!F "ici= <[8Fi+o }8F(7%`aFxH(Fsa[ ;a0o-MFF F)o F  " !(F.! FY#x .+$A"(F0F +"_#0;I+FRFM!F(f!F(ROBF A"@F!F+# ݸ 2$I! EFF 0 +ZDI+F8Fyhm(8FX|+F I F L0 ")F0Fj$))ON-MAhF:F(o0FFziox *'hi7B ѣhBRaa' Fi+ci%hkh +OhAF(F>FZFPF F(BF(Fjh *JAF(F(F0##aO[;a*Or *@r F(ЅL#h3Hh$ Fh FH]#hHYhX h F H  "H@?Q))}))0IF@ FiF0)F" F$F| Fy@ 0o@FF@ IFxiF 8o(F[ F "9F(FFNiF(F("9F(FF"##:ii0o @-MTFI@ FF(K(@A"AF(d i )iOO OHBzF6 4D-tuJBtF FBz4haj3CRFBx+F?O@!?F1FXO3!F(FgKgH4 * *OrObBUBFF!F(0XHXFrh  j XFa1J1U!FD(F ++OsOcBҢFEv+F!F2[H2/KQFTCE[F!Fб)H(~ ++OsOcBr CFK2 Br2 [DQFh(FQ + +OsOcBE FKo*o )@))FF@ I?F!Jw8FqZ)F"8FNF8 F4`(Foo pFp F_(6Or!0Fkq1zaى`1dيX1!X@P! z !#`i`#.`poFI F@DpG0F \Fh0(F0 I0 F0*-MFܰ @ !FXF0"Ff F(Ҁ ,"FAFf 8FUF(9F9F_Ho $ FXF\@ VIcF(YF(@( PK` F" p F FJHe FF`izwѶ??iЪBAp aB! #˂h*Fd3FH0E3H5 FFUO9F F o F *F( )i "!8FZ0 +# #B!r#a: "8Fi9F F (SH FFTo Qo No Ko Ho N$*@P@*X*q*0  EE0-MF0"! FrIF@ FnHo -iF@F]iI(F#PhI(fHo F(@ `K)F` F"FF)F\Hvo F@F(F F)FoizD 8 0"9FXF@ BI1Fo PF--+)F@H=]F!F<hŖ#L@ YC?1!?(O3=FPFM(5%hijhY *(F?9D(Fi0#HoajhBѣj"jaaz* F' FFs F1(xk%@= F( F(oX@*q0W*P@**q*-MFڰ0"!0F F( "FQFb 8FQFP9FF@9FH$o %F @ IkF(1FF(@jK@`!F"(FxFF!FzHmDF0h(F FXFZ(FF8nH\FQo kic (BF9F(F o dI(bI(o QF(F7F(Ѻ.i/h "! Fh{h +##B!O0 aぢa"AF " F @ WC?!?#FPo BF9F(F(ЭF:F4 "(hF gH8F F @@0+`ј0+b"F YIqF,n)j#BF+F@+FBF(Y# "#DIGHcF( .F(BHa+"@I(f0`(_2h(hF(0FDF+ј0+D#@F-IQ8x+#Di FرFX4O<<<CE"L"HX F,S(k F(#IBF h 'Ff ,?|LL0L. L=d, ,0,hQ -E.Kk.KF`#" F*H*IF0(KB'H+#!IFHF+ BF9F FhHIHFHHL FH&OS VE(FBF9F5F(6Q , -r \-B--AFHFF HB%$+F9FJ0F+"F0F I KB 5?HH FP  -AIFHFAF :Fб1F#%gS" ICF HF0F\ FY(FMr  𵋰F!JF#IFF0H F IHF(:Fm)F(P:R1D0D;"IHFs-r -M%*F IEF(@ !F(9F# F(F(@Ҁ"oI x jL &B@(FleHB F >FF  ]KFBO VE@$T ,Q (! TJSI,F(FF+زF FuVF"FI~(ѫFSE  @FOw F 00B !Fa#0  -L C@F@,|FFE?v0!wF0F"0IFx@FSFRFI4FK8F(  b   F:X74F6L40  -EO FFH AHHq$ FhFFBHcAHFȱF(CAF=HT5F &0`B H/,"9FPF6-, #S``#`C` 4`FE,"9F0FEk6hRBH<PsFFF.*F F3FF<FpF FF$-L F!0F)`F(ЂhB!`1$h1*F UF hB*hQh4-EFFvFF+H"8Fz(KB$! F"1F0a#bh|`5%`c``PEEO1FH 0F F ! _P#S`` ``` F H`+j(b#`h'F3S/O '7FO E%:/+"FR*hB !B*h*F@Fp7  !EP*)*F@F_7  F[_E;i k1F#*FhFJ!F F?hJ-MFFFFF0BQFAF(FFp"9F#(FN!L FF[hXE"0BAF(FF(iB%#S```D`/ѪhB(FiQ)* J```D`FhLFdFThBѲhB Mi#0F1~F9F?hM1FHD(F0Fy%>.-MO FF @!FFNF@4! HF0 F{M(F#a'OS#`K`eRFQF(F&RF`YF(FVF*F0FIFX"F0F IxF @>`M H0F FB s.-AF# FFF7.LH8F(C;i+@m FAF F06 FiF@F2FlFCF 0hF}@s !OO2CBR KB Kp0L-0h#@F3`F FN0hB@q 2[O3B(jCR!~ F@FRBhF\?cE hhBh"Fh1P8FF#*F FXFF8-AF(F&ULԱ" FIU   FFnIx+L Fy"CF!F8FF5W,6>FRZh`8hCLQ ]pGQK& FF7F@pG𵅰 FF8%T !T|T,;#0F49F5=FRZh F"r-HFQ ]pGQK FFF@pGFFF"F#(FFyF:F1F(FFH"F#!F(F F02KhF F'(+IF0i*k+%I#$IFq)abaPbFhKh\K`n KM`#ae)FjGFE[k"Fo#FGF:0Q(Q0F'(FF8##I(FF!#i++I#F0k{(FkGF) F#!I#O>KhP]hQ-AFFF##F F&I7F%#i++ M F(FKhBѧ#ji`&!1F "j(#j2FAFhiej` + FQ(F!H ##b0Q.8OqJ F J KD Jh MBb Jb 2bbc H(F F8<hQ\p`HpG. pG#"𵑰FIHFx !0J 0:F IF$ FF:F3 1FF(F -A FFFF(2hF `9F@F(`@F+hH8F"h2D"`/h1F8F(`8F+h+0F"h2D2 "`H FFQa!!F@i`a" FIF F60 /١A+ء72*# (` N!shF F hF KB ;B  hH `+`2F!hpH 0$B 0PB` 04-AFFF'n/`FO1Fv!0F!FO2(`)1F@F*h=F(h(/` FL -AF$OM+lB il"0F9D hkl;DZ||@ ||@@@`4-AF"!8HX7H X6H85H}5L F4! F 1Hp0L F .HJFh@reh !-@U@- EU*FkF3.F8"HM"HJ!L-bhEe6 F!F@F5CP:F!F/H F FD!FH6F(Hx<<..//* :/Y/#sF F3OpF H N(FK5hB(j(1"I Q`(F_K(Fk[lG@  FpPiF0FF0,$A H ) H -hx/Xh//H "K`a:KpHQ8F n44 (` 8 aB  F, l!h!H iKu /-AFO FF~h #sC JIhBXBa Hj C KhBP Hp #cC Hh*X3`% #Ch+`< 簥ȥKOBZ`pG JOBAHB HZ`ZhBZ` pG)ZhBh +pB@+x+J1+R#,H(:0(s1+?nR#~(8 m k&8h'8@84(2( ܠ0+?!8~( Q8 K G C# ?Ch#hSBSAhahB3siHG6h2#HQ\ Mz)xA F "LU FpJSF++ + +Y)Phz@ ɲB@3 )`3S$K,ph<@LHQ*c*ucy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCcI(F $3"I xx.C#*0FI DEF0F/I =-BD0FI by#yIC#yCCyCb D#(F+p !(F^F*bz#z`yC#zzCC"yCcB"yIBByBb (F !S+-)++x+++++|++3+++++++"++"yymIC#cy"y(F ayyy"yC#B"eI"dI>cK cz"za{B"zzBB#{&|C#{BbCC{(FCcVI gb|.*0 ,QIQI0F W|D* R,KIKI0F H5Wcy"yHIw$0GI+4' ' 9./D0F/3I 0BDє$ >Izyayy"yfzC#$zB"(F7I &yy"y`y!zdzC#A!B"/Im"(F+I .%*J*O#D0Fz(I 5-:FDxx$IG' {D(FJ#9 D(FI 011'181F1P2R1`1\1Հd1s1M1x1110Wt11ȀrIsH#y*FqIF!S+ՀU"<"6)0+g+!y`yyy*gA!AAAb(0XI"AFcy"yB"yyBBMIBb(F DSA!AAAbCFgEIcy"y!|B"yf}BBc|yA!|BbAA|Aa#}C#}CC}Cccz!zf{A!zAAzAa#{C#{{CCCc*I"*I xx.C#*?0F$I DEF0F/I =-BDxx A!9FH xx!B":|3F@(FJ D0F9!F 1 211*2B2t00pFm$hF/%,&s bB#x+cx+ #phFF$ F mpkxxC#D!F[F}F FpF FF F8F F)F FhF F88F F)F F(F F88F F)F FF F88F F")F FqF F8F~ FQF FFr F4 FsF!FF0"F#eH p[20KF˅K)Fhع FI3)F FJF0 I H )F F J;0IH 0hQ9222-EF($FB!(F'J1F(F(F !F(F8##4O "F1F(FKQE?FF!F(F=SF!F J(F.#  9F@FU!F(F/PF FF!"F"KB+UNc+&(FF!)jhihD @SB8 F1hBL3` F3h`)F H L(F[)F HF(H :/xY/*-AFF3KHS"bPCF9F0FJ HSFHOFHKKJ(F-FCF9F0FJ  L#Fo;2<2t0W2#-EðFF `*FI0*FiIhF"F!@FFpF;F2F =F(F4C8 FFtmm h#c`$ F8LLpFF,m<## FpL8 FF"!kki#+iphph#qkhcq+hq8Fn F@lFt F i@iŻ-MFF#FL00*"1F#O10FF0\+y/yh EHj1 )DF(𭀄F:@h /-LXFh /# XF(W%e F F%=FXF[n0F 1FB(F x.+0F 1FB(F .FCEF)/*(F )FB0F   XFS l( Fz "#XF#e%#XFI#e X2220W8F`(lph $d(Fg F8$8Fl FH8)Fh(-AFFFF."8F1I -([h/!8F GQ-K2BOAD2mH0R ۲B!L FPO1@F0F0AFO2.9F(F (F(F3m $0F`BBLLLL p FFFHA:m;m& hl=Hp+h1F0h#(*`1B2 HHH8 FFy(FhF he`=(F8MpF FF\2F)F FFl FpFN;C>PT@FOEFH @<RE-=95B  0F^F"?h< -EFFF3+'H\@<SEH"AF FXc|"|B"3B2 Hh8F(FpF%iBp#S```E`pF%hBp#S``hh`E`S````F& ,jB F# FS``&`f`s-MFJ| |C#|CC|CcB$"cx'xG'xGGx +Gg [; +*+bx#xC#xCCDL F! F(׀"!F0`ia#`Ocz%z'GE%z'DEEzEe%DB:! F(AF ha(_Д,0- .C#+ `(QO czJ*zJJzJjDWE3FS/U`#h5aE +xc+hO1@5=F0+++ji F]B+jiR+ O1F @   O 2Lhhi (FV*L*L ;P+'L 6FHO`@```by#y C#Esj ubC B* (F8(F(FVLRFYF0h J`;`x``PhS````#  pF F )FFF0F 8(];((  p FFF# F4 H;h#, HT_B$H0Fh(-h -EFFF 0F $HhBظHFZ_UE8FhxhB+iB٧9FhiFH*ihi?!8Dna@FSF(kiDb -h -AFFF8 F0 IHT_B@Fh+iBjiC;R#P-(F3hFB0`(HF)F54` -h-E FFF F H+h#HF&XE+hB .`H 6D%i;&FEp4FBsachg`<`{`` c6 FVO3c8(F9H$h1BB?/(F1H,=O 2O3YBRBUEAE*ѥhhB&jjjjBBLje#S``#`C`FhXEM,hB jH" I F $hHdQ XH7@u RCOC BR o j0F KFBF7ٵ((Ј #FOQFH #*h(h H "F(##2F FF20 " F@Ho FFFF L FU F*F;FIH L"(F1(4-3-M@uF@H_F,## ? FVGWO8H 4?J: F Bzӻ_2F FW F:F FO(DA2 Bl @- aA-K- EU U2*Fxj Rj R O1AQ60KdFFF2`@r@OO6BFVkF2F9F - (IJe]@q@j@@3#`Hʑd}7FF F0H %(F0"F(F5*F!8@ T%TINE@BB!Q@BE"F I H H&'Dg!@Hʑd},4FH$ph bE("TC`` #+`B")(<E(џ h4(ĕKh;`HdQpG7@s%!8L @ @:E BR)F+F#H J @"@)F+F (F0 ! RF(4'%#&Gpp"Ipp8D##u#cuKuu KO K"FK8FKIK KKKKKK(;ha H8hQd (H@ pNF74hB j" I2h F--#FFF$hXX+H !H! \`"H"ZBK`] pG-MFF FF.NM(F'-)F F "HKF`HKF`GK9F`FB.*@DE-;FOE4#B_F:hD*k%0@:i0Dh8Ka=X6J7KFb6Kb(9F FJh3(2)Di;1 FG$hBiBR$dH "Hh!OB OxlBOqBr$PDxd+DnjEwdEr" ph D`33Xx`A( K`O0>M,h,sF(kMF(fF(a4N#3J3I4HF(QF-I/HS.KB/"###&J&I#)HcF(8\FFF`:F@F jFRFF;!0Fp H#" IC H-F( H 1,` F4  !$4FO1FFF0@O2!F]+F!J O2Qp W4FF&W%DB (.(I~`_#&;+R0Fp))Hi(s$FFF! KB 8](@`83%0#%0@$4 F<4@p pFF>=65OC Fp[F(WB$O4 F<4@+ ^@"7+ C@ FhF?([(*(8(F 0FhF](FhF-( hFBۄBhF](c]B]A(](-BEhFB8F Fg)F FFx F8FFFFW#(F"F;F1FF #x#`_(FFFFF=,#"F1F;F(FFF FLpF FF 2F)F FF0 FpF FFF;F2F)F FF F#%1J 0p 000+J+F+I,H PvF(F $J+F$I%HiF(9ѝ 0NC 2F+F"IHSF  0C IC 2F+F"H<Fh 2F+FI H0F Fp H 3lQB!X!l!!!\4-AMFF$FO20F)h;X"8Fih}( #h4,  -AOFFBFFFKB(hFh+FBF9F0F( F7#+`$ FDF#-M`O1 F(qFDF'; EJ٫:F 0F?"F 61Fy)JFB0@(FF0F "NF(ch2#F#`3SD#FFK"#d# #AF# @`#CKUbEfiVa 0 "! FȹM!FO2(`r "+ha#F!JHKF F0UbEfiVa`-MFD0FFFIH*)л+\**!*"9F@F!@ Fѻдv AF8FF]+;ih)?-H&&л > !4Х 2k.++h$@AF8F0""F[FHHViha@1CЅ$@B?{?x.lh(FMJKFcKScKcKdR`  0@ L#h3 H#z ! Jch h"( kL0"MFHMFh+x#H #+pLg F 0(p# H#"#M8BBLHmQ444-E2CFF0H/H.I.KBB"i)F :fiIB#iDB  O18FFF+hS "9FPF##QF28F9FH QF8Fe@"PF Ikh+h3D&4UbEfiVa5dO1 F(H\HO2#!F#H"#F(#*s H> F iBBH FQ(t0 4$54H#FFF@B5FKh)K#!"#pQK!#JH&FH FpQ-Z5F FFFI*F$! F0$":`(hcM FL-M, L @ FiB;؄iB6ؼ7'#\E2"C h  `24 B73DP@P@@@ @+HH 0#F Fm++i+% %#i FbiFF F0%LL-MFFFLX **  *@݁.ҁ#' .ɁV&RF[F@FAF( F &&E@𥁭:B B  B w \ B #%F\3FB0/DDM@n:Bi Bb  BZO w \`cEP %F<CS0CN;B  /DDM@*:B% B  BO w \`cE  K%F<O[C#0C.;B  /DD&@P:B܀ YBՀ BЀYDBˀ.ƀs# \BKC #& && ."J  C   37BD3+D.R0#@C#@#@c#B0OK o#o#@;!-6Ъkѭ :Bc B] BY)U O \ wSELGC! !!%F )ђVxxFpp20E  DD) h 6SO0O  _LLLJ($F.R&S_u.R&g}}-M (_h FF3+Kx! &F8(H(KF F%Ir("H!J(a JeaJ$!"bPbb". "eeh'cѺ#OccK@<sO@Chd#bc#OxAccOc##dm0 5?  8T(F F8@ݻ-MFF p!FFF(~1F(F/wF(kXFPIlF(e#F#FF(ZAFPFf@F\{h;;lAK#" :Kn;I_F(f.B+z+? "!PFh3Kcb3Kb3Kb3K#ck{<0#=0cibdd.E8#b`^*Kh2l*h`jhrZ`@F FfFHfki;7;F1F(F(_(1F(FnlF( FnIPF(>0F$0OA  -AFgFF(RЀhhBJCy+Ii:BFh3@C4@ @ BA2,L4@%0F $FX FS+X ;F2F)FF9 KBF F;F2F)FULLLL -AFgFF(WЂhy+MhBLSy+Ki9BHh3BC4B B "BA4,L4@%0F FX FS+X ;F2F)FF KBFx Fq;F2F)FLLLLL  IXi(hy8 ] 0%F "F!FF, FI(i-ALh F(  F h&+) FCiF#ah6H{#FFX1KahB B/HhO0!F(F(F%FU4O<<<B $Kh+8 @B FU!( FLF FIF>(siahH2Fi;(!F0F0Fk555sLh! Fi0 F(S( p Fqh&+eP0F(F?! FbO0-EFF!H)*@F(@FAO F hedhF@F3h)F0F;FJu(ۨB S(@FO FF)F0FJ]6 6 ]HpGHpGHpGHpGHpGHpGHpGHpGHpGHpG )p FٱoN4h,K FhFDcBX\B KhS$KhC$P3h33`pQQQQ F#lh+ M/h K N3` +h7`C"clCcdKh< @Q!ltQcyHF FFFU'3x+;lh;+ "!F(F#+p^#lppsxpx+qxkqK FLLL!7H-H #H8Fu+lhl"Kldh<@+l` F8LLtQpFFFH#lh+cl3`#cdK h*`$` FpLLLQ-MFFF-t+q.o+lh+m+m0+i7O܀9h R!J{ {D$, dd" " +"F #"FD "L9h"h0hR! BL2`~ F0S!;h"hR# 32`ZBXSB;`0;03"Kh< $kl#kd L L L LQQQQtQ-MFFFF(x-D,Bжo?+lhB9ﱻ7к4кB2Ѹ x"YF F"AF0[#s#cs+lh۱+O!F2F8h1F8h M K`$klCkd FLLLLQQ8F+lh+$ "Kldh<@+l` F8LLLtQ8Fm+lhc$ K`+l` F8LLQ8Fl+lh;+ $ [ K` Y UB +l` Lj F8"Kldh<@+l`LLQtQF4#lh*"`B" FFF"8 FLLLHpGHpGpLF hF(O` `Ob!o2F)FOb hKh0Ob!h$pQ|Q-M F(B( NOM0`0Oa 8`$0h8h4`+h+@(h|K}Lh|HD?0 ?8`! cF(`(OO`ED,hT0+! IgK`(0h.0hfIF(@4haIF FF(@0h]IРXCo9Ӱ6( p h3 `0o@ c?#p h?Z` `Xp?@2 b"p h?Tc `Spe%p h?eb `bpO07 F$x F0(C4=?4FO0h*(Г `\CoӠXCoT,2 `@1\B :B3  hXBoӰڰ? h 3 `pG0BXB h @\@ `XO0pG7FFh% #h0x+0C!F? =O07 F F`0(=7 F$ F0m(C4=(ݰo4?447FFh% #hp0+DC!F? =O0(ܠA+ 0pGBXpG3*pGK,(ܠa+ 8pGBpG3Z*pGK,O1<0@91?"?+pGpF8FF,F Fp2F!F~-AFFFFO1F8FBDEd`O@9FEDF^#&0@F'?%: F4;?\FoҧXA#Q f3p?6?fcaFppp0'!F F[+;o F f??kcCpFXAoӣ\Ao?# ap?afApp0Fh* #1@B+ȿ`3`3+?#`oF F& F#%T^p_(&pB&p F0M\B0K$5@`@*(@B}(} KS pGHpG8n8ihBX pGphF F"!0F;#3p#p$spp+h 3+`phFF F "! F$ ##p #p%cppD#`RFQF(Fp"q1Fa#"#v(F#Ia#"`vI(FZv(FcxD0D0"(FIHqMCXCC -AhFF"!F F#Ocpp&pBFAF`+a(FKBF qK(FI`qji "(FFKo|rC t!#"r#u!# ruu(F!sbsss"tbtaucxD;hD;`FXC-M'O3F>FF'7%)O09FX;G D1"! F" FI#"!q#r"bsBs"&s%t@btB@ Fqcrstt#ucuuu`q_FCpG-MFhFO 1F 0 +;i Ka p1F8F RFiI:FHiHGO07FHt 0 BH0BuiH 0 + kh!h2O HC3B P* JC;+>(1|& 0h[ABBУieHh ch DBZIaHri_H!h@ KF(NѣiZHy "hO(OFFrC 2F[D F GB F3FKI KH?iJHR D"h  *F_?>D#h!khDD0 0h3BУi2H !h @ YC?1!?Fi+H#"h BC h ch DB?r%KF#3 [BFYF3F F G B5[FIJHiHG0F$I<C-CCDEE*DNDxDD,DDE(EKEaErEDDB#h! HcBs ,0F  D UF3 \YFci FGkhDD 0h3B?CiHrIHWiHj kEC-EE-AX_%,F F `%<` 8FF,O I G'F8FN:FFI"FH %FF-FsF p%.F F(.x.+@%#x46.( FsFNM| Fo#x4Bp Fp#F!MDB D #@ @Cp4k3D  @ -AFFFFnF F*F!F8FG( 4`#h&F+,F4`5`.F-h-M hFB FF#% T"!PFch`#hӹFB>%FVTl.Q+`FF@FG+h]`-h+h+,`e`hF"F`[+B.%.FHCFT<9F@F"FK,65FZ& "9F@FF6F1F@FG(.`u`-h6h+`]`-hh+3FNFFg-MiF#X+C0ootO6 0AY D ljmmj @mC k Ikkk) Px@x2@0DD1  @ `xx@ F{BqBm@f8FбB> @$O0$818D@) Vx@x2@>D4D1O>$&`$ @#BvE qFdD2 dD12O< $ @ DE@ B2ҋH (`O0@$ B2  0B)s430cc  vDB>D-pD>FE+DGBG>DvD>DB@DpD>FEDB;FF( 4;F(?( px3Xp3  B;D vDB>DpD>FEѠlgF ll8 ll lF B{0{OPٲFFFFH (F,eF  GG3. L.FF (G0x u$>D Hu O0$>D&`yH FFF-M ! ,FF%1)$k!B&5>h$`OqVh`VP 4@1D4@l6$@l,F!41)$F'F<D@7/4,8.@5$O 'h$ PR@5  D(@$B ڱ*Ā"JJ 5P] p E5 % @4"B@R 8@B"!F' &EFpH 8B(h`$ `/O@O _O0r(*!i۱$"aBcOBDa`aZab`\``bbbcccfed: Fo8 FF(/#ajJbFbbj Jbb!B0RjGF-a#mB`+ #MbKc F8@+3/-`cj"jG#ao8oUB]B8FiCjkk3"cjikjGj"cjiG a8o-M*FFOD xDOsBE=,DB٤DE@;D,DXS< +D ,DDZD ,D D , D ,[D D ,D D, D,D D\DD,DDDDaDD DDSDsDcD DDD+DD6B(FOq F FOq FW7ASEظ?e;FBF*OGDBN(FOq F FOq FJ )DD DDD DD DD DD DD DDDD DDDD DDDD DD\DD D D:,D+D,D -MF(Fi,ChCh+>#hk + ##` 00k0#"(%&0FL2[imto2o hZ ##`/$;?@D5-ّH3B"FF"a ,` #^F]Fa#`##a#jO2ch0! !K0#+ПK6 bj3BҜK="ca # #a F4 F#`q/ʀ;?@D5-+&a`OЊK#j"`#i"i ,`a%#.F#`-@Ҁ#j^`#i"i a%#.F#`-@ǀ#j#`#j2 `#i"i ,`a%#.F#`#icЀ-@#j&d^a#i%.F##`#iZ-#lFB(F#"jixQii bE `DDbE:RZFQFT#iZFQFi@a#l  D#d+2##d##`#icG" 0!j2a#l jB>Y!d ЗB#iQFi aDe 0p0jccK#h+|0BvPhk(@V"ij 0(Ghc(@I##`o/;?@D5!/;?@D5,/;?@D5A"i ,`aCGFGF"j*?9a6"ja##d##`#iS7/" 0!j2a$#ljB>Y!d ЗB#iQFiqaDf##`#i- "BгKh"j*Sb/?R+?@D5%.F"j*@#b"#jc"FF?a4 # /?4;?@D5-6a4`& #5F#`hk 0p0#cc#a40 ##`K+?ch{@%#/?;?@D5-c`A+++zKd #ceyK#e#e##`=vK0## #@%- 3 CB kK/?;?@D5%#.F"d#`"l*?vE(FE(F?QFZF  D[D#l #d3/?;?@D5 -D!31"fcfeO6+AKz#f##`m/?c+?@D5-Zf7J=2083$ nB 0JC+cfd#ce$oo2` /"FFFF(9F0FfhhBh#hh #o"FF FMoF1 C2F FFh(!F0F(si?Ds`opFFFF"FF1F(Fp@pFF1F F( ۣh F!Dp@#4p-MF FF/0Flsi +O tj$"FYF0F:F)F0FFOSka?kbo` #0F (, F3j ( DDE  B ҘDE BoF#FZFAF0FRFAF(FK?+`OSkaOSo`ai$a N8+ h+o F]o JC o &JJC XMF +h$ FF@KF!FHj;o(5Jt KS"pG0J#0I@  ޓ^J-MFFFFF!F(F!IF(FaF(F (Fo*!F(FFB#ې/D,ҹ9FpAF0FQF0\FPMC0F!F(FO-AFFFhIF(FF(FO7F,8FjF!F(F@x/+D<[BF1F&( BF!F(FFOp FFPI*FF# Fp@Cp97F:O00"B o P"0D"02𵅰FFFFF[( #:F1F(F`` `` #:F1F#F(F8 ]-MFFF(o(F%'DB +T;c B"YFPFoO3BFPFCB BѻN%O1 O1XF(( 1`FBT;F?5FBȿ F FF:FT -MF EFF 4j8bzC#DBӻQF@FXF F.)F8F FF!FFO4#-AFFFFO0!AF F(۝00 :F1F F -M FFFF: FF FZFAFF FF8"!D BO1REZF FAFF F 9FXD!;D44FF2-MFoJFFĀ!F0FnOF,@t"!(F%!FcJ$0F!FaJ0F~!F^J 0Fv!F[J00Fn!FXJT0Ff!FUJH0F^!FRJ<F0FV!FOJ`F0FN+F!FKJF0FG#Ff!FO30FFJ;C( ""nCf!FO30F?J+A( ""nCf:JO3!F0FB( " "nCfO3!F0F1J C( "@"nCf!F0F+J"nCsf!F0F'JnCsf!F0F#JCCCCXFQhF(8+-Ѹ*hFC h"PDAF0G(#hBF YFh#(#hSDh#h@FSD`#hSDh+#hSD3`{8F#hS 0+Q+ѢhchB-=F'oC#hXFQ#hdp`#h@F^` h8DCh+Ѓh+Уh03` h8D0u hh8D~"AF0GH!h*F9D F1FGF#hYFBFh#O!h9D1 *F F1H `4y-EO  F FFF@"oK` F  ;F"AFG("KO4`"+h0!F#"hF("Ko`2F(Fy-M`BhF2" Fk`+j(h%Oh}a;`shCE")FSK8izi2,UДBT!FNH #O0LJ`7F#2h X+6 {`k;lh 9k+@;h#0x.+!k{`;i C% $}iD 8?C[E \+ 5D}h{a5#Fhh"F!0F!O= O\;iB # F3p!F ahF`(яChh:sцP/Rh:oFFF1F^E\.уCFxkms Ny-MF;mFO # FF` "K` :PF "K1F"Fw#+U;m.#RFymhml:m`C0s@0(OpAFP(F@F0+<(F (7Fl+J.F+{`3x +I +G#+H4F; [E{hB#x+:(Fh+ѻhh:mBTPAFl`!h(KHyh3` )уB ғ 23Bx)Ѥ `+F"(Dt&FF0TF=+  c[EbxEZE=+##pTFO#p;m3AF0Fl40Fh9m!(#RFQF#pF; [E# p3xs"K`Y\+Px(F"F;2;mӹlj#({i+_RF1F HX0Fh9m(?QHkyjN9NNFF$'khB *hX+40G(FFKJKF(F)F0FJFGB);F J0yDBؿ$p)J0Dm0Fw0WNF F!ǿ"iF iFH 3]Ȁ-M F'<"   $+C C$ C  2K]fF1HMS : C$ CO3 E# E@ $P-OO !!(N  USE @D % ,C , ADo /AFK;Dl$H!FH1FHsNNNO-MFF@+FFFF@ F$)F F3XRF0F-IB('FO Dj  E #D0B2#.&}C!LB."P3kDH,I-0K*00FIxDD  - 00۲ +0 0;xg\ p32oJ-- O-M=kF@+FFFF@ F%1F F3O {`-kFzh УF`h2FQF@F#FF8`h z;hDD8o 7F , F-AvBF FO/0F)Ff#"$mARA,u ۼBu ӧBv ?f@[CsRdS DtOU8F)F(FHhOpF?F!?@ F(3*F! FpFIFx3\pG-F[8CH#DBF#Sp Fx;A\- "h3ˆ 3:B€pGh1C ,ZhC,hC,-MFhˆ(HF'sB ")hkh2B;@00 :FQFHT; YFHG7 5̱F S H6#@; K HF,F=ONOzOȀ7 FI ~ 0@u dAE*"" CRo #=( BIHO0y,O-MDFFF@ҀcFˆ 1BZhXhENѸER`DX`O 2SB# #cC  BXa@X Ex Bt\Bxټ~+B $+T ->B}ٔ sFvEѸEO >vE4 3B/m FF:E "B(1F \ @h`DRE,  Y`;?|QF(FhFBhBD:BBEӂh2F2 0TD@(F4EؘEH 0F(F(vO0 "SCL` `S`3oO#-AhFFF FDOE 9ЬEѼBFF @eEdD4ӧB3  CCPChC`O B 00XP0AþO0pƈh : DBO0p%hch+D;BؕB0 4-MF "F+Nh V {wW,B W  BDR  DE; ?E(O2RE  *F!F0FC*FHh $ F F")F((O4 "PCXBdyyH*IHKI @OG9y̷pGp# FF FFH'F0)F Fp@"pypF FF FFH83F)F Fp@"Խpy"pFF FF FFH83F)F Fp@"py-A@@pv ױ2 F !bQF)F"+hZ*`x)+K2! FQF/+`9F F+KYx** " "?)3+`21F F" H(+h FZ*`xPPPPP7% RRRRR x!^SBSA 2)FFxx+! Fw F!!@ 0 F-MF! BFFFFBFF F!F+FBF8FF6B,&F pMC+B ,\D\DҲBѱBFpF-O2ؿB;?+pG DDB;?+FxF2,;+/*0F%x#F4-9DOKB"p0FK;,FDB K ,FɲxFBpG*FpGFFx3)pGFFFFF\B4F4"F9F0F#3U(F8F F+F)BНB 8FDBFx2,FFFF9FF*0 D8F80F,F F8!FGF 0\+8RBO-cC=6 ))O  !  @N 1  # BB @R qI+'=)H=R0#!0 B FFTDE8'p4DE80#8#p*GјECX<k &0&*F#F:4%s=DF#F0&4 '5RO  }  XF CE83:%s=D*F#FO FCE8p3CE8p3:B@ DF F; )@*FF !:-@BE8]8lCE8p38c-AF*K*FFF  F'B<"pB "B0Bp;2B+Bȿ#D#F !!Fb(CD? B B"p7Bp<3!F%KF*FFF0FF(*FQB)+ &*F(B*B (DB82BۣB1ȿ"ȿ$%DT*FO (B88B8p2Q-M FF(CF(O:(3xkBWE8;p{E<# <%+WE;p%N-*I0*iТ0 )OFO F+0 .]x.*mZx^0 )a1F# F+0 Q#{3xz+`g+aL+Z62xx*b*m%*X*WE<%#;p3x+E{pEFrxs+*Ы *#***TEEEE@E"0O8"0**ўT;FO;O Z+O3IhҲ!l+qxl)L#6Fc:*Q"/aaaa;aaaac'aaa?aa'BF;F !SE8p3:*ܸ3ؿODؿ#DWE8T;8;p !FGD* ܸ3ؿ#GF6SE8p3l+T+CFQF8FFf#FS+sxFU+I+M+SD+!и? OE E! i+pm+Aa+O hEa#QF8F#JCFQF8FFFF(CFFQF8FF Fi_IIsx\3FRFE@#@ \  FHp@+ O:p3F3+#%@pCF JE@x%@4+{c F F <9 !cE##T  FO.xl+ B+L+""Ա F s+FRF"CFQF8F]""I -nQo @F"hyF`4WE8:pE !rxE*6EE !l+Z+Dh+FL+T+>!t+4T+#F[hT+ 8FQFF?E:#pCE #CpFG8?+?E80#T+T @3N FJB ` F S+;]pGF FoA0R]pGmF F@AF F mQ ]pG#F M Oku5 F !H#F$01 +.FO0Fy" Kt J]Fs] syn7 F"F x x@ 0K\D C9(Կ08W8pGOppG-px0+CxL\D۲x+"0F%&F0xB `(Fp*"* "-"ѿ "ο#`FFFFo:F FBx*3B *(` x-,н@0@B h FxI\A۲k+m+g+рS#`Qxi)#`xB*3#`-xF0+CxI\A۲x+"0$F!F/F8xNB 7` F*"* "C1A-"˿8 F"hMx\E۲k+ m+g+щAQAQS#`Uxi-#`xAQB*3O #`8-pFFW)KB J \@Fl;]v `!p@%B!`O0p-"տ!xFsF̱%#F.FF jB<+F!hF#x F&0F (FlF'@ F0D7B'Fh F@FAF рpCBF(cCc "!hZC h} 29FZCP\ &%`pFF "!FPM)F0F+ `#cp% D-EFo9K5b2$d!@FDF)Oq@FJeBOu4$$S8N#D- EE!((Fa@mb1Kxp2@m/%%RD,,%ca(FAF#F$*F -#F*F3`K2:a#Oab f`K#<"[ f{`#>`;b8d!@FzYOq@FtI m D!JrE.€QQųFFFG-EF&O8 jD "B ci+#kHhY+#CЩh@F!Dl #BB!@Dj(??1!?_6pF&Bki++kHhpj,DhC#Cch+!!i#j!??1!? .6i)D -AyF+ѽA&iDrBFܠiY+*i "ih@F!D(ijiB!@Dii(??1!?6yF+*ѽ@,j,DDhhbich+!hci!?D?1!? 6+Bۨi!i)D&('KhFBH +H ELFQ;Q-AF"FKFK̲`KF(" `@F c =FnF2F)F F0Wy#J`J`J`J`KJ#?`pG ($ z-M KFhFF0F@I"42TO &F! apppqqRFIfq -2F $RFAF 2FKhMWsp N MI2h+h hS@ B L Kh H3h#`"h(hp@I"`($iQsKhP A1JhB  L#h3+#` H#"#`K``(Qh-M*F FF")FOHM xJxC#(ыxxC#+"ёOy/ 0 :FQF} B ѣyyC#г6@0FU#q#qFBFF4V:F!FPFQBFF&IK:FYF FFF51F*F>)F8FMO;h+"-KhSEN0h"AF#MFFRF FLG"AF(h!h(hT#;`#`3`Q($ Kh8 pG(-AFc q9!$(ppq5 !lp(qS$ )rir@!phqr*h [2!!p!ppap#qbq4=H(b"!9H#(\^##p#'cp#5Hpp'qF(Zh(Ra#cq#qq:F0F4)H)K'F(FF@F<#;FFAF`p8F7"U"p"p"q "Zq"!q"qZp#P?(ݽ6 r js s (ss)t ]##p#cppp41FH4;SLILQQ-AFFB!x)ѽ)ex5C)]2))[()dHT3+R#OOOOOOOOO)S!۰OOOOOOOO#OOOK)5,D"6H"4H"3H- #*F1I1H':F0H#-JU/F?-@#*F*I'H ?':F(H#%J/F0+- #*F IH':FH#0/F"HxKp"HKO*F8FfO5PRQQ6R@@R4,0XY"sF1F 6KB#MEq+p+x1Fl+xl,p@վpcSc,-MD)F8C+Ѹx+Cx+уx+ F"Kh#JBR[Bk3:FzKBx*5*Kћx+ F")F#")FnH"mKmHhDlKx l4 F@hKx+Ob!FfHeI xdH;QF"cH#3`aKh^IF_H!FMܽ 3Zx2DWHMu"TIIF( "QFg+?yLN7h/?}/?q/ FAFO FA0BI@)F@R F=IOb F#D#wcw#0JwFwhu5J R$ "% 4BF#&IF8"I BF BFQF!J9FhpD# FC"O1E)D4̀ЀcSc|x,XY^LĀ|RR8%sMb0 K`K`"K`K`̀ȀĀ-M$cOcH<`(!F_K`_K`Hh%1`@@R! F6YIOb F8O #VJDwwFhQJ R$ "% ("_",X"0Q"4J#FAF8A":I7+F*FQFpH 0FC# (FCC Ccf*K-h*1 "@F$Kh;H#P " C" FD#O1OKIhr#H;`[)D4F`PIH"P2`8R<ȀRsĀMbYЀ̀%KhKhBH@ J Ih@oOcFF`@Ā<R%KJ`J`"K`pG"K`pGhpGFK` FK` FK` FK` |U@"FH; o?犣L#hKJ#?`Ja`@aQ`QS``##`@οO8+H*MF` +hB"om%K` F8$I F#I( F!I(" FF +h3+`Kh@ {KFh `KhsKJ` BrK`K`KJ`"K"KShS`d\K(FFK`pGKhpG KF` `KJ`Ozs\CKC `MboKhKuK`tK )F F`@߀rKh@GOv@qmK]B(FFjKB[f{#{C#@V[B&e}#}:C#[@v@w BоB B@𣀳o-@B@)F F@TO:*@@s B{{e|F&#|vC#[ :*oٮxxF&vBg.e+x@*`+\!(F~(V".JhB3H" yyC#[ +8kz++}+ k}+/H@2F)F F@+(~k~@ @(>Bi}+}}C#}8A! H[IhGxtlSKOsB @s@ B   pG pGpKFOsBdO @tF6"I1@s rBӲ" +sjspo~)s!ds$ iss+tjt8F"F "Ib{#{C#Yj+Ӳ" #tbt8@PB  #sbs#ubuE"p"F[p#p0ICr hBpX[#q#cq@#q#`#riFqrr "" ! FRr rpFFB"w"JFh!4{rd+uu#",v$kuulvvv-MFpFFF/:J2 MOb)F8FO6 F*, ZF1F8SFI"(F. 4$K`K`K`K`K`= F O0oss( $$:!H8 Y(()) + #@J?O( KhcH Kh#HKh H"IH(wCF(H0 H H 眣3S|VSuSe+SSS H" K` (H"K @ hS("`K-M`#"t]O0;`p\KF`==9VN#3`0(FWp(rok F#;`IK`-3+; #CL3`k]( |>K`";Ko`<8H#3`\"4K`T"0K`e"hbL&Jh)JhB"h#`G0+0++!+0LU"hbFHG!hHKHh --$hh9o?眣`\hT( TT9px-AHF FF:!@FF@Fop8`*Fq FM# ,D<(*FIYFCF#IҲ]6Thx0; +!^@@pOpFK FK O"K`h$MF$HBp"I"L*h"K"I` hOb'$hJD)hF# Fh'%!J!ueu[v#vuu%vevK6`uK u(F`4 K`@߼HT-(s-M }F FF#+" 1 %KhB"#K`0+Ob% QFrrqqF""YFPF! F.r r%uuu!u uFFD9F2Fx1F(FMhKKKNh2h:*S]jSSwOrRAI F ?Hf0D F=I=IO Fp $oos( 5,#H Fp!HFF(4F(/|$[lHHZhl.BH[lD+H K%S[XdXnX#` "FF(opFF FF)F jhBMvl BGRshCdEiDeFfFgGhHiIjJkK dJhNfKhLcNjP lRePdM!mRhSbR!iTcS"jUdT#kV`U)lW mX!cX,iY(dW5kZ*`Y2l\+m\,n^.c[<p_/k_4_\Ala6a_Cnb7oc8caE_aHqe:mg@bcQ]cTnhAoiBpjB`fVqkDagXmkHomI^i[^hapmQ`jcroS\kfsqTnqX_nipsY[nqru[sv\_ruux^Zswqya\s~rzbs{cYut|du}f[wv}mr}o]ysqYytrus[{wurw]}Y}ywtyYuz[Ww}xy~zZuVvWwxXyZz{UvXxy^YUz{VX}yTzU{l|W}XSyTU{V|}Q~SnTZZUV{WX}YX~^Z[\b|h}]~^d_`fagh~hci~jukdllqmnopqrstuvwxyxzz{|}~GGAA<'<9-:6373930?0.C.,H,*J*(O('R'&U%$X$"Z"!^!a%W~zR:C>1 %\g4 Tr> *k~W%#Q u1Hw6 8f 6 B f1禠f(akfff4ypfBfm6GurR  N fmOL4% %  %%fm%ttH; 8Q*fm> Z*YO #BmGfm U1WW #CQ1f]]i@rk%GJ #Cf YG #0#C f *fNC #C foopJ#kZY\UTooo:#C fmE   #C fm; ( #C fm* EܕE 4UtL#C fmk'#C f(*>~'#C f #' #C c 5(LQ6 g% %ȵGH       Ae|xe=.   < d j 8Ogz ԼygL50M F;]#༂Z8* j_Ew/r@& eb U9ԋO" MD>zAt6 ;G; eX5Mz* WSQ =Wp _\ s`k cH>%g s jEoB[ m3 o  q ;Xs L#u \4<w kBSy\ ]5Py N%9{ ;:  ͺ Ӻ % ᶶǩʤΫج׻ z    ө׫  ͫ  rE8׫ڬ %.^ƯVS 㺞 ڭΥ H K     ס  ` K ڞ     k  ?}}  c  Z1c L  u>*      6   HU*  Y0/   i@9  #  c8"     p  Q%      BDʬ ׷ é ׫׬#  ) שᶻ﬽ ͫͫ ج# RS ӫӺ 㺩ʬΩз ( l   kC} ig *g*xd]e`F\X#x{gSo+ HMBe^ QHW  | RAL# 4p:g*& sn *Z1ʬ(9 = 0Q%Ƭ(7db3 s ö '  S '=F2}'=)2X'=1+&=A0x'=n.'= s,&'>K)j(? s*KQ&)N(aԻ2*~|zxvutqomjhfc a!^!"["$X$%V%'R'(P(*L*,H,.C.0>13936369-9<%<AAI IY]%MZb@r(>8r(Q8 Qd6@C@Ql r +@ܳ9""9s1{11111111111111111122222#2*21282?2G2O2W29~W.W2ER1=C.)D@P P-P333y33y3y3y33y3y3y3y3y3y3y33y3y3y3y3y3y3y3y3y3y3y3y3y3y3y330@JV`0ׇ@ׇׇׇ920W22e}}I}1}K<  *w w  wW w < +w  +~qIG}-E.I--A,,i,8MnKjl4p4u4z4445"  !Y"!"%]0(", *$.)#-!+%/`@@@yAɺe@Wd3E  q~K%>Sbw]V]VZWM[~LA<  d001eMJ[33+![NYd9ir;U]E' 5<̬t@).'F%6L% nW ?m9ir;nW ?m9ir;aʓ +ީB#8JzЀQjNYMR,YnW ?m9ir; >2RHUNJNy}C7/r1CM &qLFܻՇ stp9DKP/;U'&LHt7&x/iHB.׫VjbZHڣykI)OGI8z!A ,irﲡF'm2A`Bti#L˘wP2*˲:=Egeo@>@mJl$m0VL?ir;1?ir;~b3>O -;6P4ubwF%wt8i9ir;wt8i9ir;QǤ#>LIdcIe )=]QM'hUh=OtUR1h*EM2%-'?M(-'?Mf~*@.!Ê"[NYd9ir;(s*K>;Gہ5'?Ms愣J(bY q  9   8(Hn8v8888HC8899#969@9N9`9l999999999 ::0:?:N:f:s::::::;;1;J;^;d;;;;;;<<8<S<b<s<<<<<<<<==)=G=]=n========>,>G>d>{>>>>?=?S??????? @$@;@U@@@@@AA(ATAuAAAAA"BEBZBmBzBBBBBBC,CACRCaCqC}X@ @ K L'@BHHII*I:IMI^IpIIIIIIIIJJT[wewswwXwwwwK&K*K0K 7~@x}uu@x}e 4XٷRͷer}U͸]V]VZWM[:W/c  @ @    @?rEAgAA?wA 1$kAaA@EAY}?Y@@e!E@3#QC @{A@A@E@A BAAAsAC!-BCA@AA]@oA:>?>O E> L>R>5Y> > c> j>r>#R}>>>>>>>>>)g9gmJg\gmd~4  ̏      @ k q":971`ppp@@@@@@@@@;Zx0N#Wbpbxi8fiZb@7p8&@kQ%-l ",FYoQ% D@ܳ!!!!!!l!!3EWi|     )43r7 ( /   @ $9,~/ba r$7(,/369=@D3Dh&0WE :)*/9CKV^#' )   ' '1a];C L \ g r zC?B א    & BM- I e   ՓB - ? ?בB  B   @Òߒב  B    %@Pjx k u    &B Pg PM^^j, ^^1ͨK  *ЇI445'5da__5_ `_`M` @Bg @B+}   y] %2AW f|+( +@Uj|  4H(     imqp*,I`` @BgM @ @`00P]`FC=݋#@ M [ h v      D,J. :C9˜8C58CU96y6$$$0$$OE-EEEZ2 ˜,˜C24C,CC24(s*K>;;=k|~WH5:NO'L&]fJJQ;GHGNGӱTG^GXGbGgG lGqGvGGGGGGGGGGGGGG G GG GGH HHHH%H+H0H>HFHNHTHGG`H\HgHnHuH{H0W0W@@u@@{@@@@@@@A@A0W0WQaFlFF5FFFFFFFFFDF@FFFG G GGL$Gi1G0W0W %A.A[l@AxF(GQAYAjArAR>AAA AA AA&B B%!B,BQBBPBVB gBqBBBBB3jBBB#BC C+C >CGCYCbC{CCCCCCCCCC DD)D5DGDQDhDtDDDDDDD DD!EE"FEQE$pEzE'EE(EE)EE*EF++F5F,HFNF0W0W!0W:u_^L@:&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> %"K5e zj4u  &it ,~ 8;~ !1Aa  0@`@@A@!  @a`10  @BootOrderBoot####.1234567BootCurrentBootNextPlatformLangCodesPlatformLangOsIndicationsSupportedSecureBootSetupModeAuditModeDeployedModeVendorKeysPKKEKdbdbxdbtdbr<NULL> #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      Xq 9Rk3Le~Fx@r:l4f. ` ( T  H t<'hUh=OtUR1h!A ,i   +,;=[]__of_translate_addressfdt_fixup_memory_banksrockchip_dnl_key_presseddo_bootvx_fdtdo_gptusb_setup_descriptorusb_kbd_removestdio_add_deviceswrite_mbr_sectorpll_para_configphy_device_createfastboot_mmc_flash_writedwc2_free_requestg_dnl_registerfs_devreadefi_free_poolefi_runtime_relocatewrite_sparse_chunk_rawlmb_map_update_notifyadc_channel_datadwc2_ep0_readefi_free_pageswrite_sparse_imageadc_start_channelfdt_find_or_add_subnode(((((AAAAAABBBBBB"2BQYaiq 0@PX`hp(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!FDT and ATAGS support not compiled in /memory## WARNING: fixup memory failed! zimage: Bad magic! Kernel image @ %#08lx [ %#08lx - %#08lx ] arch_numberTLB addrirq_spsp start Early malloc usage: %x / %x Resetting CPU ... (T)(%0*x) %0*x reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32CACHE: Misaligned operation at range [%08lx, %08lx] %s: adc_channel_single_shot fail! download key pressed, entering download mode...setenv preboot; fastboot usb 0prebootsetenv preboot; ums mmc 0usb_dnl_umssnps,dwc2Setting reboot to fastboot flag ... u-boot,spl-boot-deviceunknown resetSoC: Rockchip %s Reset cause: %s reset_reasonPORRSTTHERMALWDOGclk-uclass not found %s: %lu rockchip,rk3288-tinker/clock-controller@ff760000rockchip,rk3288w-crucompatiblefailed to set rk3288w-cru compatible (ret=%d) oscaplldpllcpllgpllnplldisplay information about clocks/mmc@ff0f0000/spi@ff130000/flash@0/mmc@ff0c0000rk3288_sysconrockchip,rk3288-nocrockchip,rk3288-grfrockchip,rk3288-sgrfrockchip,rk3288-pmuERROR: %s image overlaps OS image (OS=%lx..%lx) Ramdisk image is corrupt or invalid RDCould not find a valid device tree FDTsilent_linuxconsole=console=ttynullverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command ERROR %dE: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported Cmdline setup failed (err=%d) subcommand failed (err=%d) Resetting the board... bootmbootz## Transferring control to RTEMS (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... filesize## Transferring control to NetBSD stage-2 loader (at address %08lx) ... Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x./localcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT Skipping fdtdir %s for failure retrieving dts fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxelinux.cfg/path (%s%s) too long, skipping pxelinux.cfg/%sSetting use of fallback Selected fallback option, but not set pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitlepromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedfallbackUnknown OSUnknown ArchitectureUnknown ImageXIPLoading %s %s Uncompressing %sUnimplemented compression type %d Unknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImagesfsplStarFive SPL ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIEFI FirmwareELF ImageInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsize## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkUnknown uclass '%s' in label No bootdevs for '%s' label "%s" is way too long Invalid partition number: %s Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-std/boot/Invalid option Unexpected value '%s' extlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxtftppxefile_addr_rPXEbootmeth_pxeu-boot,extlinux-pxe/EFI/BOOT/PXEClient:Arch:%05x:UNDI:003000bootp_vcibootp_archbootfileNet%x:%xbootmeth_efiu-boot,distro-efidevtypedevnumdistro_bootpartprefixscriptaddrboot_script_dhcpboot.scr.uimgboot.scrarmbianEnvArmbianboot.bmpbootmeth_scriptu-boot,scriptEFI bootmgr flowbootmeth_efi_mgru-boot,efi-bootmgr#size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startWARNING: could not set linux,initrd-start %s. linux,initrd-endWARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesethernetethaddreth%daddrlocal-mac-addressThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) no-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconfERROR: system-specific fdt fixup failed: %s ERROR: fdt fixup event failed: %d - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX Perform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as arguments ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Trying to execute a command out of order Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL bootflowBoot flows## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobVideo%-12s= %s %sactive FB baseFB copy copy sizeFB size%-12s= %dx%dx%d devicetree = %s serial addr width shift clockbdinfoprint Board Info structure%s is not a valid uclass Cannot find device %d of class %s %s is not a valid driver name %s is not a valid node path Cannot find a parent device for node path %s Unable to bind. err:%d Cannot find a device with path %s Unable to remove. err:%d Unable to unbind. err:%d Cannot find driver '%s' Unable to remove all. err:%d Unable to unbind all. err:%d unbindUnbind a device from a driver unbind unbind Use 'dm tree' to list all devices registered in the driver model, their path, class, sequence and current driver. Bind a device to a driver bind Use 'dm tree' to list all devices registered in the driver model, their path, class, sequence and current driver. changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureNo UEFI binary known at %s bootefiBoots an EFI payload from memoryboot Linux zImage image from memoryflushOFFInstruction Cache is %s Data (writethrough) Cache is %s dcacheenable or disable data cache[on, off, flush] - enable, disable, or flush data (writethrough) cacheicacheenable or disable instruction cache[on, off, flush] - enable, disable, or flush instruction cacheclsclear screenList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and information-e-sUnknown parameter: %s dmDriver model low level accesscompatdevresdriversstaticfunction: %s, cpu-time: %lld us, frequency: %lld.%02d times/s cyclic_demoRegistered function "%s" to be executed all %dms cyclicCyclic-necho args to console[-n] [args..] - echo args to console; -n suppresses newline%s[%d;%dH[*] [ ] [%d;%dH %s [%d;%dH[%d;%dH%sSave[%d;%dH%s[%d;%dH Press ENTER to complete, ESC to quit ** Edit Optional Data ** enter optional data: ** Edit Description ** Enter description: [?25l[%d;%dH%s Press any key to continue..\File path is too long!Boot Description is empty!File is not selected!Invalid load option for %ls Quit[?25l[%d;%dH[%d;%dH[?25h ** Update File **No block device found! ** Select Volume **Reading volume failed! ** Select File **Error: Cannot initialize UEFI sub-system, r = %lu Console size is too small! ** UEFI Maintenance Menu ** ** Select Boot Option ** Press UP/DOWN to move, +/- to change orde Press SPACE to activate or deactivate the entry CTRL+S to save, ESC to quit ** Change Boot Order **Description: Initrd File: Fdt File: Optional Data: ** Edit Boot Option ** ** Add Boot Option ** eficonfigprovide menu-driven UEFI variable maintenance interfaceAdd Boot OptionEdit Boot OptionChange Boot OrderDelete Boot OptionSelect FileClear Press UP/DOWN to move, ENTER to select, ESC to quitInvalid ELF image Automatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified host:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s) exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatmkdircreate a directory [] - create a directory in 'dev' on 'interface'fatrmdelete a file [] - delete a file from 'dev' on 'interface'fatwritewrite file into a dos filesystem [ []] - write file 'filename' from the address 'addr' in RAM to 'dev' on 'interface'fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s New length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! sysFailed to add system information to FDT: %s mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structfstypesList supported filesystem typesfstypeLook up a filesystem type : - print filesystem type fstype : - set environment variable to filesystem type lnCreate a symbolic link target linkname - create a symbolic link to 'target' with the name 'linkname' on device type 'interface' instance 'dev'. [ [directory]] - List files in directory 'directory' of partition 'part' on device type 'interface' instance 'dev'.savesave file to a filesystem bytes [pos] - Save binary file 'filename' to partition 'part' on device type 'interface' instance 'dev' from addr 'addr' in memory. 'bytes' gives the size to save in bytes and is mandatory. 'pos' gives the file byte position to start writing to. If 'pos' is 0 or omitted, the file is written from the start.load binary file from a filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from partition 'part' on device type 'interface' instance 'dev' to address 'addr' in memory. 'bytes' gives the size to load in bytes. If 'bytes' is 0 or omitted, the file is read until the end. 'pos' gives the file byte position to start reading from. If 'pos' is 0 or omitted, the file is read from the start. - Find file 'filename' from 'dev' on 'interface' determine its size, and store in the 'filesize' variable.Bank %s: -aGPIO device %s probe error %i GPIO: '%s' not found cmd_gpiogpio: requesting pin %u failed gpio: pin %s (gpio %u) value is unknown (ret=%d) Warning: no access to GPIO output value Warning: value of pin is still %d query and control gpio pins - input/set/clear/toggle the specified pin gpio status [-a] [ | ] - show [all/claimed] GPIOsNo I2C bus selected readingError %s the chip: %d Content isn't valid EDID. Current bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) Error: Not supported by the driver Valid chip addresses: %02XCurrent bus is %d Setting bus to %d Failure changing bus number (%d) Bus %d: %s (active %d) %02x: %s, offset len %x, flags %x Invalid bus %d: err=%d %04x: %02xwritingCRC32 for %08lx ... %08lx ==> %08lx: %02lx %04lx ? I2C sub-systemcrc32edidloopmmmwnmprobeolenUnknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=%-15s LED '%s' not found (err=%d) LED '%s': LED '%s' operation failed (err=%d) manage LEDs on|off|toggle Change LED state led Get LED state led list show a list of LEDstoggleblink %s Uart## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data %08x %04xZero length ??? byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data infinite loop on address range[.b, .w, .l] address number_of_objectsprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l] addr1 addr2 countmemory copy[.b, .w, .l] source target countmemory write (fill)[.b, .w, .l] address value [count]memory modify (constant address)[.b, .w, .l] addressmemory modify (auto-incrementing address)memory display[.b, .w, .l] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX10010halfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)No MMC device available OK, force rescanno mmc device at slot %x set dsr %s YesNo DDR ENH ENH Device: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Name: %c%c%c%c%c%c Bus Speed: %d Mode: %s card capabilitieshost capabilitiesRd Block Len: %d %s version %d.%dHigh Capacity: %s Bus Width: %d-bit%s Erase Group Size: HC WP Group Size: User Capacity: WRREL Boot Capacity: RPMB Capacity: Boot area %d is not write protected power on protected permanently protected in reserved protection state SD doesn't support partitioning userenhwrrelgpPartition configuration: User Enhanced Start: User Enhanced Size: No enhanced user data area User partition write reliability: %s GP%i Capacity: No GP%i partition GP%i write reliability: %s Partitioning successful, power-cycle to make effective Failed! #part_num shouldn't be larger than %d switch to partitions #%d, %s mmc%d is current device mmc%d(part %d) is current device get mmc type error! MMC erase: dev # %d, block # %d, count %d ... Error: card is write protected! %d blocks erased: %s MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s It is not an eMMC device boot areas protected MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s mmcinfodisplay MMC info- display info of the current MMC deviceMMC sub systeminfo - display info of the current MMC device mmc read addr blk# cnt mmc write addr blk# cnt mmc erase blk# cnt mmc erase partname mmc rescan [mode] mmc part - lists available partition on current mmc device mmc dev [dev] [part] [mode] - show or set current mmc device [partition] and set mode - the required speed mode is passed as the index from the following list [MMC_LEGACY, MMC_HS, SD_HS, MMC_HS_52, MMC_DDR_52, UHS_SDR12, UHS_SDR25, UHS_SDR50, UHS_DDR50, UHS_SDR104, MMC_HS_200, MMC_HS_400, MMC_HS_400_ES] mmc list - lists available devices mmc wp [PART] - power on write protect boot partitions arguments: PART - [0|1] : 0 - first boot partition, 1 - second boot partition if not assigned, write protect all boot partitions mmc hwpartition - does hardware partitioning arguments (sizes in 512-byte blocks): USER - <{on|off}> : sets user data area attributes GP - <{gp1|gp2|gp3|gp4}> <{on|off}> : general purpose partition MODE - <{check|set|complete}> : mode, complete set partitioning completed WARNING: Partitioning is a write-once setting once it is set to complete. Power cycling is required to initialize partitions after set to complete. mmc setdsr - set DSR register value wperasehwpartitionsetdsrmtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx ping failed; host %s is not alive host %s is alive rootpathdnsipdomainautoloadpingsend ICMP ECHO_REQUEST to network hostpingAddressboot image via network using DHCP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocoleth%d : %s %pM %s Could not find device %s Driver does not implement stats dump! %s: %llu NET sub-systemlist - list available devices stats - dump statistics for specified device stats%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Warning: Input data exceeds %d bytes - truncated ## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed edit: setenv## Resetting to default environment run commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveenvsave environment variables to persistent storage-bootableUnknown option %s %s%x0x%xSupported partition tables%c %s: ** Bad device specification %s %s ** Unknown partition type '%s' disk partition related commandsuuid : - print partition UUID part uuid : - set environment variable to partition UUID part list - print a device's partition table part list [flags] - set environment variable to the list of partitions flags can be -bootable (list only bootable partitions) part start - set environment variable to the start of the partition (in blocks) part can be either partition number or partition name part size - set environment variable to the size of the partition (in blocks) part can be either partition number or partition name part number - set environment variable to the partition number using the partition name part must be specified as partition name part set type - set partition type for a device part types - list supported partition table types| %-*.*s| %-*.*s| %s ParentDriverOps get_pins_count not supported by %s Ops get_pin_name error (%d) by %s Ops get_pin_muxing error (%d) by %s in %s %-*s: %-*s pin-controller device not selected %s not found Can't get the pin-controller: %s! Pin-controller device is not set! dev: %s pinmuxshow pin-controller muxinglist - list UCLASS_PINCTRL devices pinmux dev [pincontroller-name] - select pin-controller device pinmux status [-a | pin-name] - print pin-controller muxing [for all | for pin-name] -ipv6Invalid pxefile address: %s pxeuuidConfig file '%s' found Config file not found get and boot from pxe filesget [-ipv6] - try to retrieve a pxe file using tftp pxe boot [pxefile_addr_r] [-ipv6] - boot from the pxe file at pxefile_addr_r default-arm-rk3288-firefly-rk3288default-arm-rk3288default-armUSB init failed: %d usb_dnl_rockusb USB cable not detected, Command exit. use the rockusb protocol e.g. rockusb 0 mmc 0 mallocReadWrittenFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s ERROR: trying to overwrite reserved memory... SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-systemHex conversion error on %c Invalid bitlen %d generic_%d:%dspi_generic_drvError %d during SPI transaction sspiSPI utility command[:][.][@] - Send and receive bits - Identifies the SPI bus - Identifies the chip select - Identifies the SPI mode to use - Identifies the SPI bus frequency in Hz - Number of bits to send (base 10) - Hexadecimal string that gets sent time: %lu minutes, %lu.%03lu seconds run commands and summarize execution timecommand [args...] truedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-zSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceloadAddr dev:partUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type lcdputsprint string on video framebuffer setcursset cursor position within screen in characterError: Incorrect USB controller index udpFastboot UDP not enabled tcpFastboot TCP not enabled Error: Wrong USB controller index format usb_dnl_fastboot USB cable not detected. Command exit. run as a fastboot usb or udp device[-l addr] [-s size] usb | udp addr - address of buffer used during data transfers (0x800800) size - size of buffer used during data transfers (0x8000000)UMS disk %dUMS: LUN %d, dev %s %d, hwpart %d, sector %#x, count %#x Couldn't init USB controller. fsg_init failed g_dnl_register failed Please connect USB cable. CTRL+C - Operation aborted. Auto exit in: %.2d s. Check USB cable connection CTRL+C - Operation aborted Use the UMS [USB Mass Storage] [] e.g. ums 0 mmc 0 devtype defaults to mmc## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image ${Failed to get partition driver count Error insufficient memory gpt_partition_listuuid_disk=;name=,start=0x,size=0x,uuid=,uuid_diskError: is the partitions string NULL-terminated? Wrong uuid format for partition %d %s: %s dev %d NOT available repairRepairing GPT: Writing GPT: No partition list provided Partition list incomplete No partition list provided - only basic check Verify GPT: gpt_partition_addrgpt_partition_sizegpt_partition_entrygpt_partition_namegpt_partition_bootableenumerateguidsuccess! gptGUID Partition Table - GUID partition table restoration and validity check Restore or verify GPT information on a device connected to interface Example usage: gpt repair mmc 0 - repair the GPT on the device gpt write mmc 0 $partitions - write the GPT to device gpt verify mmc 0 $partitions - verify the GPT on device against $partitions gpt setenv mmc 0 $name - setup environment variables for partition $name: gpt_partition_addr, gpt_partition_size, gpt_partition_name, gpt_partition_entry, gpt_partition_bootable gpt enumerate mmc 0 - store list of partitions to gpt_partition_list environment variable gpt guid - print disk GUID gpt guid - set environment variable to disk GUID Example usage: gpt guid mmc 0 gpt guid mmc 0 varname | %-*.*s| %-*.*s| %s @ %s seqParent uclassParent name| %-*.*s| %-*.*s| %s @ %d | status: %i Error: %d (%s) Can't get PMIC: %s! PMIC device is not set! dev: %d @ %s First, set the PMIC device! Dump pmic: %s registers %%%d.%dx Can't read register: %d 0x%02x: --PMIC max reg: %d Can't read PMIC register: %d! 0x%%02x: 0x%%%d.%dx Can't write PMIC register: %d! PMIC sub-systemlist - list pmic devices pmic dev [name] - show or [set] operating PMIC device pmic dump - dump registers pmic read - read byte of 'reg' register pmic write - write 'byte' byte to 'reg' register First, set the regulator device! Regulator: %s - missing platform data! Operation not allowed for fixed regulator! regulator-name%-*s %s (err: %d) * regulator-name:Regulator info:%s %-*s %s %-*s %s %-*s %s %-*s %s %-*s * constraints:* parent uclass:* parent name:* device name: - min uV: - max uV: - min uA: - max uA: - always on: - boot on:* op modes: - mode id:Can't get the regulator: %s! Regulator device is not set! %s: no regulator platform data! dev: %s @ %s Regulator: %s - can't get the Voltage! -fValue exceeds regulator constraint limits %d..%d uV Regulator: %s - can't set the Voltage! Regulator: %s - can't get the Current! %d uA Current exceeds regulator constraint limits Regulator: %s - can't set the Current! Regulator: %s - can't get the operation mode! mode id: %d Regulator: %s - can't set the operation mode! Regulator: %s - can't enable! Regulator: %s - can't disable! enableddisabledRegulator %s status: * enable: * value uV: * current uA: * mode id:uVEnabled%-20s %-10s %10s %10s %-10s %s StatusModemA%-20s %-10s %10d %10s %-10s %iregulatoruclass operationslist - list UCLASS regulator devices regulator dev [regulator-name] - show/[set] operating regulator device regulator info - print constraints info regulator status [-a] - print operating status [for all] regulator value [val] [-f] - print/[set] voltage value [uV] (force) regulator current [val] - print/[set] current value [uA] regulator mode [id] - print/[set] operating mode id regulator enable - enable the regulator output regulator disable - disable the regulator output No CLI available%.*s%*ssyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort *?[\%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective Net: load-environmentMMC: Core: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! binman_init failed:%d modelModel: %s NULL device name! mdio_register: non unique device name '%s' %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_ignorelistusb_ignorelist parse error in "%s" usb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storagedigital signal, analog signal, , blank to black, separate sync, composite sync, sync on green, serration vnon-RGBno Not a valid EDID EDID version: %d.%d Product ID code: %04x Manufacturer: %s MAGOQIVSCSerial number: %08x Manufactured in week: %d year: %d Video input definition: %svoltage level %d%s%s%s%s%s Monitor is %s Maximum visible display size: %d cm x %d cm active offPower management features: %s%s, %s%s, %s%s standbyEstabilished timings: 720x400 70 Hz (VGA 640x400, IBM) 720x400 88 Hz (XGA2) 640x480 60 Hz (VGA) 640x480 67 Hz (Mac II, Apple) 640x480 72 Hz (VESA) 640x480 75 Hz (VESA) 800x600 56 Hz (VESA) 800x600 60 Hz (VESA) 800x600 72 Hz (VESA) 800x600 75 Hz (VESA) 832x624 75 Hz (Mac II) 1024x768 87 Hz Interlaced (8514A) 1024x768 60 Hz (VESA) 1024x768 70 Hz (VESA) 1024x768 75 Hz (VESA) 1280x1024 75 (VESA) 1152x870 75 (Mac II) Standard timings: %dx%d%c %d Hz Monitor serial number: %s Monitor ID: %s Monitor name: %s Monitor range limits, horizontal sync: %d-%d kHz, vertical refresh: %d-%d Hz, max pixel clock: %d MHz %dx%d%c %d Hz (detailed) None Enter choice: usbkbdnulldev%s: warning, ret=%dUSB KBD: Error allocating private data Failed to get keyboard state from device %04x:%04x stdinusb_kbdusb-keyboardstdoutstderrsilentNo devices available!In: Out: Err: pre-reloc realloc() is not supportedalloc space exhausted cyclic function %s took too long: %lldus vs %dus max (unknown)CRC32 for %08lx ... %08lx ==> %08lx vidconsole%s: Failed to probe keyboard '%s' (ret=%d) bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) Problem No valid hush parser to use, cli will not initialized! [?25h %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected Command '%s' failed: Error %d loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for %s device %d -- Partition Type: %s Whole Disk** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x %08x-%02x Extd Boot%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type MBR%s: failed writing '%s' (1 blks at 0x0) DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISOu-boot,efi-partition-entries-offsetPart Start LBA End LBA Name Attributes Type GUID Partition GUID %3d 0x%08llx 0x%08llx "%s" attrs: 0x%016llx type: %pUl guid: %pUl More partitions than allowed! Partition name: %s does not match %s! Partition %s size: %llu does not match %llu! Partition %s start: %llu does not match %llu! %s: can't enable vdd-supply!%s: can't enable vss-supply!vdd-polarity-negativevdd-supplyvdd-microvolts%s: Can't update Vdd. Error: %dvss-polarity-negativevss-supplyvss-microvolts%s: Can't update Vss. Error: %ddrivers/adc/adc-uclass.cError in %s/%s(). Wrong channel selection for device: %s Requested channel is not active!Error reading channel data, %d!Requested channel is invalid!Error starting channel, %d!Error stopping channel, %d!Dev: %s - can't get address!saradc-apbvref-supplycan't get vref-supply: %d can't get vref-supply value: %d rockchip_saradcrockchip,saradcrockchip,rk3066-tsadcrockchip,rk3399-saradcrockchip,rk3588-saradc%s:%d(none) IDE device %d: Device %d: unknown device scsisatanvmenvmxipefiloadervirtiopvblockblkmaprkmtdubi#clock-cellsclock-namesassigned-clock-parentsassigned-clocksassigned-clock-ratesclock-frequencyfixed_rate_raw_clockfixed_clockclock-divclock-multfixed_factor_clockfixed-factor-clockclock-output-namesext_gmacrockchip_sysreset%s: the frequency can not be 0 Hz %s: Cannot find out a supported VCO for Frequency (%luHz). %s: Failed to match output frequency %lu, difference is %u Hz, exceed 4MHZ rockchip_rk3288_crurockchip,rk3288-cru/clocks/firmware/reserved-memoryrootroot_drivernopdevice '%s' failed to unbind simple_bussimple-bussimple-mfd %-10.10s %3d [ %c ] %-20.20s | `-- |-- uclass %d: %s %-3i %c %s @ %08lx, seq %d(out of memory) Class Seq Probed Driver Name ----------------------------------------------------------- Driver Compatible %-20.20s%-20.20s %s Driver uid uclass Devices %-25.25s %-3.3d %-20.20s %-51.51s%-25.25s Driver Address %-25.25s %p little-endianbig-endiannative-endianbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kx%s: %s: error: gpio %s%d not reserved get_valueset_valueset_dir_flags%s.%s%d#gpio-cells%s%d: %s: %d [%c]%s%sinputoutputunusedunknowngpio-rangesrockchip_gpio_bankrockchip,gpio-bankSystem reset not supported on this platform resetting ... u-boot,i2c-transaction-bytesgeneric_%xi2c_generic_chip_drvu-boot,i2c-offset-leni2c-chipi2c_genericrockchip_rk3066_i2crockchip,rk3066-i2crockchip,rk3188-i2crockchip,rk3228-i2crockchip,rk3288-i2crockchip,rk3328-i2crockchip,rk3399-i2cdefault-stategpio_ledgpio_led_wrapgpio-ledsError enabling VMMC supply : %d Unknown modeStatus Error: %#08x Timeout waiting card ready MMC: block number 0x%lx exceeds max(0x%lx) mmc fail to send stop cmd eMMC >= 4.4 required for enhanced user data area Card does not support partitioning Card does not define HC WP group size User data enhanced area not HC WP group size aligned GP%i partition not HC WP group-size aligned Card does not support enhanced attribute Total enhanced size exceeds maximum (%#x > %#x) Card does not support host controlled partition write reliability settings Card already partitioned vmmc-supplyvqmmc-supplyCard did not respond to voltage select! : %d MMC: no card present unable to select a mode No ext_csd found! Select HS400 failed %d Select HS400ES failed %d unable to select a mode: %d Man %06x Snr %04x%04x%c%c%c%c%c%c%s - probe failed: %d MMC legacyMMC High Speed (26MHz)SD High Speed (50MHz)MMC High Speed (52MHz)MMC DDR52 (52MHz)UHS SDR12 (25MHz)UHS SDR25 (50MHz)UHS SDR50 (100MHz)UHS DDR50 (50MHz)UHS SDR104 (208MHz)HS200 (200MHz)HS400 (200MHz)HS400ES (200MHz)boot0boot1rpmbgp1gp2gp3gp4MMC Device %d not found eMMC%s: %d (%s)mmc_blkmmc_bootdevu-boot,bootdev-mmc Caution! Your devices Erase group is 0x%x The erase range would be change to 0x%lx~0x%lx mmc erase failed mmc write failed non-removablefifo-depthfifo-modeclock-freq-min-maxrockchip_rk3288_dw_mshcrockchip,rk2928-dw-mshcrockchip,rk3288-dw-mshcspi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave jedec,spi-nor%s %s: Erase operation failed. udevice *)(NULL%s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-readSF: Detected %s with page size , erase size , total CPU not owner of tx frame failed to enable clock %d failed to get clock phandle(%d) phy-supplyError enabling phy supply Failed to allocate MDIO bus failed to disable all clocks max-speedsnps,reset-active-lowsnps,reset-gpiosnps,reset-delays-us, fiber modeDMA reset timeout Could not initialize PHY %s %s: No link. Speed: %d, %s duplex%s eth_designwareallwinner,sun7i-a20-gmacamlogic,meson6-dwmacst,stm32-dwmacsnps,arc-dwmac-3.70asophgo,cv1800b-dwmacclk_mac_speedclock_in_outtx_delayrx_delaytx-delayrx-delaygmac_rockchiprockchip,px30-gmacrockchip,rk3228-gmacrockchip,rk3288-gmacrockchip,rk3308-gmacrockchip,rk3328-gmacrockchip,rk3368-gmacrockchip,rk3399-gmacrockchip,rv1108-gmac(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYgpio-controllerpinconfigpinctrl-namespinctrl-%d%s %s: could not find pctldev rockchip,pinsrockchip,grfrockchip,pmubias-disablebias-bus-holdbias-pull-upbias-pull-downbias-pull-pin-defaultdrive-strengthinput-schmitt-disableinput-schmitt-enablerockchip_rk3288_pinctrlrockchip,rk3288-pinctrlgpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8regulatorsact8846 pmicactive-semi,act8846REGact8846_regregulator-min-microvoltregulator-max-microvoltregulator-init-microvoltregulator-min-microampregulator-max-microampregulator-ramp-delayregulator-force-boot-offregulator-state-memregulator-off-in-suspendregulator-suspend-microvoltregulator-always-onregulator-boot-on%s %s: '%s' has nonunique value: '%s enable-active-highstartup-delay-usu-boot,off-on-delay-usCan't set regulator : %s gpio to: %d regulator_fixed_clkregulator_fixedregulator-fixed-clockregulator-fixedrockchip_rk3288_dmcrockchip,rk3288-dmcstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uart%s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) spi-max-frequency%s %s: Invalid cs %d (err=%d) Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported spi_genericpower-supplyenable-gpios#pwm-cellspwmsdefault-brightness-levelbrightness-levelspwm_backlightpwm-backlightvidconsole0no such font: %s, make sure it's name has x format 8x16Video device '%s' cannot allocate frame buffer memory - ensure the device is set up before relocation %s.vidconsole%dvideo_initvideoError: no valid bmp image at %lx Error: %d bit/pixel mode, but BMP has %d bit/pixel ddc-i2c-bussimple_panelsimple-panelauo,b133xtn01auo,b116xw03auo,b133htn01boe,nv140fhmn49lg,lb070wv8sharp,lq123p1jx31boe,nv101wxmn51panasonic,vvx10f004b00ahb%s %s: failed to get ahb reset (ret=%d) %s %s: failed to assert ahb reset (ret=%d) %s %s: failed to deassert ahb reset (ret=%d) remote-endpointedprk3288-dpmipicdn-dplvdsdclk%s %s: failed to get dclk reset (ret=%d) rockchip_rk3288_voprockchip,rk3288-vopvcc18_lcdVCC18_LCDvdd10_lcd_pwren_hvdd10_lcdVDD10_LCDvcc33_lcdrk3288_hdmi_rockchiprockchip,rk3288-dw-hdmivcc50_hdmiFAILOKAYfastboot_bootcmd0x%pBooting kernel at %s... 0x%08xN/AU-Boot 2025.01-30.40x%016zxrawplatformplatform not setBoard not setValue not set_ayesinvalid partition name%s: %sINFOmissing varMOREfastboot.%sVariable not implementedversion-bootloaderdownloadsizemax-download-sizeserialnoversion-basebandproductcurrent-slothas-slotpartition-typepartition-sizeis-userspaceExpected command parameterExpected nonzero image sizeStarting download of %d bytes DATApartitions not setgpt write mmc %x $partitionsCannot set recovery flagCannot set fastboot flagCannot set reboot flagcommand %s not supported. Unsupported commandcommand %s not recognized. unrecognized commandUnknown multiresponse commandReceived invalid data length downloading of %d bytes finished getvardownloadreboot-bootloaderreboot-fastbootreboot-recoveryset_activeoem formatoem partconfoem bootbusoem runoem consoleoem boardACmdUCmderasinginvalid mmc device invalid mmc devicepartition not givenfastboot_partition_alias_fastboot_raw_partition_Invalid number of arguments. mmcpartinvalid partition or deviceno such deviceno such partitionunknown partition table typeunanticipated error%s: updating MBR, Primary and Backup GPT(s) %s: invalid GPT - refusing to write to flash invalid GPT partition%s: writing GPT partitions failed writing GPT partitions failed........ success mbr%s: updating MBR %s: invalid MBR - refusing to write to flash invalid MBR partition%s: writing MBR partition failed writing MBR partition failedFlashing sparse image at offset %lu too large for partition: '%s' too large for partitionFlashing Raw Image failed writing to device %d failed writing to device........ wrote %lu bytes to '%s' Erasing blocks %lu to %lu due to alignment failed erasing from device %d failed erasing from device........ erased %lu bytes from '%s' rk_pwmrockchip,rk2928-pwmrockchip,rk3288-pwmrockchip,rk3328-pwm#reset-cellsresetsreset-namesrockchip_resetdr_modeutmiutmi_wideulpihsicUNKNOWNlow-speedfull-speedhigh-speedwirelesssuper-speedsuper-speed-plusperipheralotgRx: failed to receive: %d Waiting for Ethernet connection... done. unable to connect. asix_ethError: SMSC95xx: No MAC address set - set usbethaddr smsc95xx_ethdrivers/usb/gadget/dwc2_udc_otg.cWARNING at %s:%d/%s()! drivers/usb/gadget/dwc2_udc_otg_xfer_dma.cBUG at %s:%d/%s()! BUG!No memory available for UDC! crq->brequest:0x%x ep1in-bulkep2out-bulkep3in-int!cdev->configcompositeusb_dnload%s: failed!, error: %d | / - \invalid number of LUNs: %u Linux %-8s%-16s%04xFile-Store GadgetMass Storage Function, H%c=%unwritten:%zd amount:%u Unknown x%02xf_fastbootstatus: %d ep '%s' trans: %d Error %d on queue Bad status: %d buffer overflow failed to enable out ep failed to alloc out req failed to enable in ep failed alloc req in unknown command: %s FAILunknown commandFAILbuffer overflowRockusb command %x not support yet f_rockusbinvalid device "%s", %d failed erasing device %s: %d failed writing to device %s: %d failed reading from device %s: %d read storage id EMMC read chip version: rockkusb set reboot flag: %d usb_gadgetusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d companionFailed to get companion (ret=%d) No USB controllers found usb_dev_genericu-boot,bootdev-usbdisable-over-currenthnp-srp-disable%s %s: Error disabling vbus supply %s %s: Failed to reset: %d vbus-supply%s %s: Error enabling vbus supply USB DWC2 Root-Hub submit IRQ: NOT implemented unsupported root hub command %s %s: Timeout poll on interrupt endpoint dwc2_usbbrcm,bcm2835-usbbrcm,bcm2708-usbenv_buf [%u bytes] too small for value of "%s" ## Error: illegal character '=' in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:mo,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,serial#:so,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,loadaddr:loadaddr,silent:silent,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksMMC partition switch failed two copies of u-boot,mmc-env-partitionPartition '%s' [0x%lx; 0x%lx] too small for %senvironment, required size 0x%lx blocks u-boot,mmc-env-offsetInvalid ENV offset in MMC, copy=%d No MMC card foundNo block deviceMMC partition switch failedWriting to %sMMC(%d)... !read failedReading from MMC(%d)... ** Unable to write file %s ** %s/ %s %8lld %s %d file(s), %d dir(s) ** Unable to create link %s -> %s ** Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (%llu bytes written in %lu ms** Unable to create a directory "%s" ** Supported filesystemsfatext4unsupported** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s fs uses incompatible features: %08x, ignoring error: overflow occurs Invalid FAT entry: %#08x FAT sector size mismatch (fs=%u, dev=%lu) FAT cluster size not set FAT cluster size too big (cs=%u, max=%u) Error: writing directory entry <>:"/\|?*Error get-and-setting cluster Error: no space left: %llu U%.*s.%.3s~%dNo current device Interface: %s No valid FAT fs found Filesystem: FAT%d "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02XFAT: illegal filename (%s) %s: doesn't exist (%d) Error: writing contents Error: flush fat buffer Error: out of memory Error: cannot remove root Error: directory is not empty: %d %s: already exists . .. ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part Cannot free EFI memory pool EFI protocol GUID missing for driver '%s' Failed to add EFI driver %s efiblk#%defi_blkefi_disk addEvent registration for efi_disk add failed efi_disk delEvent registration for efi_disk del failed EFI block driverDM_TAG_EFI not found /EFI/BOOT/%s1234567Loading %ls '%ls' failed Booting: %ls Unloading image failed BootNext must be 16-bit integer Loading from BootNext failed, falling back to BootOrder Deleting BootNext failed BootOrder not defined delete boot option(%ls) failed EFI boot manager: Cannot load any image Can't find %pD specified in Boot#### Can't read fdt Booting %pD Loading image failed Uninstalling protocol interfaces failed Handle %p has protocols installed. Unable to delete ERROR: Failure to install protocols for loaded image EFI application exitedBOOTARM.EFIneed device tree invalid $fdt_addr or $fdtcontroladdr invalid device tree Failed to reserve space for FDT failed to process device tree failed to install device tree failed to set watchdog timer ## Application failed, r = %lu ## %ls [?25%c[%u;%u;%um78ERROR: Failed to register WaitForKey event ERROR: Failed to register console event ERROR: Failed to set console timer ERROR: Out of memory [%d;%dH[?25h[%d;%dH%ls[%d;%dH%lsPartition %d: invalid GUID %s MemhostfsUNKNOWN(%04x,%04x)MemoryMapped(0x%x,0x%llx,0x%llx)VenHw(%pUlCtrl(0x%0x)Acpi(PNP%04X,%d)Ata(%d,%d,%d)Scsi(%u,%u)Uart(%lld,%d,%c,USB(0x%x,0x%x)MAC(UsbClass(0x%x,0x%x,0x%x,0x%x,0x%x)Sata(0x%x,0x%x,0x%x)NVMe(0x%x,%s%02xUri(%s(%u)HD(%d,MBR,0x%08x,0x%llx,0x%llx)HD(%d,GPT,%pUl,0x%llx,0x%llx)HD(%d,0x%02x,0,0x%llx,0x%llx)CDROM(%u,0x%llx,0x%llx)VenMedia(%pUlDNEOMS1.5Reserved memory mapping failed addr %llx size %llx kaslr-seedError deleting %s rng-seed%s/%sboardver%s/%s%s%s%s.dtb/dtb/dtb/current/dtbs///./..bad file path! invalid image type: %u UEFI image [0x%p:0x%p] pc=0x%zx '%pD'Not a PE-COFF file Invalid number of sections: %d Invalid optional header magic %x Unknown Relocation off %x type %x Machine type 0x%04x is not supported %s: illegal free 0x%llx, 0x%zx %s: illegal free 0x%p en-USEFI: cannot initialize platform language settings %04XERROR: Secure state transition failed Cannot persist EFI variables without system partition ubootefi.varFailed to persist EFI variables Invalid EFI variables file Failed to set EFI variable %ls Failed to load EFI variables EFI: Watchdog timeout ERROR: Failed to register watchdog event ERROR: Failure adding GOP protocol Disk %s not ready Adding block device %s failed, r = %lu Adding partition for %s failed %s %d:%u%s %dERROR: Failed to register network event ERROR: Failed to set network timer ERROR: Failure to add protocol Failed to write SMBIOS table No SMBIOS tables to install Can't find initrd specified in Boot#### installing EFI_LOAD_FILE2_PROTOCOL failed Creating event failed Failed to install ECPT %d iterations in %lu ms: %lu/s, %lu DMIPS dhry[iterations] - run dhrystone benchmark - run the Dhrystone 2.1 benchmark, a rough measure of CPU speed DHRYSTONE PROGRAM, SOME STRINGDHRYSTONE PROGRAM, 1'ST STRINGDHRYSTONE PROGRAM, 2'ND STRINGDHRYSTONE PROGRAM, 3'RD STRING/binmanmultiple-imagesSuccessOperation not permittedNo such file or directoryNo such processInterrupted system callNo such device or addressArgument list too longExec format errorBad file numberNo child processesTry againOut of memoryPermission deniedBad addressBlock device requiredDevice or resource busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeMath argument out of domain of funcMath result not representableResource deadlock would occurFile name too longNo record locks availableFunction not implementedDirectory not emptyToo many symbolic links encounteredNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedInvalid exchangeInvalid request descriptorExchange fullNo anodeInvalid request codeInvalid slotBad font file formatDevice not a streamNo data availableTimer expiredOut of streams resourcesMachine is not on the networkPackage not installedObject is remoteLink has been severedAdvertise errorSrmount errorCommunication error on sendProtocol errorMultihop attemptedRFS specific errorNot a data messageValue too large for defined data typeName not unique on networkFile descriptor in bad stateRemote address changedCan not access a needed shared libraryAccessing a corrupted shared library.lib section in a.out corruptedAttempting to link in too many shared librariesCannot exec a shared library directlyIllegal byte sequenceInterrupted system call should be restartedStreams pipe errorToo many usersSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on transport endpointProtocol family not supportedAddress family not supported by protocolAddress already in useCannot assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection because of resetSoftware caused connection abortConnection reset by peerNo buffer space availableTransport endpoint is already connectedTransport endpoint is not connectedCannot send after transport endpoint shutdownToo many references: cannot spliceConnection timed outConnection refusedHost is downNo route to hostOperation already in progressOperation now in progressStale NFS file handleStructure needs cleaningNot a XENIX named type fileNo XENIX semaphores availableIs a named type fileRemote I/O errorQuota exceededNo medium foundWrong medium typemanufacturerasset-tagskufamily01/01/2025_SM3_biosbaseboardchassis%s: Sparse image block size issue [%u] sparse image block size issueFlashing Sparse Image Bogus chunk size for chunk type Raw%s: Request would exceed partition size! Request would exceed partition size!Malloc failed for: CHUNK_TYPE_RAW%s: Write failed, block #%lu [%lu] flash write failure(incomplete)Bogus chunk size for chunk type FILLMalloc failed for: CHUNK_TYPE_FILLWrite failed, block #%s: %s %lu [%d] flash write failureBogus chunk size for chunk type CRC32%s: Unknown chunk type: %x Unknown chunk type........ wrote %llu bytes to '%s' sparse image write failureevent %d/%scall %pinitcall failed at %s (err=%dE) list passed to list_sort() too long for efficiency invalid distance too far backinvalid distance codeinvalid literal/length codeunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okaydisplay-timingshback-porchhfront-porchhactivehsync-lenvback-porchvfront-porchvactivevsync-lenvsync-activehsync-activede-activepixelclk-activeinterlaceddoublescandoubleclkseparatefitembedbloblistnvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcintel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.count = %#x %s[%d] [%#llx-%#llx], %#llx bytes, flags: invalid %#x %s: LMB Map notify failure %lu This will not be a case any time lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. Unable to init LMB no-overwriteno-notifyRE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%s:%u: %s: Assertion `%s' failed.## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armv7Invalid pxeuuid: %s Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root PathNIS Domain Name*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again netretryonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Cannot autoload with TFTPGET Abort Bytes transferred = %u (%x hex) %d.%d.%d.%dnvlanUsing %s device octetblksize%c%d%cwindowsize%c%d%cFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again T tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) %02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' fromTFTP %s server %pI4; our IP address is %pI4; sending through gateway %pI4Filename '%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM ethactethrotateethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskip[:] [] - boot EFI payload bootefi bootmgr [fdt address] - load and boot EFI payload based on BootOrder/BootXXXX variables. If specified, the device tree located at gets exposed as EFI configuration table. scan - boot first available bootflow [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS[addr [initrd[:size]] [fdt]] - boot Linux zImage stored in memory The argument 'initrd' is optional and specifies the address of the initrd in memory. The optional argument ':size' allows specifying the size of RAW initrd. When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead  demo - register cyclic demo function cyclic list - list cyclic functions bootcmd=bootflow scanbootdelay=2baudrate=115200preboot=usb startloadaddr=0x800800arch=armcpu=armv7board=firefly-rk3288board_name=firefly-rk3288vendor=fireflysoc=rk3288usb_ignorelist=0x1050:*,mtdids=mtdparts=fdt_high=0x0fffffffinitrd_high=0x0ffffffffdtfile=rk3288-firefly.dtbpartitions=uuid_disk=${uuid_gpt_disk};name=loader1,start=32K,size=4000K,uuid=${uuid_gpt_loader1};name=loader2,start=8MB,size=4MB,uuid=${uuid_gpt_loader2};name=trust,size=4M,uuid=${uuid_gpt_atf};name=boot,size=112M,bootable,uuid=${uuid_gpt_boot};name=rootfs,size=-,uuid=69DAD710-2CE4-4E3C-B16C-21A1D49ABED3;scriptaddr=0x00000000pxefile_addr_r=0x00100000fdt_addr_r=0x01f00000kernel_addr_r=0x02000000ramdisk_addr_r=0x04000000stdin=serial,usbkbdstdout=serial,vidconsolestderr=serial,vidconsoleboot_targets=mmc1 mmc0 nvme scsi usb pxe dhcp spi0123456789ABCDEFuoincompat Dump list of drivers with compatibility strings dm devres Dump list of device resources for each device dm drivers Dump list of drivers with uclass and instances dm static Dump list of drivers with static platform data dm tree [-s][-e][name] Dump tree of driver model devices (-s=sort) dm uclass [-e][name] Dump list of instances for each uclass'hUh=OtUR1hdwc2-udcarocsdxbimdefault [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] ep0-control Android Fastbootaddr [-c] [-q] [] - Set the [control] fdt location to fdt systemsetup - Do system-specific set up fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.Mass Storage0123456789abcdefbus [muxtype:muxaddr:muxchannel] - show I2C bus info i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c dev [dev] - show or set current I2C bus i2c edid chip - print EDID configuration information i2c loop chip address[.0, .1, .2] [# of objects] - looping read of device i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c probe [address] - test for and show device(s) on the I2C bus i2c read chip address[.0, .1, .2] length memaddress - read to memory i2c write memaddress chip address[.0, .1, .2] length [-s] - write memory to I2C; the -s option selects bulk write in a single transaction i2c flags chip [flags] - set or get chip flags i2c olen chip [offset_length] - set or get chip offset length i2c reset - re-init the I2C Controller i2c speed [speed] - show or set I2C bus speed+,<=>:;"/\|?*[]addr part [dest] - extract from legacy image at and copy to Rockchip #(-27] - Run script starting at addr !R\248>Ž ;?2H53F6CDBALinux U-Boot 2025.01-3 (Apr 08 2025 - 23:07:41 +0000)yUIWyVSU}U YEXWQWZ[S[\]\S ]y_9_%_+_bZ!0W0WW!0W0WB!0W0W#R! 0W0WW!@0W0WW!0W0WW!0W0WW!0W0WT!0W0WK!5r0W0W_1x0W0W_1Yx0W0W6b!|0W0W=b!{0W0WDb!|0W0WLb!u|0W0Wx>!|0W0W!{0W0Wb!=~0W0W! }0W0Wog{gd~g // !m0W0Wr!q0W0W!0W0Wx!0W0W}!0W0W !ٰ0W0W!0W0W!10W0W!0W0W!10W0Wz!0W0W'P10W0W!!A0W0W!ѯ0W0W;! 0W0W!0W0W@1y0W0Wz!0W0W10W0W'P10W0W1-0W0W!0W0W!0W0W10W0W!0W0W1U0W0W10W0W10W0WӤ10W0WO10W0Wn@10W0Wu190W0Wz10W0W150W0W@!0W0W@!)0W0Wy10W0WG@150W0W91q0W0W!0W0W!90W0Wޓ!Y0W0W!Q0W0W@!0W0W˱O!0W0W!0W0Wmr!0W0Wz!0W0W'P!Y0W0W!a0W0W!m0W0W!)0W0Wޓ!0W0W!0W0WA!0W0W:!0W0W`!0W0WQ!0W0WD8 L  =9   CC-ED?EDCKECED DDGEтOEiD7E;EQD DC = }ESEWE C [EC$$44<<DDLLTT\\ddlltt||ăẵ̃ԃԃ܃܃  $$,,44<<DDLLTT\\ddlltt||ĄĄ̄̄ԄԄ܄܄  $$,,44<<DDLLTT\\ddlltt||ąą̅̅ԅԅ܅܅  $$,,44<<DDLLTT\\ddlltt||ĆĆ̆̆ԆԆ܆܆  $$,, %, \\MY7  ؋}tsAs       ddvwwK! =1D d~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666nIyCsQ4d5e7g8hVBr3c@p;kAqK{T?o<lDtFvUJzSL|PM}GwO9iN~Hx=mEuR6f:j$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,01jkjkZ[LMV'GXY,-4RHIlmUBC_*+-M$D;./ !<=()"# @!Ars3S%E*J8 ]5PQFGVWlm\]dehiRStuvwX: \     nofg YhiJKNO Z>`a|}~?$%pqDE`aTUz{(H)I&'^bcdefg,L"B&F [#CxyT2/Obc+KPQW^_.N7@A6!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Z------------ -$-!-"-%---- -- - - - -----------#--'---,0,(,X,,1,,M, ,<,,4,,7,*,Z,,G,,3,,H, ,;, ,:,),Y,',W, ,9,+,[, ,=,.,^,,>,,?,,@,,A,,I,,J,,B,,C,,N,,K,,,\,,D,$,T,%,U,",R,-,],,L,,E,,F,,2,!,Q, ,P,,O,,5,&,V,#,S,,8,,6,   q  prssr)!-%/'+#u( ,$.&*"tpq91=5?7;3w80<4>6:2viameogkc}h`ldnfjb|IAMEKCyH@LDJBxvwYQ]U_W[S{zAa&':e,23m,Q456789:;<=BbSCFGCc      ;<Sno,-./Dd    WEe()FG$%"#JKjkFfGg"# !` !cABHh*+()$%g,h,&'"#$%f&'u,v,&'Ii,-./   *+./h(),-yz{|}yilmJj45HIKk0167i,j,BC2345@ADELl9:=l=>;<<=6789`,a,HI:;?@b,kABMm>?@ABCn,qNnCDGHEFJKDEFGrHI OoNO*+./01PQ  JKLMLMRSPQLMNO,-NO[T"#PpTUVWRSTUc,}PQQqXYVWRrZ[TUXYVWXYZ[\]^_LMd,}>?X\\]SsZ[de`afg^_\]`abchi~,?YaTtdebcpq>f,jklmnofgdefg*+o,Pp,Re~oE()UuDlmvwrspqjkz{rsnohixytuVv^_~|}hibc`aWwtur,s,XxYyvwx23NOZzyz}~k,l,{|$%,@ (hH~+B[!! )[!}s[0W5]1v ^$^D_1xM_q_@!mJW0WDW!mJW0W`1x`Xi@1}iiY@rAYYr8@!nlWYأ!ޣ{@i1 Gifi8@!]y>`}][!#40Wa!{a0W!ea!){a0WL! ,r!Ib@}Ab_|`!z``L!K{h7!!-m77b@|AbLc{@!~bb19 $f1%f0W@!Pd)j!-.j0W5l1w>lfl m!k)vuBqf8 a݂"G{OU!iC;Ͷ;3JA;BTy;3g}CT AJ}Ii* '3.ͺ !YM@Mݲ)i}gMc!( RxJ=kJEJ :KPK_A! L&!O(!%2O6em8> o?HLG Q/SYkZ)l [t ^ac]xQw|8;e lmU Dq_9ɋ $x sarD4uwW~_#*@ $_Y*D@ $B q U=H88HPx|0X\LTX $(4 8     $(,048dhlptx|PTX\`TX\`dhlptx| 4\   H      4!\!`!!!!!x####,$$$$$%%%%%%%x&|&&&&)))))))))*** **** *$*+++++++++++ ,,8,d,---D--8.<.@.h/l/p/t/x/|//////000 22D22233 3L5P5T5X5\5`5d5h5l5p5t5x5|555555577777777777777777x8|89999999999999999999999,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;;;;;;;<l<p<t<==4>8><>@>D>>>????@@@@@@@@@@AAAAAAAAAAAA BPBTBtBBCCCDDD DDDDDDDDEEEEEEEEEPFF HHH@HHHHI I@JDJHJLJPJTKXK\K`KdKKK\>>>>>>> ?$?(?,?0?4?8?????@@@4A8A>> >$>p>t>x>>?????????T@X@@@@@@@AB BC\CCCCCCCCCDhD E$E(E,EFFFFFFFGG G4G8G>>>>??? ????? ?$?(?,?0?4?????X@\@`@PB$F(F,F@IDIHILIJJ,P0P4P8PSSSSSSSSVVVVVxY|YYZZZZZZpbtbbheeeeekkl lDlHlllmmDrHrLrPrTrXr\r`rdrhrlrprtrxr|rrrrrsPt uduu,xx\z`zdz||||8}<}@}D}H}x}~~~~~ЀD$(,048< 48<@pІpć|P  $( dԖؖܖXd8<@DHLPTX\`dhlptx|@LhL\`Ī̫Ыԫثܫ048<@ĭ dhlptx|įȯ̯Яԯدܯ гԳܳ  @DHL  hlptxȶ4x|8<@DHLPTX\`dhlpĸȸ̸Ⱥ̺кԺغܺ x|лD<@DHLPTX$(,048<@DHL $(,048<@DHLPT(<  $(,048<@DHL  $(,048<@DHLPTX\`dhlp,048<@DH(,048<@DHLPTX\`dhlptx|X\048<@DHLP lptx|@Dpt048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx| $(  8<@HXt $,4<DLT\dlt|  $(,048<@DLT\dlt \`dhl @DHLPTX\`d8<@DHLPTX\`dhlpt  $8<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,0|  $(,048<@DHpt $4<@HLTX`dlpx| $(,04@DHLPTX\`hlptx|  $,4<Llpx| $,4<DLTX\`dl       $ ( , 0 4 8 < @ D L T \ d t x |             , < L \ l |                $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |              ( , < H T ` l x               , 8 D P \ h t            (4@LXdp| $0<HT`lx(,pt  $8<DHLPTXdhlp|  $0@DHLPTX\`dhlxdtt| ,048<@DLPT\`dlpt (,48@DLPX\dhpt| $(04<@HLTX`dlpx|  $,08<DHPT\`hltx (,48@DLPX\dhpt| $(04<@HLTX`dlpx|txxx|xxxxxxxxxxxxxxxxxxxxxyyyyy$y,y0y8y@yHyLyTy\ydyhypyxyyyyyyyyyyyyyyyyyyyyzz zzz z$z(z,z4zspi@ff110000(rockchip,rk3288-spirockchip,rk3066-spiARQspiclkapb_pclkJ  Otxrx ,default !Cokayspi@ff120000(rockchip,rk3288-spirockchip,rk3066-spiBSQspiclkapb_pclkJ Otxrx -default"#$%C disabledspi@ff130000(rockchip,rk3288-spirockchip,rk3066-spiCTQspiclkapb_pclkJOtxrx .default&'()C disabledi2c@ff140000rockchip,rk3288-i2cC >Qi2cMdefault*okayi2c@ff150000rockchip,rk3288-i2cC ?Qi2cOdefault+ disabledi2c@ff160000rockchip,rk3288-i2cC @Qi2cPdefault,okayi2c@ff170000rockchip,rk3288-i2cC AQi2cQdefault-okaywserial@ff180000&rockchip,rk3288-uartsnps,dw-apb-uartC 7YcMUQbaudclkapb_pclkJOtxrxdefault ./0okayn6serial@ff190000&rockchip,rk3288-uartsnps,dw-apb-uartC 8YcNVQbaudclkapb_pclkJOtxrxdefault1okayn6serial@ff690000&rockchip,rk3288-uartsnps,dw-apb-uartCi 9YcOWQbaudclkapb_pclkdefault2okayn6 serial@ff1b0000&rockchip,rk3288-uartsnps,dw-apb-uartC :YcPXQbaudclkapb_pclkJOtxrxdefault3okayn6serial@ff1c0000&rockchip,rk3288-uartsnps,dw-apb-uartC ;YcQYQbaudclkapb_pclkJ  Otxrxdefault4 disableddma-controller@ff250000arm,pl330arm,primecellC%@p{ Qapb_pclkthermal-zonesreserve-thermal5cpu-thermald5tripscpu_alert0p>passive6cpu_alert1$>passive7cpu_crit_ >criticalcooling-mapsmap060map170gpu-thermald5tripsgpu_alert0p>passive8gpu_crit_ >criticalcooling-mapsmap08 9tsadc@ff280000rockchip,rk3288-tsadcC( %HZQtsadcapb_pclkG |tsadc-apbinitdefaultsleep: ;: 6<Cs disabled5ethernet@ff290000rockchip,rk3288-gmacC)Zmacirqeth_wake_irq6<8fgc]MQstmmacethmac_clk_rxmac_clk_txclk_mac_refclk_mac_refoutaclk_macpclk_macGB |stmmacethokayjz=inputdefault>?@ABrgmii 'B@ C0usb@ff500000 generic-ehciCP Dusb disabledusb@ff520000 generic-ohciCR )Dusb disabledusb@ff5400002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2CT QotghostE usb2-phyokaydefaultFusb@ff5800002rockchip,rk3288-usbrockchip,rk3066-usbsnps,dwc2CX Qotgotg-?N@@ G usb2-phyokayusb@ff5c0000 generic-ehciC\  disableddma-controller@ff600000arm,pl330arm,primecellC`@p{ Qapb_pclk disabledi2c@ff650000rockchip,rk3288-i2cCe <Qi2cLdefaultHokaysyr827@40silergy,syr827]C@zvdd_cpu PpI syr828@41silergy,syr828]CAzvdd_gpu PpIhym8563@51haoyu,hym8563CQxin32k&JdefaultKact8846@5aactive-semi,act8846CZdefaultLMregulatorsREG1zvcc_ddrOOREG2zvcc_io2Z2ZREG3zvdd_logREG4zvcc_20REG5 zvccio_sd2Z2ZREG6 zvdd10_lcdB@B@REG7zvcca_18w@w@REG8zvcca_332Z2ZREG9zvcc_lan2Z2ZBREG10zvdd_10B@B@REG11zvcc_18w@w@REG12 zvcc18_lcdw@w@i2c@ff660000rockchip,rk3288-i2cCf =Qi2cNdefaultNokaypwm@ff680000rockchip,rk3288-pwmChdefaultO_ disabledpwm@ff680010rockchip,rk3288-pwmChdefaultP_okaypwm@ff680020rockchip,rk3288-pwmCh defaultQ_ disabledpwm@ff680030rockchip,rk3288-pwmCh0defaultR_ disabledsram@ff700000 mmio-sramCppsmp-sram@0rockchip,rk3066-smp-sramCddr-sram@1000rockchip,rk3288-ddr-sramC@sram@ff720000#rockchip,rk3288-pmu-srammmio-sramCrpower-management@ff730000&rockchip,rk3288-pmusysconsimple-mfdCs power-controller!rockchip,rk3288-power-controller jhz dpower-domain@9C chgfdehilkj$!STUVWXYZ[ power-domain@11C op!\] power-domain@12C !^ power-domain@13C !_` reboot-modesyscon-reboot-mode(/RB;RBIRB YRBsyscon@ff740000rockchip,rk3288-sgrfsysconCt clock-controller@ff760000rockchip,rk3288-cruCv Qxin24m6<eHjjk$r#gׄeрxhрxh syscon@ff770000&rockchip,rk3288-grfsysconsimple-mfdCw <edp-phyrockchip,rk3288-dp-phyhQ24m disabledtio-domains"rockchip,rk3288-io-voltage-domain disabledusbphyrockchip,rk3288-usb-phy disabledusb-phy@320C ]QphyclkG |phy-resetGusb-phy@334C4^QphyclkG |phy-resetDusb-phy@348CH_QphyclkG |phy-resetEwatchdog@ff800000 rockchip,rk3288-wdtsnps,dw-wdtCp Ookaysound@ff8b0000,rockchip,rk3288-spdifrockchip,rk3066-spdifCT QmclkhclkJaOtx 6defaultb6< disabledi2s@ff890000(rockchip,rk3288-i2srockchip,rk3066-i2sC 5RQi2s_clki2s_hclkJaaOtxrxdefaultc disabledcrypto@ff8a0000rockchip,rk3288-cryptoC@ 0 }Qaclkhclksclkapb_pclkG |crypto-rstiommu@ff900800rockchip,iommuC@  Qaclkiface disablediommu@ff914000rockchip,iommu C@P  Qaclkiface disabledrga@ff920000rockchip,rk3288-rgaC jQaclkhclksclkd Gilm |coreaxiahbvop@ff930000rockchip,rk3288-vop C Qaclk_vopdclk_vophclk_vopd Gdef |axiahbdclkeokay port endpoint@0Cfxendpoint@1Cguendpoint@2Choendpoint@3Ciriommu@ff930300rockchip,iommuC  Qaclkifaced okayevop@ff940000rockchip,rk3288-vop C Qaclk_vopdclk_vophclk_vopd G |axiahbdclkjokay port endpoint@0Ckyendpoint@1Clvendpoint@2Cmpendpoint@3Cnsiommu@ff940300rockchip,iommuC  Qaclkifaced okayjdsi@ff960000*rockchip,rk3288-mipi-dsisnps,dw-mipi-dsiC@ ~d Qrefpclkd 6< disabledportsport@0Cendpoint@0Cohendpoint@1Cpmport@1Clvds@ff96c000rockchip,rk3288-lvdsC@g Qpclk_lvdslcdcqd 6< disabledportsport@0Cendpoint@0Criendpoint@1Csnport@1Cdp@ff970000rockchip,rk3288-dpC@ bihcQclk_edpclk_edp_24mpclk_edptdpd Go|dp6< disabledportsport@0Cendpoint@0Cugendpoint@1Cvlport@1Chdmi@ff980000rockchip,rk3288-dw-hdmiCc6< ghmnQiahbisfrcecd okay%wportsportendpoint@0Cxfendpoint@1Cykvideo-codec@ff9a0000rockchip,rk3288-vpuC   Zvepuvdpu Qaclkhclkzd iommu@ff9a0800rockchip,iommuC  Qaclkifaced ziommu@ff9c0440rockchip,iommu C@@@ o Qaclkiface disabledgpu@ffa30000#rockchip,rk3288-maliarm,mali-t760C$ ZjobmmugpuN{bd  disabled9opp-table-1operating-points-v2{opp-100000000~opp-200000000 ~opp-300000000B@opp-400000000ׄopp-600000000#Fqos@ffaa0000rockchip,rk3288-qossysconC _qos@ffaa0080rockchip,rk3288-qossysconC `qos@ffad0000rockchip,rk3288-qossysconC Tqos@ffad0100rockchip,rk3288-qossysconC Uqos@ffad0180rockchip,rk3288-qossysconC Vqos@ffad0400rockchip,rk3288-qossysconC Wqos@ffad0480rockchip,rk3288-qossysconC Xqos@ffad0500rockchip,rk3288-qossysconC Sqos@ffad0800rockchip,rk3288-qossysconC Yqos@ffad0880rockchip,rk3288-qossysconC Zqos@ffad0900rockchip,rk3288-qossysconC [qos@ffae0000rockchip,rk3288-qossysconC ^qos@ffaf0000rockchip,rk3288-qossysconC \qos@ffaf0080rockchip,rk3288-qossysconC ]dma-controller@ffb20000arm,pl330arm,primecellC@p{ Qapb_pclkaefuse@ffb40000rockchip,rk3288-efuseC q Qpclk_efusecpu-id@7Ccpu_leakage@17Cinterrupt-controller@ffc01000 arm,gic-4001F@C @ `   pinctrlrockchip,rk3288-pinctrl6<* gpio@ff750000rockchip,gpio-bankCu Q@Wg1Fgpio@ff780000rockchip,gpio-bankCx RAWg1Fgpio@ff790000rockchip,gpio-bankCy SBWg1Fgpio@ff7a0000rockchip,gpio-bankCz TCWg1F gpio@ff7b0000rockchip,gpio-bankC{ UDWg1FCgpio@ff7c0000rockchip,gpio-bankC| VEWg1Fgpio@ff7d0000rockchip,gpio-bankC} WFWg1Fgpio@ff7e0000rockchip,gpio-bankC~ XGWg1F Jgpio@ff7f0000rockchip,gpio-bankC YHWg1F hdmihdmi-cec-c0s|hdmi-cec-c7s|hdmi-ddc s||hdmi-ddc-unwedge s}|pcfg-output-low}pcfg-pull-up~pcfg-pull-downpcfg-pull-none|pcfg-pull-none-12ma suspendglobal-pwroffs|ddrio-pwroffs|ddr0-retentions~ddr1-retentions~edpedp-hpds i2c0i2c0-xfer s||Hi2c1i2c1-xfer s||*i2c2i2c2-xfer s | |Ni2c3i2c3-xfer s||+i2c4i2c4-xfer s||,i2c5i2c5-xfer s||-i2s0i2s0-bus`s||||||clcdclcdc-ctl@s||||qsdmmcsdmmc-clks sdmmc-cmdssdmmc-cds~sdmmc-bus1s~sdmmc-bus4@ssdmmc-pwrs |sdio0sdio0-bus1s~sdio0-bus4@s~~~~sdio0-cmds~sdio0-clks|sdio0-cds~sdio0-wps~sdio0-pwrs~sdio0-bkpwrs~sdio0-ints~sdio1sdio1-bus1s~sdio1-bus4@s~~~~sdio1-cds~sdio1-wps~sdio1-bkpwrs~sdio1-ints~sdio1-cmds~sdio1-clks|sdio1-pwrs ~emmcemmc-clks|emmc-cmds~emmc-pwrs ~emmc-bus1s~emmc-bus4@s~~~~emmc-bus8s~~~~~~~~spi0spi0-clks ~spi0-cs0s ~spi0-txs~spi0-rxs~ spi0-cs1s~!spi1spi1-clks ~"spi1-cs0s ~%spi1-rxs~$spi1-txs~#spi2spi2-cs1s~spi2-clks~&spi2-cs0s~)spi2-rxs~(spi2-txs ~'uart0uart0-xfer s~|.uart0-ctss~/uart0-rtss|0uart1uart1-xfer s~ |1uart1-ctss ~uart1-rtss |uart2uart2-xfer s~|2uart3uart3-xfer s~|3uart3-ctss ~uart3-rtss |uart4uart4-xfer s~|4uart4-ctss ~uart4-rtss |tsadcotp-pins |:otp-outs |;pwm0pwm0-pins|Opwm1pwm1-pins|Ppwm2pwm2-pins|Qpwm3pwm3-pins|Rgmacrgmii-pinss||||||| ||>rmii-pinss||||||||||phy-ints ~Aphy-pmebs~@phy-rsts?spdifspdif-txs |bpcfg-output-highpcfg-pull-up-drv-12ma act8846pwr-holdsMpmic-vsels}Lhym8563rtc-ints~Kkeyspwr-keys~ledspower-leds|work-leds|usb_hosthost-vbus-drvs|usbhub-rstsFusb_otgotg-vbus-drvs |irir-ints~memoryCexternal-gmac-clock fixed-clocksY@ ext_gmac=ir-receivergpio-ir-receiverdefault Jgpio-keys gpio-keysbutton@0  GPIO Powertdefaultleds gpio-leds work firefly:blue:user rc-feedbackdefault power firefly:green:power default-ondefault vsys-regulatorregulator-fixedzvcc_sysLK@LK@Isdmmc-regulatorregulator-fixed J defaultzvcc_sd2Z2Zflash-regulatorregulator-fixed zvcc_flashw@w@usb-regulatorregulator-fixedzvcc_5vLK@LK@Iusb-host-regulatorregulator-fixed- default zvcc_host_5vLK@LK@usb-otg-regulatorregulator-fixed-  default zvcc_otg_5vLK@LK@chosen@/serial@ff690000(Lsame-as-spl/mmc@ff0f0000/mmc@ff0c0000binmanbsimple-binru-boot-rockchip.bin{mkimageridbloader.img-nrk3288-Trksdu-boot-tplu-boot-splu-boot-img(dmc@ff610000rockchip,rk3288-dmcsyscon@Cabcd(lmno<Qpclk_ddrupctl0pclk_publ0pclk_ddrupctl1pclk_publ1arm_clk6<* BN  $  @ CH  `@0Ud''Z syscon@ffac0000rockchip,rk3288-nocsysconC  config  firefly:green:power #address-cells#size-cellscompatibleinterrupt-parentmodelethernet0gpio0gpio1gpio2gpio3gpio4gpio5gpio6gpio7gpio8i2c0i2c1i2c2i2c3i2c4i2c5mshc0mshc1mshc2mshc3serial0serial1serial2serial3serial4spi0spi1spi2mmc0mmc1mmc2mmc3interruptsinterrupt-affinityenable-methodrockchip,pmudevice_typeregresetsoperating-points-v2#cooling-cellsclock-latencyclocksdynamic-power-coefficientcpu0-supplyphandleopp-sharedopp-hzopp-microvoltrangesclock-frequencyclock-output-names#clock-cellsbootph-allarm,cpu-registers-not-fw-configuredarm,no-tick-in-suspendclock-namesportsmax-frequencyfifo-depthreset-namesstatusbus-widthcap-mmc-highspeedcap-sd-highspeedcard-detect-delaydisable-wpnum-slotspinctrl-namespinctrl-0vmmc-supplybroken-cdnon-removablevqmmc-supply#io-channel-cellsvref-supplydmasdma-namesreg-shiftreg-io-width#dma-cellsarm,pl330-broken-no-flushparm,pl330-periph-burstpolling-delay-passivepolling-delaythermal-sensorstemperaturehysteresistripcooling-devicepinctrl-1pinctrl-2#thermal-sensor-cellsrockchip,grfrockchip,hw-tshut-tempinterrupt-namesassigned-clocksassigned-clock-parentsclock_in_outphy-supplyphy-modesnps,reset-active-lowsnps,reset-delays-ussnps,reset-gpiotx_delayrx_delayphysphy-namesdr_modesnps,reset-phy-on-wakeg-np-tx-fifo-sizeg-rx-fifo-sizeg-tx-fifo-sizefcs,suspend-voltage-selectorregulator-nameregulator-min-microvoltregulator-max-microvoltregulator-always-onregulator-boot-onvin-supplysystem-power-controller#pwm-cells#power-domain-cellspm_qosoffsetmode-normalmode-recoverymode-bootloadermode-loader#reset-cellsassigned-clock-rates#phy-cells#sound-dai-cellsrockchip,playback-channelsrockchip,capture-channels#iommu-cellsrockchip,disable-mmu-resetpower-domainsiommusremote-endpointddc-i2c-businterrupt-controller#interrupt-cellsgpio-controller#gpio-cellsrockchip,pinsoutput-lowbias-pull-upbias-pull-downbias-disabledrive-strengthbootph-pre-ramoutput-highgpiosgpio-key,wakeuplabellinux,codelinux,default-triggerstartup-delay-usenable-active-highstdout-pathu-boot,spl-boot-ordermultiple-imagesfilenamepad-byteargsmultiple-data-filesrockchip,crurockchip,nocrockchip,sgrfrockchip,sramrockchip,pctl-timingrockchip,phy-timingrockchip,sdram-paramsu-boot,boot-led