pax_global_header00006660000000000000000000000064150021554630014513gustar00rootroot0000000000000052 comment=6e43c07e83406cdd3f75952ee988d61d7573ec11 flycheck-35.0/000077500000000000000000000000001500215546300132325ustar00rootroot00000000000000flycheck-35.0/.flake8000066400000000000000000000003031500215546300144010ustar00rootroot00000000000000# -*- mode: conf; -*- [flake8] # Ignore all missing docstrings for now, until we have docstrings everywhere ignore = D100,D101,D102,D103,D105,D401,W503 exclude = test/resources inline-quotes = ' flycheck-35.0/.github/000077500000000000000000000000001500215546300145725ustar00rootroot00000000000000flycheck-35.0/.github/CLA.md000066400000000000000000000006771500215546300155250ustar00rootroot00000000000000I, the contributor, agree to licence my contributions to the Flycheck project under the terms of the [GPL 3.0][1] and any later version, and to license my contributions to the documentation of the Flycheck project under the terms of the [Creative Commons Attribution-ShareAlike 4.0 International][2] license. [1]: http://www.flycheck.org/en/latest/licenses.html#flycheck-gpl [2]: http://www.flycheck.org/en/latest/licenses.html#flycheck-cc-by-sa flycheck-35.0/.github/CONTRIBUTING.rst000066400000000000000000000007311500215546300172340ustar00rootroot00000000000000=========== Thank you =========== Thank you very much for your interest in contributing to Flycheck! We’d like to warmly welcome you in the Flycheck community, and hope that you enjoy your time with us! Flycheck’s documentation provides a comprehensive Contributor Guide which shows how you can contribute to Flycheck and helps you through all stages of the contribution process. Please read it at . flycheck-35.0/.github/FUNDING.yml000066400000000000000000000002371500215546300164110ustar00rootroot00000000000000# These are supported funding model platforms open_collective: flycheck github: bbatsov ko_fi: bbatsov patreon: bbatsov custom: https://www.paypal.me/bbatsov flycheck-35.0/.github/ISSUE_TEMPLATE/000077500000000000000000000000001500215546300167555ustar00rootroot00000000000000flycheck-35.0/.github/ISSUE_TEMPLATE/bug_report.md000066400000000000000000000024561500215546300214560ustar00rootroot00000000000000--- name: Bug report about: Report an unexpected Flycheck behavior title: '' labels: 'kind: bug' assignees: '' --- Thank you for taking the time to report an issue and improve Flycheck. This template is for **actual bugs you observed**. If you have trouble setting up Flycheck, or if you have a question, please use the relevant issue template instead. ## Checklist - [ ] I have checked existing issues for potential duplicates before creating this one. - [ ] I have read the [Troubleshooting guide][]. ## Bug description A clear and concise description of what the bug is. ## Steps to reproduce Steps to reproduce the behavior: 1. Open file '...' 2. Do '....' 3. See error - [ ] I have read https://emacs.stackexchange.com/questions/28429/how-do-i-troubleshoot-emacs-problems ## Expected behavior A clear and concise description of what you expected to happen. ## Screenshots If applicable, add screenshots to help explain your problem. ## System configuration ``` Paste the output of `M-x flycheck-verify-setup` here. ``` Emacs configuration: - [ ] Plain Emacs / Custom configuration - [ ] Spacemacs - [ ] Doom Emacs - [ ] Other shared configuration ## Additional notes Add any other context about the problem here. [Troubleshooting guide]: https://www.flycheck.org/en/latest/user/troubleshooting.html flycheck-35.0/.github/ISSUE_TEMPLATE/feature_request.md000066400000000000000000000011121500215546300224750ustar00rootroot00000000000000--- name: Feature request about: Suggest an improvement to Flycheck title: '' labels: 'kind: feature request' assignees: '' --- Thank you for taking the time to improve Flycheck. ## Checklist - [ ] I have checked existing issues for potential duplicates before creating this one. ## Feature description A clear and concise description of what you want Flycheck to do. ## Describe alternatives you've considered A clear and concise description of any alternative solutions or features you've considered. ## Additional context Add any other context or screenshots, mockups etc. flycheck-35.0/.github/ISSUE_TEMPLATE/user-support.md000066400000000000000000000026361500215546300217760ustar00rootroot00000000000000--- name: User support about: Trouble setting up or using Flycheck? title: '' labels: 'kind: user support' assignees: '' --- This template is for **user support**. If you are reporting an actual Flycheck bug, please use the relevant issue template instead. ## Checklist - [ ] I have searched existing issues and StackOverflow for solutions. - [ ] I have read the [Flycheck manual][]. - [ ] I have read the [Troubleshooting Guide][]. - [ ] I have checked my issue has not been reported yet. ## Problem description A clear and concise description of the problem you encounter. ## Steps to reproduce Steps to reproduce the behavior: 1. Open file '...' 2. Do '....' 3. See error - [ ] I have read https://emacs.stackexchange.com/questions/28429/how-do-i-troubleshoot-emacs-problems ## Expected behavior A clear and concise description of what you expected to happen. ## Screenshots If applicable, add screenshots to help explain your problem. ## System configuration ``` Paste the output of `M-x flycheck-verify-setup` here. ``` Emacs configuration: - [ ] Plain Emacs / Custom configuration - [ ] Spacemacs - [ ] Doom Emacs - [ ] Prelude - [ ] Other shared configuration (please specify) ## Additional notes Add any other context about the problem here. [Flycheck manual]: https://www.flycheck.org/en/latest/user/troubleshooting.html [Troubleshooting guide]: https://www.flycheck.org/en/latest/user/troubleshooting.html flycheck-35.0/.github/PULL_REQUEST_TEMPLATE/000077500000000000000000000000001500215546300200515ustar00rootroot00000000000000flycheck-35.0/.github/PULL_REQUEST_TEMPLATE/new-checker.md000066400000000000000000000020431500215546300225650ustar00rootroot00000000000000--- name: New checker about: Provide a new checker implementation title: 'Add syntax checker for XXX' labels: 'component: checkers' assignees: '' --- ## Checklist - [ ] I have read the [Contributor's guide][]. - [ ] I have documented this checker in the [manual][]. - [ ] I have added a test for this checker in [flycheck-test.el][]. - [ ] (*If you have written a test*) I have created a companion PR to add the checker tool in [flycheck/docker-tools][]. - [ ] I have mentioned the checker in the [Changelog][]. ## Description Describe the checker you added. ## Additional context Additional relevant information about the checker and its integration into Flycheck. [Changelog]: https://github.com/flycheck/flycheck/blob/master/CHANGES.rst [manual]: https://www.flycheck.org/en/latest/languages.html [flycheck-test.el]: https://github.com/flycheck/flycheck/blob/master/test/flycheck-test.el [flycheck/docker-tools]: https://github.com/flycheck/docker-tools [Contributor's guide]: https://www.flycheck.org/en/latest/contributor/contributing.html flycheck-35.0/.github/workflows/000077500000000000000000000000001500215546300166275ustar00rootroot00000000000000flycheck-35.0/.github/workflows/docs.yml000066400000000000000000000010331500215546300202770ustar00rootroot00000000000000name: Docs on: push: branches: - master paths: - '**.yml' - docs/** pull_request: workflow_dispatch: concurrency: group: ${{ github.workflow }}-${{ github.ref }} cancel-in-progress: true jobs: build-manual: runs-on: ubuntu-latest steps: - uses: actions/checkout@v3 - uses: actions/setup-python@v4 with: python-version: '3.10' - name: Run tests run: | pip install -r doc/requirements.txt make -C doc SPHINXOPTS=-n html flycheck-35.0/.github/workflows/github-release.yml000066400000000000000000000014611500215546300222540ustar00rootroot00000000000000name: Create GitHub Release on: push: tags: - "v*" # Trigger when a version tag is pushed (e.g., v1.0.0) jobs: create-release: runs-on: ubuntu-latest permissions: contents: write steps: - name: Checkout Code uses: actions/checkout@v4 - name: Create GitHub Release with Auto-Generated Notes uses: ncipollo/release-action@v1 with: tag: ${{ github.ref_name }} name: Flycheck ${{ github.ref_name }} prerelease: ${{ contains(github.ref, '-rc') || contains(github.ref, '-alpha') || contains(github.ref, '-beta') }} generateReleaseNotes: true # Auto-generate release notes based on PRs and commits # TODO: Use bodyFile to get the contents from changelog token: ${{ secrets.GITHUB_TOKEN }} flycheck-35.0/.github/workflows/lint-python.yml000066400000000000000000000010141500215546300216330ustar00rootroot00000000000000name: Lint Python on: push: branches: - master paths: - '**.yml' - docs/** pull_request: workflow_dispatch: concurrency: group: ${{ github.workflow }}-${{ github.ref }} cancel-in-progress: true jobs: lint-python: runs-on: ubuntu-latest steps: - uses: actions/checkout@v3 - uses: actions/setup-python@v4 with: python-version: '3.10' - name: Run tests run: | pip install -r maint/requirements.txt make -C maint check flycheck-35.0/.github/workflows/test.yml000066400000000000000000000041111500215546300203260ustar00rootroot00000000000000name: CI on: push: branches: - master pull_request: workflow_dispatch: concurrency: group: ${{ github.workflow }}-${{ github.ref }} cancel-in-progress: true jobs: test: runs-on: ${{ matrix.os }} continue-on-error: ${{ matrix.experimental }} strategy: fail-fast: false matrix: os: [ubuntu-latest, macos-latest, windows-latest] emacs-version: - 27.2 - 28.2 - 29.4 - 30.1 experimental: [false] include: - os: ubuntu-latest emacs-version: snapshot experimental: true - os: macos-latest emacs-version: snapshot experimental: true - os: windows-latest emacs-version: snapshot experimental: true exclude: - os: macos-latest emacs-version: 27.2 steps: - uses: actions/checkout@v3 - uses: jcs090218/setup-emacs@master with: version: ${{ matrix.emacs-version }} # Remove expired DST Root CA X3 certificate. Workaround for # https://debbugs.gnu.org/cgi/bugreport.cgi?bug=51038 bug on Emacs 27.x or lower. # https://github.com/jcs090218/setup-emacs-windows/issues/156#issuecomment-1126671598 - name: Workaround for Emacs 27.x or lower's Windows build from GNU FTP if: ${{ runner.os == 'Windows' && (matrix.emacs-version == '26.3' || matrix.emacs-version == '27.2') }} run: | gci cert:\LocalMachine\Root\DAC9024F54D8F6DF94935FB1732638CA6AD77C13 gci cert:\LocalMachine\Root\DAC9024F54D8F6DF94935FB1732638CA6AD77C13 | Remove-Item - uses: emacs-eask/setup-eask@master with: version: 'snapshot' - name: Run tests (Unix) if: matrix.os == 'ubuntu-latest' || matrix.os == 'macos-latest' run: | make init make format make unit make specs - name: Run tests (Windows) if: matrix.os == 'windows-latest' # TODO: Add `make unit` once it's valid run: | make init make format make compile make specs flycheck-35.0/.gitignore000066400000000000000000000004261500215546300152240ustar00rootroot00000000000000*.elc *autoloads.el # autoloads /flycheck-autoloads.el # Packages installed for development /.cask/ /.eask/ # linters /.elsa/ # Bundler configuration and lock file /.bundle/ /Gemfile.lock # Generated distribution packages /dist/ # Directory local variables .dir-locals.el flycheck-35.0/.mailmap000066400000000000000000000024211500215546300146520ustar00rootroot00000000000000# -*- mode: conf; -*- Biao Xie <423300@gmail.com> Bozhidar Batsov Chao SHEN Cristian Capdevila Manuel Uberti Manuel Uberti Mark Hellewell Mark Karpov Peter Vasil Romanos Skiadas # Looks as if there's different unicode normalisations for this name Saša Jovanić Sean Whitton Sebastian Schueppel Sebastian Wiesner Sebastian Wiesner Senda Akiha Steve Purcell Sylvain Benner Sylvain Rousseau Vlatko Basic Yuuki Arisawa Zhuo Yuan # These contributors prefer to remain anonymous fmdkdd # The real names of these contributors are unknown papaeye chessman flycheck-35.0/.readthedocs.yaml000066400000000000000000000020101500215546300164520ustar00rootroot00000000000000# Read the Docs configuration file for Sphinx projects # See https://docs.readthedocs.io/en/stable/config-file/v2.html for details # Required version: 2 # Set the OS, Python version and other tools you might need build: os: ubuntu-22.04 tools: python: "3.12" # You can also specify other tool versions: # nodejs: "20" # rust: "1.70" # golang: "1.20" # Build documentation in the "doc/" directory with Sphinx sphinx: configuration: doc/conf.py # You can configure Sphinx to use a different builder, for instance use the dirhtml builder for simpler URLs # builder: "dirhtml" # Fail on all warnings to avoid broken references # fail_on_warning: true # Optionally build your docs in additional formats such as PDF and ePub # formats: # - pdf # - epub # Optional but recommended, declare the Python requirements required # to build your documentation # See https://docs.readthedocs.io/en/stable/guides/reproducible-builds.html # python: # install: # - requirements: docs/requirements.txt flycheck-35.0/CHANGES.old000066400000000000000000001114771500215546300150150ustar00rootroot000000000000000.25.1 (Nov 16, 2015) --------------------- - Fix undefined function call in ``emacs-lisp`` syntax checker [GH-791] 0.25 (Nov 14, 2015) ------------------- - **Breaking changes**: - ``scala-scalastyle`` now expects a ``scalastyle`` executable in ``exec-path`` [GH-763] - Drop support for legacy Ruby YAML implementations prior to Ruby 1.9.3 in ``ruby-yaml`` - Remove racket syntax checker due to possible code execution [GH-786] - New syntax checkers: - JSON with Python’s built-in ``json`` module [GH-758] - Rust with ``cargo rustc`` [GH-772] - New features: - Add ``flycheck-help-echo-function`` to customize the Help Echo of Flycheck overlays [GH-730] - Use symbolic error IDs in Pylint [GH-714] - Add ``flycheck-pylint-use-symbolic-id`` to disable symbolic IDs for Pylint [GH-714] - Add ``flycheck-command-wrapper-function`` to wrap syntax checker commands before execution [GH-629] [GH-752] - Add ``flycheck-executable-find`` to customise how Flycheck searches executables [GH-752] - Add ``flycheck-hlint-args`` to pass additional arguments to hlint [GH-713][GH-762] - Add ``flycheck-go-build-tags`` and ``flycheck-go-install-deps`` to specify tags and automatically install dependencies with ``go build`` [GH-674] - Add :standard-input property to syntax checkers to read source from standard input [GH-673] [GH-728] - Add support for JSX modes to some Javascript checkers [GH-778] - Improvements: - Improve mode line display for buffers with only info messages [GH-733] - Merge messages of all errors under cursor for Help Echo [GH-730] - Align multi-line messages in error list [GH-732] [GH-731] - Cache GHC output for faster syntax checking and better template haskell support [GH-708] - Fall back to ``rst`` if ``rst-sphinx`` is disabled [GH-745] [GH-746] - New uniform fringe indicators [GH-750] - Demote AsciiDoc deprecation warnings to ``info`` level - Bug fixes: - Fix error patterns of ``coq`` [GH-742] - Support GFortran 5 [GH-751] - Fix stack overflow when parsing hlint errors [GH-760] - Fix error columns of jsonlint 0.24 (Aug 15, 2015) ------------------- - **Breaking changes**: - Remove Elixir syntax checker due to code execution [GH-630] - Drop support for Emacs 24.1 and 24.2 - New syntax checkers: - Javascript with ``jscs`` [GH-634] and ``standard`` [GH-644] - Jade [GH-686] - SQL with ``sqllint`` [GH-691] - Groovy [GH-716] - Haskell with ``stack ghc`` [GH-711] - New features: - The error list can now be filtered by error level by pressing f - Add ``flycheck-error-list-minimum-level`` to restrict error levels displayed in the error list [GH-698] [GH-701] - Add ``flycheck-perl-include-path`` to set include directories for Perl [GH-621] - Add ``flycheck-rust-args`` to pass additional arguments to ``rustc`` - Add ``flycheck-dmd-args`` to pass additional arguments to ``dmd`` [GH-655] - Add ``flycheck-erlang-include-path`` [GH-668] and ``flycheck-erlang-library-path`` [GH-696] for Erlang - Add ``flycheck-verilator-include-path`` to set include directories for Verilator [GH-684] - Add ``flycheck-cppcheck-include-path`` to set include directories for cppcheck [GH-687] - Add support for Hlint configuration file [GH-682] - Add Hlint options for ignore rules, language extensions and hint packages [GH-682] - Improvements: - Show chained checkers in Help buffers for syntax checkers [GH-571] - Map custom error levels to compilation mode levels [GH-700] - ``flycheck-verify-setup`` now includes the manually selected checker if any [GH-705] - ``flycheck-select-checker`` now shows a verification buffer if the selected checker cannot be used [GH-705] - Add ``flycheck-verify-checker`` to check whether a specific syntax checker can be used in a buffer [GH-705] - Bug fixes: - Fix offset of column numbers in ESLint [GH-640] - Properly parse indentation errors from Python 2.7 [GH-635] - Don’t choke if ``default-directory`` does not exist [GH-625] - Fix error parsing for Puppet 4 - Fix duplicate checkdoc errors on Emacs 25 - Fix level of ``info`` messages in ``flycheck-compile`` [GH-669] - Allow custom ``:verify`` functions for command checkers [GH-672] - Fix error when ``flycheck-scalastylerc`` was set to a non-existing file - Fix error column offsets in ``scala-scalastyle`` - Do not use ``r-lintr`` in non-R buffers [GH-607] - Enforce output format of ``flake8`` [GH-704] - Parse error ids from luacheck 0.11 - Fix patterns for Puppet environment names [GH-694] - Properly locate configuration files from jshint and jscs [GH-703] - Fix column offsets in eslint 1.0 [GH-718] 0.23 (Apr 6, 2015) ------------------ - **Breaking changes**: - New manual in native Texinfo format, to achieve higher quality Info manuals - Remove ``make`` syntax checker due to various issues [GH-572] [GH-573] - Remove ``zsh`` support from ``sh-shellcheck``, since Shellcheck does not support Zsh anymore - Remove ``global-flycheck-mode`` from customization interface [GH-595] - New syntax checkers: - R with ``lintr`` [GH-512] - Lua with ``luacheck`` [GH-591] [GH-609] - SCSS with ``scss-lint`` [GH-582] [GH-598] - New features: - Add ``flycheck-disable-checker`` to disable a syntax checker in the current buffer - Add ``flycheck-global-modes`` to control in which modes ``global-flycheck-mode`` turns on ``flycheck-mode`` - Add ``pedantic`` and ``pedantic-errors`` options to Clang and GCC [GH-543] - Add ``flycheck-foodcritic-tags`` to select tags for Foodcritic [GH-560] - Improvements: - ``chef-foodcritic`` handles relative paths correctly now [GH-556] - Global Flycheck Mode enables Flycheck Mode even if there is no syntax checker for the buffer yet [GH-568] - ``handlebars`` now supports Web Mode [GH-605] - Extract error IDs from ``rustc`` - Don’t cache last syntax checker in buffer anymore - Bug fixes: - Fix void variable error when trying to use ``flycheck-compile`` with a non-command checker [GH-563] - Fix faulty mode line reporting [GH-564] - Automatically initialize packages when checking ``user-init-file`` - Properly initialize hook variables [GH-593] - Fix handling of file names with symbolic links for some checkers [GH-561] - Parse multiline type errors from ``rustc`` [GH-592] 0.22 (Dec 23, 2014) ------------------- - **Breaking changes**: - Never allow use of disabled checkers anymore, even with ``flycheck-select-checker`` - Error parsers **must** set the ``:buffer`` and ``:checker`` slots of ``flycheck-error`` now - The internals of syntax checker definitions have changed again. **All packages depending on Flycheck must be recompiled!** [GH-524] - ``flycheck-error-list-refresh`` is not an interactive command anymore - Replace ``flycheck-perlcritic-verbosity`` with ``flycheck-perlcritic-severity`` - Replace ``flycheck-copy-messages-as-kill`` with ``flycheck-copy-errors-as-kill`` [GH-529] - Remove ``flycheck-google-messages`` command - Options and config file variables are not buffer-local anymore [GH-546] - New syntax checkers: - Python with ``py_compile`` [GH-484] - New features: - ``flycheck-ert.el`` library to write unit tests for Flycheck extensions - Add ``flycheck-define-generic-checker`` to define syntax checkers over arbitrary Emacs Lisp functions [GH-169] [GH-524] - Add ``flycheck-define-command-checker`` as non-macro variant of ``flycheck-define-checker`` [GH-524] - Add support for IDs of errors [GH-529] - Add special ``id`` sexp to parse error ids with ``:error-patterns`` [GH-529] - Parse error IDs from Checkstyle XML [GH-259] - ``flycheck-copy-errors-as-kill`` can put error ids into kill ring now [GH-529] - Parse error IDs from many error checkers [GH-259] - Verify Flycheck setup in a buffer with ``flycheck-verify-setup`` [GH-338] - Add options for arbitrary arguments to some syntax checkers [GH-542] - Add ``flycheck-flake8-error-level-alist`` to customize error levels from flake8 [GH-454] - Improvements: - Automatically disable syntax checkers that report too many errors [GH-476] - Reduce filesystem access when parsing errors to improve parsing speed - Add explicit ``load-path`` inheritance to ``flycheck-emacs-lisp-load-path``, via new ``inherit`` value [GH-511] - Parse help messages from ``rustc`` [GH-517] - ``g`` in the error list checks the source buffer again [GH-532] - ``haskell-ghc`` supports literate Haskell now [GH-535] - Bug fixes: - Properly parse notes in ``sh-shellcheck`` [GH-508] - Fix shell quoting in ``flycheck-compile`` [GH-522] [GH-523] - Fix faulty properties of customize options which broke ``customize-changed`` and related functions - Fix use deprecated option in ``coffee-coffeelint`` - Fix error columns of ``python-pylint`` and ``tex-chktex`` [GH-536] - Correctly compute error level of errors on included files in ``c/c++-clang`` and ``c/c++-gcc`` [GH-451] 0.21 (Oct 26, 2014) ------------------- - **Breaking changes**: - ``html-tidy`` is not enabled in Web Mode anymore [GH-464] - ``d-dmd`` now requires DMD 2.066 or newer [GH-460] - ``:next-checkers`` now requires the maximum permissible level instead of a custom predicate [GH-472] - Remove ``flycheck-error-list-highlight-at-point`` face and related functionality [GH-490] - New syntax checkers: - Coq - RPM spec files with ``rpmlint`` [GH-480] [GH-481] - New features: - Add ``null-device`` symbol for syntax checker commands - Add ``flycheck-display-error-messages-unless-error-list`` for ``flycheck-error-display-function`` - Add ``flycheck-error-list-after-refresh-hook`` to run after the error list refreshes - Add ``flycheck-navigation-minimum-level`` to restrict error levels available for navigation [GH-398] [GH-485] - The error list can be sorted by message and syntax checker name now [GH-500] - Add ``flycheck-error-list-checker-name`` face to customize the appearance of the syntax checker name in the error list [GH-500] - Add ``flycheck-shellcheck-excluded-warnings`` to exclude warnings from ShellCheck reports [GH-499] - Add ``flycheck-add-mode`` to add a new major mode to a syntax checker [GH-506] - Add ``flycheck-gcc-openmp`` to enable OpenMP for GCC in C/C++ [GH-507] - Improvements: - Improve GCC syntax checking by expanding templates [GH-459] - ``d-dmd`` reports errors with columns now [GH-460] - Remove Projectile-based config file search [GH-461] - Do not change point when navigating in the error list [GH-487] - ShellCheck warnings now include the corresponding warning code - Bug fixes: - Expand ``default-directory`` before using it, to handle abbreviated paths gracefully [GH-434] - Restore mouse support in the error list [GH-468] - ``less`` now correctly resolves relative paths in ``data-uri`` [GH-471] - ``go-errcheck`` now properly uses package names as syntax checker arguments - ``c/c++-clang`` now handles empty error messages [GH-497] 0.20 (Aug 12, 2014) ------------------- - **Breaking changes**: - The internal names of syntax checker properties changed. **All packages depending on Flycheck must be recompiled!** - ``flycheck-substitute-argument`` always returns a list now - The special meaning of a trailing ``=`` in ``(option …)`` and ``(config-file …)`` is removed. Both arguments must now explicitly specify ``concat`` to prepend the option as string. - New syntax checkers: - C/C++ with GCC [GH-408] - Scala with scalastyle [GH-425] - Fortran with GFortran [GH-414] [GH-450] - Ada with GNAT [GH-414] [GH-457] - New features: - Add ``flycheck-clang-no-exceptions`` and ``flycheck-gcc-no-exceptions`` to flag exceptions as errors in C++ [GH-412] - Add ``flycheck-rust-crate-root`` to resolve inter-crate references in ``rust`` [GH-417] - Add ``flycheck-clang-blocks`` to enable the block syntax in Clang [GH-420] - ``read-flycheck-checker`` now accepts a default value - Add ``flycheck-status-changed-functions`` to react on status changes - Make the mode line lighter of Flycheck customizable with ``flycheck-mode-line`` - Add ``flycheck-rubylintrc`` to support configuration files for ``ruby-rubylint`` [GH-424] - Add ``flycheck-rust-crate-type`` to make the Crate type customizable [GH-446] - The mode line of the error list is now customizable with ``flycheck-error-list-mode-line`` [GH-454] - Pressing ``n`` or ``p`` in the error list now shows the error at point in a separate window [GH-452] [GH-454] - Pressing ``RET`` in the error list now jumps to the error at point [GH-454] - The error list can now be sorted by error level by clicking on the corresponding list header, or by pressing ``S`` with point on the column text [GH-454] - Error levels defined with ``flycheck-define-error-level`` can now have a numeric severity used for sorting [GH-454] - Improvements: - Use proper temporary files in ``python-flake8`` [GH-421] - Demote errors from ``package-initialize`` in the ``emacs-lisp`` checker [GH-423] - ``flycheck-select-checker`` now uses the last used syntax checker as default when reading from minibuffer - ``flycheck-compile`` now prompts for the syntax checker to run as ``compile`` command [GH-428] - The ``rust`` syntax checker shows info messages now [GH-439] - The ``sass`` and ``scss`` syntax checkers now use a temporary directory for their cache [GH-443] [GH-454] - Change the default of ``flycheck-eslintrc`` to ``nil`` [GH-447] - Show the menu on the mode line lighter [GH-365] - Greatly improve Flycheck's menu - ``n`` and ``p`` now navigate the error list by errors, not by lines [GH-452][GH-444] - ``c/c++-clang`` does not use in-place temporary files anymore [GH-456] - Bug fixes: - Properly support ``unload-feature`` now - Other changes: - Remove dependencies on f.el and s.el 0.19 (Jun 12, 2014) ------------------- - Flycheck now has an official logo [GH-331] - **Breaking changes**: - The ``ruby-rubylint`` syntax checker now requires Ruby Lint 2.0 or newer. [GH-405] - New syntax checkers: - Go with ``errcheck`` [GH-393] - New features: - Add ``flycheck-keymap-prefix`` to change the prefix key for Flycheck keybindings [GH-381] - Make the prefix of Flycheck's temporary files customizable with ``flycheck-temp-prefix`` [GH-387] - Add ``:error-filter`` property for syntax checkers to apply a custom function to modify or filter errors after parsing [GH-397] - Add ``flycheck-rust-check-tests`` to disable syntax checking of test code in Rust [GH-406] - Add ``flycheck-cppcheck-inconclusive`` to enable cppcheck tests that might give false positives [GH-407] - Improvements: - Collapse redundant whitespace in messages from ``emacs-lisp`` [GH-397] - Dedent messages from ``haskell-ghc`` [GH-397] - Fold errors in included files into the error messages of the corresponding include in ``c/c++-clang`` [GH-397] - The ``ruby-rubylint`` syntax checker now supports ruby-lint 2.0 and newer [GH-405] - Bug fixes: - When stopping Flycheck, correctly kill running processes and cleanup their temporary files [GH-334] - Do not choke on files without extensions in ``haskell-ghc`` - Fix spurious warning when a syntax checker reports errors, but not for the file being checked [GH-391] - Do not signal errors in Go Mode, when ``go`` is not available 0.18 (Mar 24, 2014) ------------------- - **Breaking changes**: - The POSIX script syntax checkers ``sh-bash`` and ``sh-dash`` were renamed to ``sh-posix-bash`` and ``sh-posix-dash`` respectively. The ``bash`` and ``zsh`` syntax checkers were renamed to ``sh-bash`` and ``sh-zsh`` respectively. Thus, all shell script syntax checkers now live in the ``sh-`` prefix. - ``rst-sphinx`` requires Sphinx 1.2 or newer now. - ``rustc`` requires Rust 0.10 (not yet released at the time of writing) or newer now [GH-353] - New syntax checkers: - Perl with Perl Critic [GH-88] - Replace GNU Make with POSIX Make [GH-322] - Shellcheck [GH-267] - Go with ``golint`` [GH-328] - Go with ``go tool vet`` [GH-329] - New features: - Add ``flycheck-rust-library-path`` to specify library locations for ``rust`` - Add ``flycheck-dmd-include-path`` to change the include path of ``d-dmd`` [GH-344] - Improvements: - ``flycheck-parse-checkstyle`` supports ``info`` level messages now - Correctly parse multiline error messages of ``go-build`` and ``go-test`` - ``rst-sphinx`` supports custom nodes without explicit writer support now, by using the ``pseudoxml`` builder. - Avoid warnings about missing main functions in ``rust`` - Properly resolve relative filenames in ``.. include::`` directives in ``rst`` - Use ``--unix_mode`` option in ``javascript-gjslint`` to get the file name [GH-348] - Puppet Lint messages now include the name of the corresponding check - ``rustc`` supports upcoming Rust 0.10 now [GH-353] - Flycheck now handles Clang errors from included files [GH-367] 0.17 (Feb 1, 2014) ------------------ - The manual was ported to Sphinx_ and is now located at http://flycheck.readthedocs.org [GH-274] - **Breaking changes**: - The default ``flycheck-completion-system`` was changed to nil, i.e. the built-in ``completing-read``, for compliance with Emacs' defaults. To restore the previous behaviour, add ``(eval-after-load 'flycheck '(setq flycheck-completion-system 'ido))`` to your ``init.el``. - ``flycheck-count-errors`` counts errors of all levels now, and returns an alist mapping error symbols to error counts. - New syntax checkers: - RST (ReStructuredText) using Sphinx - GNU Make [GH-321] - New features: - Extend syntax checkers with ``flycheck-add-next-checkers`` [GH-266] - Improvements: - Immediately re-check the buffer when it was changed during a syntax check [GH-301] - Do not defer syntax checker after idle change timeout [GH-305] - Do not use the generic ``rst`` syntax checker in Sphinx projects anymore, to avoid false positives by Sphinx-only markup - Check for more than just syntax errors in ``rust`` [GH-314] - ``chef-foodcritic`` supports ``enh-ruby-mode`` now - Bug fixes - Do not attach syntax checker processes to the buffer anymore [GH-298] - Do not visit the file to check in ``emacs-lisp`` and ``emacs-lisp-checkdoc`` to avoid unintended side effects [GH-319] 0.16 (Jan 11, 2014) ------------------- - **Breaking changes**: - Argument substitution is no longer performed on syntax checker executables. The executable must be a string. - Split out ``haskell-hdevtools`` into a separate package. See flycheck-hdevtools_ [GH-275] - Drop support for coffeelint 0.x - The error list is reimplemented on top of Tabulated List Mode. This greatly changes the appearance and behaviour of the error list [GH-230] - New syntax checkers: - Ruby with ``ruby-lint`` [GH-250] - Handlebars [GH-270] - YAML with ``yaml-jsyaml`` [GH-253] - Chef recipes with ``foodcritic`` [GH-255] - AsciiDoc [GH-276] - CFEngine [GH-271] - Racket [GH-277] - Texinfo - Verilog [GH-296] - Javascript with ``eslint`` [GH-291] - ERuby [GH-285] - New features: - Define variables to override the executables of syntax checkers [GH-272] - Interactively set the executable of a syntax checker with ``flycheck-set-checker-executable`` [GH-272] - Disable syntax checkers easily with ``flycheck-disabled-checkers`` [GH-269] - Add support for the Compass CSS framework in the ``sass`` and ``scss`` checkers, with ``flycheck-sass-compass`` and ``flycheck-scss-compass`` respectively [GH-268] - Disable style checks in ``ruby-rubocop`` with ``flycheck-rubocop-lint-only`` [GH-287] - Add support for Microsoft extensions in ``c/c++-clang`` via ``flycheck-clang-ms-extensions`` [GH-283] - New faces ``flycheck-error-list-info``, ``flycheck-error-list-warning``, ``flycheck-error-list-error``, ``flycheck-error-list-line-number`` and ``flycheck-error-list-column-number`` [GH-230] - Add ``flycheck-ghc-no-user-package-database`` to disable the user package database for ``haskell-ghc`` - Add ``flycheck-ghc-package-databases`` to add additional package databases to ``haskell-ghc`` - Add ``flycheck-ghc-search-path`` to add additional directories to the search path of ``haskell-ghc`` - Improvements: - Demote Rubocop convention messages to ``info`` level - Stop Flycheck before the buffer is reverted [GH-282] - Properly resolve local module imports in ``haskell-ghc`` - Bug fixes: - Make relative imports work with ``python-pylint`` [GH-280] - Fix parsing of errors in ``scss`` and ``sass`` .. _flycheck-hdevtools: https://github.com/flycheck/flycheck-hdevtools 0.15 (Nov 15, 2013) ------------------- - Flycheck has a new home at https://github.com/flycheck/flycheck, the online manual moved to http://flycheck.github.io. - **Breaking changes**: - Do not add the current directory to the ``emacs-lisp`` syntax checker load path - ``flycheck-list-errors`` cannot list errors at point anymore. It does not accept a prefix argument anymore, and takes zero arguments now [GH-214] - ``flycheck-display-errors-in-list`` is gone. The error list automatically highlights the error at point now [GH-214] - Remove obsolete ``flycheck-declare-checker`` - New syntax checkers: - YAML [GH-236] - Javascript with ``gjslint`` [GH-245] - Slim [GH-246] - PHP using ``phpmd`` [GH-249] - New features: - Support IDO or Grizzl_ as completion systems for ``flycheck-select-checker`` at ``C-c ! s`` - Disable standard error navigation with ``flycheck-standard-error-navigation`` [GH-202] - Add ``flycheck-clang-language-standard`` to choose the language standard for C/C++ syntax checking [GH-207] - Add ``flycheck-clang-definitions`` to set additional definitions for C/C++ syntax checking [GH-207] - Add ``flycheck-clang-no-rtti`` to disable RTTI for C/C++ syntax checking [GH-207] - Add new option cell ``option-flag`` for boolean flags in syntax checker commands - Add ``flycheck-clang-includes`` to include additional files for C/C++ syntax checking [GH-207] - Add configuration file variable ``flycheck-pylintrc`` for Pylint - New faces ``flycheck-error-list-highlight-at-point`` and ``flycheck-error-list-highlight`` to highlight the errors at point and at the current line respectively in the error list [GH-214] - The error list now automatically updates to show the errors of the current buffer [GH-214] - Define new error levels with ``flycheck-define-error-level`` [GH-212] - Add ``flycheck-clang-standard-library`` to choose the standard library for C/C++ syntax checking [GH-234] - Customize the delay for displaying errors via ``flycheck-display-errors-delay`` [GH-243] - Add ``info`` level for informational annotations by syntax checkers [GH-215] - Add a new symbol ``temporary-file-name`` to pass temporary file names to syntax checkers [GH-259] - Improvements: - The error list now refreshes automatically after each syntax check [GH-214] - The errors at point are now automatically highlighted in the error list [GH-214] - ``emacs-lisp-checkdoc`` does not longer check ``.dir-locals.el`` files - Do not automatically check syntax in encrypted files [GH-222] - Parse notes from ``c/c++-clang`` into info level messages [GH-215] - Parse convention warnings from ``pylint`` to info level [GH-204] - Demote naming warnings from ``python-flake8`` to info level [GH-215] - Support ``enh-ruby-mode`` in Ruby syntax checkers [GH-256] - Parse columns from ``python-pylint`` errors - Do not compress temporary files for syntax checks if the original file was compressed - Bug fixes: - Find local includes in the Clang syntax checker [GH-225] - Do not emit spurious flawed definition warning in the ``rst`` syntax checker - Handle abbreviated file names in ``luac`` output, by simply ignoring them [GH-251] - Correctly redirect the output binary of the ``go-build`` syntax checker [GH-259] - Fix Cppcheck parsing with the built-in Emacs XML parser [GH-263] .. _Grizzl: https://github.com/grizzl/grizzl 0.14.1 (Aug 16, 2013) --------------------- - Bug fixes: - Add a missing dependency [GH-194] 0.14 (Aug 15, 2013) ------------------- - **Breaking changes**: - Introduce ``flycheck-define-checker`` and obsolete ``flycheck-declare-checker`` [GH-163] - Remove the obsolete ``flycheck-error-face`` and ``flycheck-warning-face`` - Do not initialize packages by default in ``emacs-lisp`` syntax checker for non-configuration files [GH-176] - Change the default ``flycheck-highlighting-mode`` to ``symbols`` [GH-179] - Drop support for Pylint 0.x in ``python-pylint`` [GH-184] - New features: - List errors at point only with prefix arg to ``flycheck-list-errors`` [GH-166] - Add new display function ``flycheck-display-errors-in-list`` to display errors at point in the error list [GH-166] - New ``option-list`` argument cell to pass option lists to a syntax checker - New ``flycheck-emacs-lisp-load-path`` option to customize the ``load-path`` used by the ``emacs-lisp`` syntax checker [GH-174] - New ``flycheck-emacs-lisp-initialize-packages`` option to initialize packages in the ``emacs-lisp`` syntax checker [GH-176] - New ``flycheck-emacs-lisp-package-user-dir`` option to configure the package directory for the ``emacs-lisp`` syntax checker [GH-176] - New option filter ``flycheck-option-comma-separated-list`` for options with comma separated lists as values - New highlighting mode ``symbols`` to highlight the symbol pointed to by an error [GH-179] - New syntax checkers: - LESS [GH-160] - Haskell with ``ghc``, ``hdevtools`` and ``hlint`` [GH-162] - C/C++ with ``cppcheck`` [GH-170] - C/C++ with ``clang`` [GH-172] - CoffeeScript with ``coffee`` - XML with ``xmllint`` [GH-180] - D with ``dmd`` [GH-167] - Improvements: - Support Web Mode in ``html-tidy`` syntax checker [GH-157] - Support Rubocop 0.9 and drop support for older Rubocop releases [GH-159] - Include the message ID in error messages from ``python-pylint`` - Bug fixes: - Fix warnings about flawed definitions in ``emacs-lisp`` and ``emacs-lisp-checkdoc``, caused by faulty formatting of sexps - Refresh error lists when pressing ``g`` [GH-166] - Do not obscure active minibuffer input when displaying errors in the echo area [GH-175] - Fix universal prefix argument for ``flycheck-next-error`` at ``C-c ! n`` - Correctly parse output of ``coffeelint`` 0.5.7 [GH-192] - Correctly parse output of ``pylint`` 1.0 [GH-184] 0.13 (Jun 28, 2013) ------------------- - **Breaking changes**: - Obsolete ``flycheck-warning-face`` and ``flycheck-error-face`` in favor ``flycheck-warning`` and ``flycheck-error`` respectively - Obsolete ``:predicate`` forms in favor of ``:predicate`` functions - ``flycheck-def-config-file-var`` does not automatically mark variables as safe anymore - New features: - Make fringe indicator faces customizable independently with ``flycheck-fringe-error`` and ``flycheck-fringe-warning`` - Improve the default faces by using underlines instead of foreground colors, if possible - Customizable error processing with ``flycheck-process-error-functions`` [GH-141] - Make the delay before starting a syntax check customizable via ``flycheck-idle-change-delay`` [GH-144] - Make display of errors under point customizable via ``flycheck-display-errors-function`` [GH-156] - Improvements - Always highlight errors on top of warnings now - Do not trigger syntax checks in the middle of commands [GH-141] - Add the current directory to load path in the ``emacs-lisp`` syntax checker - Do not longer use the ``emacs-lisp-checkdoc`` syntax checker in Scratch buffers - Do not flush temporary files onto disk [GH-149] - Syntax checkers may have error patterns and error parser now - Predicate forms are now wrapped into functions and compiled into functions during byte compilation - Copy each message separately in ``flycheck-copy-messages-as-kill`` - Mark some customizable variables as safe for file variable usage, most notably ``flycheck-indication-mode``, ``flycheck-highlighting-mode`` and ``flycheck-idle-change-delay``. - Bug fixes: - Fix error when searching for a configuration file outside a Projectile project - Do not start a syntax check before the ``flycheck-mode-hook`` was run - Do not start automatic syntax checks if Flycheck Mode is disabled - Defer the initial syntax check until after the current interactive command [GH-143] - Correctly clean up information about running processes - Fix compatibility with Emacs 24.2 and earlier [GH-150] - Fix version information on Emacs trunk builds 0.12 (May 18, 2013) ------------------- - New syntax checkers: - Ruby using ``jruby`` [GH-136] - Puppet [GH-138] - New features: - Highlight error expressions by default, with the new ``sexps`` highlighting mode - Automatically check syntax some time after the last change in the buffer [GH-140] - Add ``flycheck-version`` to determine the installed Flycheck version - Add ``flycheck-list-errors``, mapped to ``C-c ! l``, to list all errors in a separate buffer - Improvements: - Defer syntax checks while a buffer is reverted, to avoid race conditions - Bug fixes: - Correctly parse syntax errors from JRuby [GH-136] 0.11 (May 01, 2013) ------------------- - New syntax checkers: - Scala [GH-124] - New features: - Customizable error indication with control of the fringe side, via ``flycheck-indication-mode`` - Customizable automatic syntax checking, via ``flycheck-check-syntax-automatically`` [GH-128] - Customizable configuration file search, via ``flycheck-locate-config-file-functions`` [GH-133] - Find configuration files in Projectile_ projects - Add ``flycheck-before-syntax-check-hook`` and ``flycheck-syntax-check-failed-hook`` - Improvements: - The ``ruby`` syntax checker now differentiates warnings from errors [GH-123] - Faces are now in a separate customization group - Bug fixes: - Add missing customization group for syntax checker options .. _Projectile: https://github.com/bbatsov/projectile 0.10 (Apr 21, 2013) ------------------- - Flycheck uses ``cl-lib`` now. This library is built-in as of GNU Emacs 24.3. For earlier releases of GNU Emacs 24 an additional compatibility library will be installed from GNU ELPA. - New syntax checkers: - POSIX Shell script using ``bash`` [GH-112] - Ruby using ``rubocop`` [GH-113] - Elixir [GH-108] - Erlang [GH-122] - Removed syntax checkers: - Python using Pyflakes. Use the superior Flake8 syntax checker [GH-115] - New features: - Add ``flycheck-copy-messages-as-kill``, mapped to ``C-c ! C-w``, to copy all error messages under point into kill ring - Add ``flycheck-google-messages``, mapped to ``C-c ! /``, to google for error messages under point. Needs the `Google This`_ library - Syntax checkers can redirect output to a temporary directory now using the ``temporary-directory`` argument symbol - Improvements: - Call option filters for ``nil`` values, too - Improve error parsing in Bash syntax checker [GH-112] - Error navigation does not cross restrictions in narrowed buffers anymore - Try to preserve the non-directory part of the buffer's file name when substituting the ``source`` symbol [GH-99] - Bug fixes: - Fix error highlighting and navigation in narrowed buffers - Use a hopefully more reliable way to parse output of PHP CodeSniffer [GH-118] .. _Google This: https://github.com/Malabarba/emacs-google-this 0.9 (Apr 13, 2013) ------------------ - New syntax checkers: - SCSS using ``scss`` [GH-103] - RST (ReStructuredText) using Docutils - Go using ``go build`` and ``go test`` [GH-107] - Improvements: - Quit the error message window when navigating away from error locations 0.8 (Apr 9, 2013) ----------------- - New syntax checkers: - Go using ``gofmt`` [GH-91] - Rust using ``rustc`` [GH-101] - New features: - Add a global Flycheck mode. ``(global-flycheck-mode)`` is now the recommended way to enable Flycheck [GH-29] - Add support for syntax checker options [GH-72] - Add option for the coding standard used by the ``php-phpcs`` syntax checker - Add options for the maximum McCabe complexity and the maximum line length to ``python-flake8`` - Improvements: - Support McCabe warnings in ``python-flake8`` - Support warnings from ``flake8`` 2 - Show long error messages in a popup buffer [GH-94] - Show all error messages at point [GH-96] - Add support for naming warings from ``flake8`` 2 [GH-98] - Flycheck mode is not longer enabled for buffers whose names start with a space - Improve highlighting to reduce screen flickering [GH-100] 0.7.1 (Feb 23, 2013) -------------------- - Bug fixes: - Do not signal errors from ``flycheck-mode`` [GH-87] - Correctly fall back to ``$HOME`` when searching configuration files - Correctly ascend to parent directory when searching configuration files - API changes: - Rename ``config`` cell to ``config-file`` - Allow to pass the result of ``config-file`` cells as single argument - Add support for evaluating Lisp forms in syntax checker commands [GH-86] 0.7 (Feb 14, 2013) ------------------ - New features: - Navigate to source of syntax checker declarations from syntax checker help - Add online Info manual [GH-60] - Improvements: - Use pipes instead of TTYs to read output from syntax checkers - Defer syntax checks for invisible buffers [GH-80] - Immediately display error messages after error navigation [GH-62] - Bug fixes: - Never select deleted buffers - Do not let the debugger interfere with necessary cleanup actions - Do not attempt to parse empty XML trees [GH-78] - Fix infinite recursion on Windows [GH-81] 0.6.1 (Jan 30, 2013) -------------------- - Fix package dependencies 0.6 (Jan 29, 2013) ------------------ - New syntax checkers: - Emacs Lisp with ``checkdoc-current-buffer`` [GH-53] - PHP with PHP CodeSniffer [GH-72] - Removed syntax checkers: - Javascript with ``jsl`` - New features: - Error navigation with ``next-error`` and ``previous-error`` [GH-26] - Fringe icons instead of error indicators [GH-33] - Menu entry for Flycheck [GH-59] - Customizable error highlighting, taking the column number into account [GH-35] - Configuration files for syntax checkers - Add configuration file support to the syntax checkers ``coffee-coffeelint``, ``html-tidy``, ``javascript-jshint``, ``pyton-flake8`` and ``tex-chktex`` - Allow to compile a buffer with a syntax checker for testing purposes [GH-58] - Use multiple syntax checkers during a syntax check [GH-31] - Add dedicated help for syntax checkers [GH-52] - Improvements: - Match error patterns in order of declaration [GH-55] - Bug fixes: - Inherit highlighting faces from built-in faces [GH-24] - Correct error patterns of the HTML syntax checker [GH-36] - Detect syntax errors in the ``python-flake8`` syntax checker [GH-42] - Fix various regressions after introducing unit tests - Inhibit syntax checking during package installation [GH-45] - Disable syntax checking in Tramp buffers [GH-54] - Preserve whitespace in error messages [GH-65] - API changes: - Replace syntax checker variables with syntax checker declarations [GH-41] - Support parsing errors with arbitrary functions instead of error patterns [GH-38] - Add an error parser for Checkstyle-like XML output [GH-38] 0.5 (Dec 28, 2012) ------------------ - New syntax checkers: - SASS [GH-15] - Perl [GH-21] - XML - Lua [GH-30] - New features: - Support manual buffer-local selection of syntax checker [GH-25] - Add customizable error indicators [GH-28] - Echo error messages at point without 3rd-party libraries like flymake-cursor_ [GH-27] - Improvements: - Remember the last automatically selected syntax checker [GH-24] - Bug fixes: - Fix syntax checking of buffers without backing files [GH-19] - API changes: - Replace underlying Flymake API with a custom syntax checking implementation [GH-15] .. _flymake-cursor: https://www.emacswiki.org/emacs/FlymakeCursor 0.4 (Nov 21, 2012) ------------------ - Rename the project to Flycheck [GH-5] - New syntax checkers - HAML [GH-9] - CSS [GH-9] - Javascript with ``jsl`` [GH-9] - Javascript with ``jshint`` [GH-16] - JSON [GH-12] - LaTeX with ``lacheck`` - Bug fixes: - Fix type error when checking compressed Emacs Lisp [GH-10] 0.3 (Nov 21, 2012) ------------------ - Replace ``flymake-mode`` with a custom syntax checking minor mode [GH-4] 0.2 (Oct 25, 2012) ------------------ - New syntax checkers: - PHP - API changes: - Simplify syntax checker declarations [GH-2] 0.1 (Oct 11, 2012) ------------------ Initial release as flymake-checkers - New syntax checkers: - TeX/LaTeX - Shell scripts - Python - Ruby - Coffeescript - Emacs Lisp flycheck-35.0/CHANGES.rst000066400000000000000000000506441500215546300150450ustar00rootroot00000000000000``master`` (unreleased) ====================== 35.0 (2025-04-23) ====================== ------------ New Features ------------ - [#2105]: Add options for configuring the ``jsonnet`` checker. - [#1975]: Add support for ``--expt-relaxed-constexpr`` flag to ``cuda`` checker. - [#2055]: Add support for ``--expt-extended-lambda`` flag to ``cuda`` checker. - [#1987]: Add a flag ``flycheck-auto-display-errors-after-checking`` control whether to display errors automatically after checking. - [#2035]: Add colors to FlyC mode line and update mode line menu. Introduce ``flycheck-mode-success-indicator``. - [#2059]: Enable checkers for new AUCTeX 14 modes. - [#2070]: Add a new syntax checker ``r`` for R with the builtin ``parse`` function. - [#2073]: Add new syntax checker ``salt-lint`` for the salt infrastructure-as-code language. - [#2071]: Add a new checker ``perl-perlimports``, for cleaning up Perl import statements. - [#1972]: New defcustom ``flycheck-clear-displayed-errors-function`` to customize how error messages are to be cleared. - [#2075]: Add the ``flycheck-chktex-extra-flags`` option to the ``tex-chktex`` checker. - [#2107]: Add ``-Xcompiler`` option for ``cuda-nvcc``. - Add new ``markdownlint-cli2`` checker. ----------- Bugs fixed ----------- - [#2057]: Revert the replacement of ``flycheck-version`` with ``lm-version``. - [#1972]: Refine flycheck-display-errors lifecycle so error messages can be cleared. - [#2067]: Handle correctly GHC 9.6 error output format. - [#2079]: Fix ruff ``error-patterns`` and ``error-filter``. ---------- Changes ---------- - **(Breaking)** [#2066]: Remove support for versions of ``stylelint`` older than v14. - Update ``error-patterns`` for ghdl 4.1.0. - [#2078]: ruff: ``--output-format=text`` replaced with ``--output-format=concise`` due to upstream changes in ruff. 34.1 (2024-02-18) ====================== ----------- Bugs fixed ----------- - [#2054]: Remove explicit dep on the built-in package ``seq.el``. 34.0 (2024-02-14) ====================== ------------ New Features ------------ - New syntax checkers - [#2015]: PHP with ``phpcs-changed`` - [#2017]: HAML with ``haml-lint`` - [#2030]: Add ``yaml-actionlint`` checker for GitHub yaml action workflows. - [#2052]: Sass with Stylelint - [#2013]: Nix with ``statix`` - [#1935]: Chef (Ruby) with ``cookstyle`` - [#1915]: Markdown with ``pymarkdown`` - [#1873]: Add error explainer to ``perl-perlcritic``. - [#1875]: Add error-explainer to ``css-stylelint``. - [#1876]: Add error-explainer for ``markdownlint checker``. - [#2019]: Add support for RELAX NG schema in ``xmllint``. ---------- Bugs Fixed ---------- - [#1793]: Fix ``flycheck-ruby-rubocop`` on buffers with no backing file. ---------- Changes ---------- - [#2026]:Update the possible locations for ``yamllint``'s configuration file. - **(Breaking)** [#1697]: Remove the ``coq`` checker. - **(Breaking)** [#1935]: Remove the ``chef-foodcritic`` checker. (it's now replaced by ``ruby-chef-cookstyle``) - **(Breaking)** [#2018]: Remove the ``golint`` checker. - **(Breaking)** Remove the ``ruby-rubylint`` checker. - [#1704]: The ``tslint`` checker is deprecated; it will go away in a future release. ---------------------- 33.1 (2024-02-04) ====================== - Bugs Fixed - Fixed an usage of the removed ``flycheck--format-message`` function. 33.0 (2024-02-04) ======================= .. note:: The changelog for this release is incomplete. - New features and improvements - The ``flycheck-verify-setup`` UI now includes buttons to re-enable manually disabled checkers and to try to re-enable automatically disabled checkers (command checkers are automatically disabled when their executable cannot be found). [GH-1755] - Error explainers can now return URLs (to show a webpage) or functions (to use custom formatting). For example, the Rust checker now renders explanations using ``markdown-view-mode``. [GH-1753] - Enable checkers in many newer TreeSitter-based major modes (think ``*-ts-mode``). - New syntax checkers - Python with ``ruff``. [GH-2033] - **Breaking changes** - Drop support for Emacs 25. - The variable ``flycheck-current-errors`` now contains errors in the order in which they were returned by checkers. In previous versions of Flycheck, this list was sorted by error position and severity. [GH-1749] 32 (frozen on May 3rd, 2020, released Mar 28, 2022) =================================================== - Highlights - Many checkers and compiler, such as ``ocaml``, ``rust``, ``eslint``, and others, include end-line and end-column information. Flycheck can now highlight the exact region that they report. Authors of checker definitions can use the new ``:end-line`` and ``:end-column`` arguments in ``flycheck-error-new``, or the new ``end-line`` and ``end-column`` fields in error patterns. [GH-1400] - Errors that checkers return for other files will now be displayed on the first line of the current buffer instead of begin discarded. The error list indicates which file each error came from, and navigation moves automatically moves between files. This change helps with compiled languages, where an error in another file may cause the current file to be considered invalid. Variables ``flycheck-relevant-error-other-file-show`` and ``flycheck-relevant-error-other-file-minimum-level`` control this behavior. [GH-1427] - Flycheck can now draw error indicators in margins in addition to fringes. Margins can contain arbitrary characters and images, not just monochrome bitmaps, allowing for a better experience on high-DPI screens. ``flycheck-indication-mode`` controls this behavior, and ``flycheck-set-indication-mode`` can be used to automatically adjust the fringes and margins. Additionally, Flycheck's will now use high-resolution fringe bitmaps if the fringe is wide enough [GH-1742, GH-1744] - Error highlighting is now configurable, using the new ``flycheck-highlighting-style`` variable: instead of applying level-dependent faces (typically with wavy underlines), Flycheck can now insert delimiters around errors, or mix styles depending on how many lines an error covers. Additionally, stipples are added in the fringes to indicate errors that span multiple lines. [GH-1743] - New features and improvements - Flycheck can now trigger a syntax check automatically after switching buffers, using the ``idle-buffer-switch`` option in ``flycheck-check-syntax-automatically``. This is useful when errors in a file are due to problems in a separate file. Variables ``flycheck-idle-buffer-switch-delay`` and ``flycheck-buffer-switch-check-intermediate-buffers`` control the functionality. [GH-1297] - Flycheck will now use Emacs' native XML parsing when libXML fails. This behavior can be changed by customizing ``flycheck-xml-parser``. [GH-1349] - ``flycheck-verify-setup`` now shows more clearly which checkers will run in the buffer, and which are misconfigured. [GH-1478] - Flycheck now locates checker executables using a customizable function, ``flycheck-executable-find``. The default value of this function allows relative paths (set e.g. in file or dir-local variables) in addition to absolute paths and executable names. [GH-1485] - Checkers that report error positions as a single offset from the start of the file can use the new ``flycheck-error-new-at-pos`` constructor instead of converting that position to a line and a column. [GH-1400] - Config-file variables can now be set to a list of file names. This is useful for checkers like mypy which don't run correctly when called from a subdirectory without passing an explicit config file. [GH-1711] - Thanks to algorithmic improvements in error reporting, Flycheck is now much faster in large buffers. [GH-1750] - New syntax checkers: - Awk with ``gawk`` [GH-1708] - Bazel with ``buildifier`` [GH-1613] - CUDA with ``cuda-nvcc`` [GH-1508] - CWL with ``schema-salad-tool`` [GH-1361] - Elixir with ``credo`` [GH-1062] - JSON with ``json-jq`` [GH-1568] - Jsonnet with ``jsonnet`` [GH-1345] - MarkdownLint CLI with ``markdownlint`` [GH-1366] - mypy with ``python-mypy`` [GH-1354] - Nix with ``nix-linter`` [GH-1530] - Opam with ``opam lint`` [GH-1532] - protobuf-prototool with ``prototool`` [GH-1591] - Rust with ``rust-clippy`` [GH-1385] - Ruumba with ``eruby-ruumba`` [GH-1616] - Staticcheck with ``go-staticheck`` [GH-1541] - terraform with ``terraform fmt``, ``tflint`` [GH-1586] - Tcl with ``nagelfar`` [GH-1365] - Text prose with ``textlint`` [GH-1534] - VHDL with ``ghdl`` [GH-1160] - Checker improvements: - ``python-pylint`` and ``python-flake8`` are now invoked with ``python -c``, to make it easier to change between Python 2 and Python 3. [GH-1113] - Add ``flycheck-perl-module-list`` to use specified modules when syntax checking code with the ``perl`` checker. [GH-1207] - ``rust-cargo`` now uses ``cargo check`` and ``cargo test``. [GH-1289] - Add ``flycheck-ghc-stack-project-file`` for the ``haskell-stack-ghc`` checker. [GH-1316] - Add ``flycheck-cppcheck-suppressions-file`` to pass a suppressions file to cppcheck. [GH-1329] - Add ``--force-exclusion`` flag to ``rubocop`` command. [GH-1348] - Flycheck now uses ESLint's JSON output instead of checkstyle XML. [GH-1350] - Add ``flychjeck-eslint-args`` to pass arguments to ``javascript-eslint``. [GH-1360] - Flycheck will now execute ``rubocop`` from the directory where a ``Gemfile`` is located. If a ``Gemfile`` does not exist, the old behaviour of running the command from the directory where ``.rubocop.yml`` is found will be used. [GH-1368] - Add ``flycheck-sh-bash-args`` to pass arguments to ``sh-bash``. [GH-1439] - ``haskell-stack-ghc`` will not try to install GHC anymore. [GH-1443] - Add ``flycheck-ghdl-ieee-library`` to select which standard IEEE library to use for ghdl. [GH-1547] - The ``javascript-eslint`` checker now supports ``typescript-mode`` by default. - Add ``flycheck-erlang-rebar3-profile`` to select which profile to use when compiling erlang with rebar3. [GH-1560] - Add ``flycheck-relevant-error-other-file-show`` to avoid showing errors from other files. [GH-1579] - The ``nix-linter`` checker now has an error explainer. [GH-1586] - The Emacs Lisp checker can now run in buffers not backed by files. [GH-1695] - **Breaking changes** - Remove the ``javascript-jscs`` checker. [GH-1024] - Remove the ``elixir-dogma`` checker. [GH-1450] - ``rust-cargo`` now requires Rust 1.17 or newer. [GH-1289] - ``rust`` now requires 1.18 or newer. [GH-1501] - Rename ``flycheck-cargo-rustc-args`` to ``flycheck-cargo-check-args``. [GH-1289] - ``rust-cargo`` does not use the variable ``flycheck-rust-args`` anymore. [GH-1289] - Improve detection of default directory for ``haskell-ghc`` to consider ``hpack`` project files. [GH-1435] - Replace ``go tool vet`` with ``go vet``. [GH-1548] - Remove the deprecated ``go-megacheck`` checker, which is replaced by ``go-staticcheck``. [GH-1583] 31 (Oct 07, 2017) ================= - **Breaking changes** - ``rust-cargo`` now requires Rust 1.15 or newer [GH-1201] - Remove javascript-gjslint checker - New syntax checkers: - Protobuf with ``protoc`` [GH-1125] - systemd-analyze with ``systemd-analyze`` [GH-1135] - Nix with ``nix-instantiate`` [GH-1164] - Dockerfile with ``hadolint`` [GH-1194] - AsciiDoc with ``asciidoctor`` [GH-1167] - CSS/SCSS/LESS with ``stylelint`` [GH-903] - Ruby with ``reek`` [GH-1244] - Go with ``megacheck`` [GH-1290] - LLVM IR with ``llc`` [GH-1302] - Text prose with ``proselint`` [GH-1304] - New features: - Add ``flycheck-xml-xmlstarlet-xsd-path`` and ``flycheck-xml-xmllint-xsd-path`` to specify an XSD schema to validate XML documents against [GH-1272] - Add ``flycheck-tslint-args`` to pass additional arguments to tslint [GH-1186] - Add an error explainer to the ``rpm-rpmlint`` checker using ``rpmlint -I`` [GH-1235] - Add ``flycheck-emacs-lisp-check-declare`` to check function declaration in the ``emacs-lisp`` checker [GH-1286] - Add ``flycheck-shellcheck-follow-sources`` to check included files when using the ``sh-shellcheck`` checker [GH-1256] - Improvements: - Use option ``flycheck-go-build-tags`` for ``go-test``, ``go-vet`` and ``go-errcheck`` as well. - Add a revert function to ``flycheck-verify-setup``, so hitting ``g`` reloads the buffer. - Make sure the erlang compiler is only run on compilable files. - ``flycheck-tslint`` does not crash any more on deprecation notices [GH-1174] - ``rust-cargo`` now checks integration tests, examples and benchmarks [GH-1206] - ``rust-cargo`` does not use ``flycheck-rust-library-path`` anymore, as dependencies are taken care of by Cargo [GH-1206] - ``c/c++-gcc`` checker now works from GCC 4.4 and up [GH-1226] 30 (Oct 12, 2016) ================= - **Breaking changes** - Flycheck now requires flake8 3.0 or newer - Remove ``--config`` option in ``lua-luacheck`` in favour of ``luacheck``'s own ``.luacheckrc`` detection. Therefore ``flycheck-luacheckrc`` is no longer used [GH-1057] - ``:modes`` is now mandatory for syntax checker definitions [GH-1071] - Remove jade checker [GH-951] [GH-1084] - Remove ``javascript-eslintrc`` and instead rely on eslint's own configuration file search [GH-1085] - ``C-c ! e`` explains errors now [GH-1122] - New syntax checkers: - Elixir with ``dogma`` [GH-969] - sass and scss with ``sass-lint`` [GH-1070] - Pug [GH-951] [GH-1084] - New features: - Add ``flycheck-cargo-rustc-args`` to pass multiple arguments to cargo rustc subcommand [GH-1079] - Add ``:error-explainer`` to ``flycheck-define-checker`` and ``flycheck-explain-error-at-point`` to display explanations of errors [GH-1122] - Add an error explainer to the ``rust`` and ``rust-cargo`` checkers using ``rustc --explain`` [GH-1122] - Add ``:enabled`` property to ``flycheck-define-checker`` [GH-1089] - Improvements: - Do not use ``javascript-eslint`` if eslint cannot find a valid configuration [GH-1085] - Automatically disable syntax checkers which are not installed instead of checking executable before each syntax check [GH-1116] - Add patterns for syntax errors to ``scheme-chicken`` [GH-1123] 29 (Aug 28, 2016) ================= - **Breaking changes** - Change ``flycheck-eslint-rulesdir`` (string) to ``flycheck-eslint-rules-directories`` (list of strings) [GH-1016] - Require rust 1.7 or newer for ``rust`` and ``rust-cargo`` [GH-1036] - New syntax checkers: - Slim with ``slim-lint`` [GH-1013] - CHICKEN Scheme with ``csc`` [GH-987] - New features: - Add ``:working-directory`` option to ``flycheck-define-command-checker`` [GH-973] [GH-1012] - ``flycheck-go-build-install-deps`` turns on dependency installation for ``go test`` as well as ``go build`` [GH-1003] - Improvements: - Add default directory for ``haskell-stack-ghc`` and ``haskell-ghc`` checkers [GH-1007] - ``rust`` and ``rust-cargo`` checkers now support the new error format of rust 1.12 [GH-1016] - ``flycheck-verify-checker`` and ``flycheck-verify-setup`` now include information about configuration files of syntax checkers [GH-1021] [GH-1038] 28 (Jun 05, 2016) ================= - **Breaking changes**: - Rename ``luacheck`` to ``lua-luacheck`` to comply with our naming conventions - Remove ``flycheck-cppcheck-language-standard`` in favour of ``flycheck-cppcheck-standards`` which is a list of standards [GH-960] - New features: - Add option to set binary name for ``rust-cargo`` [GH-958] - Add ``flycheck-cppcheck-standards`` to pass multiple code standards to cppcheck [GH-960] - Add ``flycheck-cppcheck-suppressions`` to suppress warnings for cppcheck [GH-960] - Improvements: - Check Racket syntax in Geiser Mode [GH-979] - Bug fixes - Do not signal errors when tslint reports no output [GH-981] - Do not generate invalid temporary filenames on Windows [GH-983] 27 (May 08, 2016) ================= - **Breaking changes** - Require PHP Code Sniffer 2.6 or newer for ``php-phpcs`` [GH-921] - New syntax checkers: - Go with ``go-unconvert`` [GH-905] - Markdown with ``mdl`` [GH-839] [GH-916] - TypeScript with ``tslint`` [GH-947] [GH-949] - Improvements: - Pass checkdoc settings from Emacs to `emacs-lisp-checkdoc` [GH-741] [GH-937] - Bug fixes: - Fix parsing of syntax errors in triple-quoted strings for ``python-pycompile`` [GH-948] - Correctly handle rules based on the current file name in ``php-phpcs`` [GH-921] 26 (Apr 27, 2016) ================= Flycheck now has a `Code of Conduct`_ which defines the acceptable behaviour and the moderation guidelines for the Flycheck community. [GH-819] Flycheck also provides a `Gitter channel`_ now for questions and discussions about development. [GH-820] The native Texinfo manual is again replaced with a Sphinx_ based documentation. We hope that this change makes the manual easier to edit and to maintain and more welcoming for new contributors. The downside is that we can not longer include a Info manual in Flycheck’s MELPA packages. From this release onward Flycheck will use a single continuously increasing version number. Breaking changes may occur at any point. .. _Code of Conduct: https://www.flycheck.org/en/latest/community/conduct.html .. _Gitter channel: https://gitter.im/flycheck/flycheck .. _Sphinx: https://sphinx-doc.org - **Breaking changes**: - Remove ``flycheck-copy-messages-as-kill``, obsolete since Flycheck 0.22 - Remove ``flycheck-perlcritic-verbosity``, obsolete since Flycheck 0.22 - Replace ``flycheck-completion-system`` with ``flycheck-completing-read-function`` [GH-870] - JSON syntax checkers now require ``json-mode`` and do not check in Javascript Mode anymore - Prefer eslint over jshint for Javascript - Obsolete ``flycheck-info`` in favour of the new ``flycheck-manual`` command - New syntax checkers: - Processing [GH-793] [GH-812] - Racket [GH-799] [GH-873] - New features: - Add ``flycheck-puppet-lint-rc`` to customise the location of the puppetlint configuration file [GH-846] - Add ``flycheck-puppet-lint-disabled-checks`` to disable specific checks of puppetlint [GH-824] - New library ``flycheck-buttercup`` to support writing Buttercup_ specs for Flycheck - Add ``flycheck-perlcriticrc`` to set a configuration file for Perl::Critic [GH-851] - Add ``flycheck-jshint-extract-javascript`` to extract Javascript from HTML [GH-825] - Add ``flycheck-cppcheck-language-standard`` to set the language standard for cppcheck [GH-862] - Add ``flycheck-mode-line-prefix`` to customise the prefix of Flycheck’s mode line lighter [GH-879] [GH-880] - Add ``flycheck-go-vet-shadow`` to check for shadowed variables with ``go vet`` [GH-765] [GH-897] - Add ``flycheck-ghc-stack-use-nix`` to enable Nix support for Stack GHC [GH-913] - Improvements: - Map error IDs from flake8-pep257 to Flycheck error levels - Explicitly display errors at point with ``C-c ! h`` [GH-834] - Merge message and checker columns in the error list to remove redundant ellipsis [GH-828] - Indicate disabled checkers in verification buffers [GH-749] - Do not enable Flycheck Mode in ``fundamental-mode`` buffers [GH-883] - Write ``go test`` output to a temporary files [GH-887] - Check whether ``lintr`` is actually installed [GH-911] - Bug fixes: - Fix folding of C/C++ errors from included files [GH-783] - Fix verification of SCSS-Lint checkstyle reporter - Don’t fall back to ``rust`` if ``rust-cargo`` should be used [GH-817] - Don’t change current buffer when closing the error message buffer [GH-648] - Never display error message buffer in current window [GH-822] - Work around a caching issue in Rubocop [GH-844] - Fix checkdoc failure with some Emacs Lisp syntax [GH-833] [GH-845] [GH-898] - Correctly parse Haskell module name with exports right after the module name [GH-848] - Don’t hang when sending buffers to node.js processes on Windows [GH-794][GH-850] - Parse suggestions from ``hlint`` [GH-874] - Go errcheck handles multiple ``$GOPATH`` entries correctly now [GH-580][GH-906] - Properly handle Go build failing in a directory with multiple packages [GH-676] [GH-904] - Make cppcheck recognise C++ header files [GH-909] - Don’t run phpcs on empty buffers [GH-907] .. _Buttercup: https://github.com/jorgenschaefer/emacs-buttercup flycheck-35.0/COPYING000066400000000000000000001045131500215546300142710ustar00rootroot00000000000000 GNU GENERAL PUBLIC LICENSE Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such measures. When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a) The work must carry prominent notices stating that you modified it, and giving a relevant date. b) The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c) You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d) If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a) Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b) Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c) Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d) Limiting the use for publicity purposes of names of licensors or authors of the material; or e) Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f) Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of this License. Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively state the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . Also add information on how to contact you by electronic and paper mail. If the program does terminal interaction, make it output a short notice like this when it starts in an interactive mode: Copyright (C) This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, your program's commands might be different; for a GUI interface, you would use an "about box". You should also get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply and follow the GNU GPL, see . The GNU General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Lesser General Public License instead of this License. But first, please read . flycheck-35.0/Eask000066400000000000000000000035331500215546300140440ustar00rootroot00000000000000(package "flycheck" "35.0" "On-the-fly syntax checking") (website-url "https://www.flycheck.org") (keywords "convenience" "languages" "tools") (package-file "flycheck.el") (files "flycheck-ert.el" "flycheck-buttercup.el") (script "test" "echo \"Error: no test specified\" && exit 1") (source 'gnu) (source 'melpa) (depends-on "emacs" "27.1") (development (depends-on "f") ; For some maintenance tools (depends-on "buttercup") ; BDD test framework for Emacs (depends-on "shut-up") ; Silence Emacs ;; Various modes for use in the unit tests (depends-on "adoc-mode") (depends-on "bazel") (depends-on "coffee-mode") (depends-on "cperl-mode") (depends-on "cwl-mode") (depends-on "d-mode") (depends-on "dockerfile-mode") (depends-on "elixir-mode") (depends-on "erlang") (depends-on "ess") (depends-on "geiser") (depends-on "go-mode") (depends-on "groovy-mode") (depends-on "haml-mode") (depends-on "handlebars-mode") (depends-on "haskell-mode") (depends-on "js2-mode") (depends-on "js3-mode") (depends-on "rjsx-mode") (depends-on "json-mode") (depends-on "julia-mode") (depends-on "less-css-mode") (depends-on "lua-mode") (depends-on "markdown-mode") (depends-on "mmm-mode") (depends-on "nix-mode") (depends-on "php-mode") (depends-on "processing-mode") (depends-on "protobuf-mode") (depends-on "pug-mode") (depends-on "puppet-mode") ;; (depends-on "racket-mode") ;; https://github.com/greghendershott/racket-mode/issues/461 (depends-on "rhtml-mode") (depends-on "rpm-spec-mode") (depends-on "rust-mode") (depends-on "sass-mode") (depends-on "scala-mode") (depends-on "scss-mode") (depends-on "slim-mode") (depends-on "systemd") (depends-on "terraform-mode") (depends-on "tuareg") (depends-on "typescript-mode") (depends-on "web-mode") (depends-on "yaml-mode")) flycheck-35.0/MAINTAINERS000066400000000000000000000002171500215546300147270ustar00rootroot00000000000000Clément Pit-Claudel (@cpitclaudel) fmdkdd (@fmdkdd) Bozhidar Batsov (@bbatsov) flycheck-35.0/Makefile000066400000000000000000000104611500215546300146740ustar00rootroot00000000000000# Copyright (c) 2018 Flycheck contributors # Copyright (c) 2012-2016 Sebastian Wiesner and Flycheck contributors # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . # Programs EASK = eask EMACS = emacs GIT = git INKSCAPE = inkscape CONVERT = convert OPTIPNG = optipng # Program options EMACSOPTS = PATTERN = .* LANGUAGE = ifdef LANGUAGE SELECTOR = (language $(LANGUAGE)) endif # Internal variables EMACSBATCH = $(EMACS) -Q --batch -L . $(EMACSOPTS) RUNEMACS = # Program availability ifdef EASK RUNEMACS = $(EASK) exec $(EMACSBATCH) HAVE_EASK := $(shell sh -c "command -v $(EASK)") ifndef HAVE_EASK $(warning "$(EASK) is not available. Please run make help") endif else RUNEMACS = $(EMACSBATCH) endif HAVE_INKSCAPE := $(shell sh -c "command -v $(INKSCAPE)") HAVE_CONVERT := $(shell sh -c "command -v $(CONVERT)") HAVE_OPTIPNG := $(shell sh -c "command -v $(OPTIPNG)") RUNTEST = $(RUNEMACS) --load test/flycheck-test --load test/run.el \ -f flycheck-run-tests-main # Export Emacs to goals, mainly for EASK EASK_EMACS = $(EMACS) export EMACS export EASK_EMACS # Run make help by default .DEFAULT_GOAL = help # File lists SRCS = flycheck.el flycheck-ert.el IMGS = doc/_static/logo.png TEST_SRCS = flycheck.el flycheck-ert.el test/flycheck-test.el # File rules flycheck-ert.elc: flycheck.elc flycheck-buttercup.elc: flycheck.elc doc/_static/logo.png: flycheck.svg ifndef HAVE_CONVERT $(error "$(CONVERT) not available. Please run make help.") endif ifndef HAVE_INKSCAPE $(error "$(INKSCAPE) not available. Please run make help.") endif ifndef HAVE_OPTIPNG $(error "$(OPTIPNG) not available. Please run make help.") endif $(CONVERT) $< -trim -background white -bordercolor white \ -border 5 $@ $(OPTIPNG) $@ # Public targets .PHONY: init init: $(EASK) install-deps --dev $(EASK) upgrade .PHONY: clean clean: $(EASK) clean elc $(MAKE) -C doc clean .PHONY: purge purge: $(GIT) clean -xfd .PHONY: format format: $(RUNEMACS) -l maint/flycheck-format.el -f flycheck/batch-format .PHONY: check-format check-format: $(RUNEMACS) -l maint/flycheck-format.el -f flycheck/batch-check-format .PHONY: checkdoc checkdoc: $(EASK) lint checkdoc .PHONY: check check: check-format checkdoc .PHONY: compile compile: $(EASK) compile .PHONY: specs specs: compile $(EASK) exec buttercup -L . test/specs .PHONY: unit unit: compile $(RUNTEST) '(and (not (tag external-tool)) $(SELECTOR))' .PHONY: integ integ: compile $(RUNTEST) '(and (tag external-tool) $(SELECTOR))' .PHONY: images images: $(IMGS) .PHONY: help help: @echo 'Run `make init` first to install and update all local dependencies.' @echo '' @echo 'Available targets:' @echo ' init: Initialise the project. RUN FIRST!' @echo ' check: Check all Emacs Lisp sources (needs Emacs 25)' @echo ' compile: Byte-compile Emacs Lisp sources' @echo ' format: Format all Emacs Lisp sources' @echo ' specs: Run all buttercup specs for Flycheck' @echo ' unit: Run all ERT unit tests for Flycheck (legacy)' @echo ' integ: Run all integration tests for Flycheck' @echo ' images: Generate PNG images from SVG sources' @echo ' clean: Clean compiled files' @echo ' purge: Clean everything' @echo '' @echo 'Available make variables:' @echo ' PATTERN: A regular expression matching spec names to run with `specs`' @echo ' SELECTOR: An ERT selector expression for `unit` and `integ`' @echo ' LANGUAGE: The name of a language for `integ`. Overrides `SELECTOR`' @echo ' EMACSOPTS: Additional options to pass to `emacs`' @echo ' EMACS: The path or name of the Emacs to use for tests and compilation' @echo '' @echo 'Available programs:' @echo ' $(EASK): $(if $(HAVE_EASK),yes,no)' @echo '' @echo 'You need $(EASK) to develop Flycheck.' @echo 'See https://emacs-eask.github.io/ for more information.' flycheck-35.0/README.md000066400000000000000000000330211500215546300145100ustar00rootroot00000000000000# [![Flycheck][logo]](https://www.flycheck.org) [![License GPL 3](https://img.shields.io/github/license/flycheck/flycheck.svg)][COPYING] [![Join the chat](https://img.shields.io/gitter/room/flycheck/flycheck.svg)](https://gitter.im/flycheck/flycheck) [![MELPA](https://melpa.org/packages/flycheck-badge.svg)](https://melpa.org/#/flycheck) [![MELPA stable version](http://stable.melpa.org/packages/flycheck-badge.svg)](https://stable.melpa.org/#/flycheck) [![NonGNU ELPA](https://elpa.nongnu.org/nongnu/flycheck.svg)](https://elpa.nongnu.org/nongnu/flycheck.html) [![CI](https://github.com/flycheck/flycheck/actions/workflows/test.yml/badge.svg)](https://github.com/flycheck/flycheck/actions/workflows/test.yml) [![Docs](https://github.com/flycheck/flycheck/actions/workflows/docs.yml/badge.svg)](https://github.com/flycheck/flycheck/actions/workflows/docs.yml) [![Lint Python](https://github.com/flycheck/flycheck/actions/workflows/lint-python.yml/badge.svg)](https://github.com/flycheck/flycheck/actions/workflows/lint-python.yml) Modern on-the-fly syntax checking extension for GNU Emacs. [Try it][]! ![](https://raw.githubusercontent.com/flycheck/flycheck/master/doc/images/flycheck-annotated.png) ## Getting Started Flycheck is available for installation with `package.el` on [NonGNU ELPA](https://elpa.nongnu.org/nongnu), [MELPA Stable](http://stable.melpa.org) and [MELPA](http://melpa.org). You can install Flycheck with the following command: M-x `package-install` [RET] `flycheck` [RET] Finally add this to your Emacs config: ```elisp (global-flycheck-mode +1) ``` Alternatively, if you're into `use-package` you can do the following: ``` emacs-lisp (use-package flycheck :ensure t :config (add-hook 'after-init-hook #'global-flycheck-mode)) ``` Now you can start using any of the [bundled checkers](https://www.flycheck.org/en/latest/languages.html) or install additional checkers. For a more gentle introduction read the [Installation][] instructions and go through [Quickstart][] guide. ## Getting Help Please ask questions about Flycheck on [Stack Exchange][sx] or in our [Gitter chat][gitter], and report bugs to our [issue tracker][]. ## Contributing We welcome all kinds of contributions, whether you write patches, open pull requests, write documentation, help others with Flycheck issues, or just tell other people about your experiences with Flycheck. Please take a look at our [Contributor’s Guide][contrib] for help and guidance about contributing to Flycheck. ## Sponsoring You can support financially the development of Flycheck and related packages via: - [Open Collective](https://opencollective.com/flycheck) - [GitHub Sponsors](https://github.com/sponsors/bbatsov) - [Patreon](https://www.patreon.com/bbatsov) - [PayPal](https://www.paypal.me/bbatsov) ### Open Collective Backers ### Open Collective Sponsors Become a sponsor and get your logo on our README on Github with a link to your site. [[Become a sponsor](https://opencollective.com/flycheck#sponsor)] ## Code of Conduct We strive to create a safe, friendly and welcoming environment in the Flycheck community and have a [Code of Conduct][coc] that defines acceptable and welcome behaviour as well as sanctions for violations. All contributors and all participants are expected to follow it, on Github, Gitter, Emacs.SX or any other place that’s part of Flycheck’s broader community. ## License Flycheck is free software: you can redistribute it and/or modify it under the terms of the [GNU General Public License][copying] as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. Flycheck is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the [GNU General Public License][copying] for more details. [COPYING]: https://github.com/flycheck/flycheck/blob/master/COPYING [logo]: https://raw.githubusercontent.com/flycheck/flycheck/master/doc/_static/logo.png [try it]: https://www.flycheck.org/en/latest/#try-out [Installation]: https://www.flycheck.org/en/latest/user/installation.html [Quickstart]: https://www.flycheck.org/en/latest/user/quickstart.html [sx]: https://emacs.stackexchange.com/questions/tagged/flycheck [gitter]: https://gitter.im/flycheck/flycheck [Issue Tracker]: https://github.com/flycheck/flycheck/issues [contrib]: https://www.flycheck.org/en/latest/contributor/contributing.html [coc]: https://www.flycheck.org/en/latest/community/conduct.html flycheck-35.0/doc/000077500000000000000000000000001500215546300137775ustar00rootroot00000000000000flycheck-35.0/doc/.gitignore000066400000000000000000000001421500215546300157640ustar00rootroot00000000000000# Sphinx build artifacts /_build/ # Python bytecode of the in-tree Sphinx extensions __pycache__/flycheck-35.0/doc/COPYING.cc-by-sa000066400000000000000000000472451500215546300164430ustar00rootroot00000000000000Attribution-ShareAlike 4.0 International ======================================================================= Creative Commons Corporation ("Creative Commons") is not a law firm and does not provide legal services or legal advice. Distribution of Creative Commons public licenses does not create a lawyer-client or other relationship. Creative Commons makes its licenses and related information available on an "as-is" basis. Creative Commons gives no warranties regarding its licenses, any material licensed under their terms and conditions, or any related information. Creative Commons disclaims all liability for damages resulting from their use to the fullest extent possible. Using Creative Commons Public Licenses Creative Commons public licenses provide a standard set of terms and conditions that creators and other rights holders may use to share original works of authorship and other material subject to copyright and certain other rights specified in the public license below. The following considerations are for informational purposes only, are not exhaustive, and do not form part of our licenses. Considerations for licensors: Our public licenses are intended for use by those authorized to give the public permission to use material in ways otherwise restricted by copyright and certain other rights. Our licenses are irrevocable. Licensors should read and understand the terms and conditions of the license they choose before applying it. Licensors should also secure all rights necessary before applying our licenses so that the public can reuse the material as expected. Licensors should clearly mark any material not subject to the license. This includes other CC- licensed material, or material used under an exception or limitation to copyright. More considerations for licensors: wiki.creativecommons.org/Considerations_for_licensors Considerations for the public: By using one of our public licenses, a licensor grants the public permission to use the licensed material under specified terms and conditions. If the licensor's permission is not necessary for any reason--for example, because of any applicable exception or limitation to copyright--then that use is not regulated by the license. Our licenses grant only permissions under copyright and certain other rights that a licensor has authority to grant. Use of the licensed material may still be restricted for other reasons, including because others have copyright or other rights in the material. A licensor may make special requests, such as asking that all changes be marked or described. Although not required by our licenses, you are encouraged to respect those requests where reasonable. More_considerations for the public: wiki.creativecommons.org/Considerations_for_licensees ======================================================================= Creative Commons Attribution-ShareAlike 4.0 International Public License By exercising the Licensed Rights (defined below), You accept and agree to be bound by the terms and conditions of this Creative Commons Attribution-ShareAlike 4.0 International Public License ("Public License"). To the extent this Public License may be interpreted as a contract, You are granted the Licensed Rights in consideration of Your acceptance of these terms and conditions, and the Licensor grants You such rights in consideration of benefits the Licensor receives from making the Licensed Material available under these terms and conditions. Section 1 -- Definitions. a. Adapted Material means material subject to Copyright and Similar Rights that is derived from or based upon the Licensed Material and in which the Licensed Material is translated, altered, arranged, transformed, or otherwise modified in a manner requiring permission under the Copyright and Similar Rights held by the Licensor. For purposes of this Public License, where the Licensed Material is a musical work, performance, or sound recording, Adapted Material is always produced where the Licensed Material is synched in timed relation with a moving image. b. Adapter's License means the license You apply to Your Copyright and Similar Rights in Your contributions to Adapted Material in accordance with the terms and conditions of this Public License. c. BY-SA Compatible License means a license listed at creativecommons.org/compatiblelicenses, approved by Creative Commons as essentially the equivalent of this Public License. d. Copyright and Similar Rights means copyright and/or similar rights closely related to copyright including, without limitation, performance, broadcast, sound recording, and Sui Generis Database Rights, without regard to how the rights are labeled or categorized. For purposes of this Public License, the rights specified in Section 2(b)(1)-(2) are not Copyright and Similar Rights. e. Effective Technological Measures means those measures that, in the absence of proper authority, may not be circumvented under laws fulfilling obligations under Article 11 of the WIPO Copyright Treaty adopted on December 20, 1996, and/or similar international agreements. f. Exceptions and Limitations means fair use, fair dealing, and/or any other exception or limitation to Copyright and Similar Rights that applies to Your use of the Licensed Material. g. License Elements means the license attributes listed in the name of a Creative Commons Public License. The License Elements of this Public License are Attribution and ShareAlike. h. Licensed Material means the artistic or literary work, database, or other material to which the Licensor applied this Public License. i. Licensed Rights means the rights granted to You subject to the terms and conditions of this Public License, which are limited to all Copyright and Similar Rights that apply to Your use of the Licensed Material and that the Licensor has authority to license. j. Licensor means the individual(s) or entity(ies) granting rights under this Public License. k. Share means to provide material to the public by any means or process that requires permission under the Licensed Rights, such as reproduction, public display, public performance, distribution, dissemination, communication, or importation, and to make material available to the public including in ways that members of the public may access the material from a place and at a time individually chosen by them. l. Sui Generis Database Rights means rights other than copyright resulting from Directive 96/9/EC of the European Parliament and of the Council of 11 March 1996 on the legal protection of databases, as amended and/or succeeded, as well as other essentially equivalent rights anywhere in the world. m. You means the individual or entity exercising the Licensed Rights under this Public License. Your has a corresponding meaning. Section 2 -- Scope. a. License grant. 1. Subject to the terms and conditions of this Public License, the Licensor hereby grants You a worldwide, royalty-free, non-sublicensable, non-exclusive, irrevocable license to exercise the Licensed Rights in the Licensed Material to: a. reproduce and Share the Licensed Material, in whole or in part; and b. produce, reproduce, and Share Adapted Material. 2. Exceptions and Limitations. For the avoidance of doubt, where Exceptions and Limitations apply to Your use, this Public License does not apply, and You do not need to comply with its terms and conditions. 3. Term. The term of this Public License is specified in Section 6(a). 4. Media and formats; technical modifications allowed. The Licensor authorizes You to exercise the Licensed Rights in all media and formats whether now known or hereafter created, and to make technical modifications necessary to do so. The Licensor waives and/or agrees not to assert any right or authority to forbid You from making technical modifications necessary to exercise the Licensed Rights, including technical modifications necessary to circumvent Effective Technological Measures. For purposes of this Public License, simply making modifications authorized by this Section 2(a) (4) never produces Adapted Material. 5. Downstream recipients. a. Offer from the Licensor -- Licensed Material. Every recipient of the Licensed Material automatically receives an offer from the Licensor to exercise the Licensed Rights under the terms and conditions of this Public License. b. Additional offer from the Licensor -- Adapted Material. Every recipient of Adapted Material from You automatically receives an offer from the Licensor to exercise the Licensed Rights in the Adapted Material under the conditions of the Adapter's License You apply. c. No downstream restrictions. You may not offer or impose any additional or different terms or conditions on, or apply any Effective Technological Measures to, the Licensed Material if doing so restricts exercise of the Licensed Rights by any recipient of the Licensed Material. 6. No endorsement. Nothing in this Public License constitutes or may be construed as permission to assert or imply that You are, or that Your use of the Licensed Material is, connected with, or sponsored, endorsed, or granted official status by, the Licensor or others designated to receive attribution as provided in Section 3(a)(1)(A)(i). b. Other rights. 1. Moral rights, such as the right of integrity, are not licensed under this Public License, nor are publicity, privacy, and/or other similar personality rights; however, to the extent possible, the Licensor waives and/or agrees not to assert any such rights held by the Licensor to the limited extent necessary to allow You to exercise the Licensed Rights, but not otherwise. 2. Patent and trademark rights are not licensed under this Public License. 3. To the extent possible, the Licensor waives any right to collect royalties from You for the exercise of the Licensed Rights, whether directly or through a collecting society under any voluntary or waivable statutory or compulsory licensing scheme. In all other cases the Licensor expressly reserves any right to collect such royalties. Section 3 -- License Conditions. Your exercise of the Licensed Rights is expressly made subject to the following conditions. a. Attribution. 1. If You Share the Licensed Material (including in modified form), You must: a. retain the following if it is supplied by the Licensor with the Licensed Material: i. identification of the creator(s) of the Licensed Material and any others designated to receive attribution, in any reasonable manner requested by the Licensor (including by pseudonym if designated); ii. a copyright notice; iii. a notice that refers to this Public License; iv. a notice that refers to the disclaimer of warranties; v. a URI or hyperlink to the Licensed Material to the extent reasonably practicable; b. indicate if You modified the Licensed Material and retain an indication of any previous modifications; and c. indicate the Licensed Material is licensed under this Public License, and include the text of, or the URI or hyperlink to, this Public License. 2. You may satisfy the conditions in Section 3(a)(1) in any reasonable manner based on the medium, means, and context in which You Share the Licensed Material. For example, it may be reasonable to satisfy the conditions by providing a URI or hyperlink to a resource that includes the required information. 3. If requested by the Licensor, You must remove any of the information required by Section 3(a)(1)(A) to the extent reasonably practicable. b. ShareAlike. In addition to the conditions in Section 3(a), if You Share Adapted Material You produce, the following conditions also apply. 1. The Adapter's License You apply must be a Creative Commons license with the same License Elements, this version or later, or a BY-SA Compatible License. 2. You must include the text of, or the URI or hyperlink to, the Adapter's License You apply. You may satisfy this condition in any reasonable manner based on the medium, means, and context in which You Share Adapted Material. 3. You may not offer or impose any additional or different terms or conditions on, or apply any Effective Technological Measures to, Adapted Material that restrict exercise of the rights granted under the Adapter's License You apply. Section 4 -- Sui Generis Database Rights. Where the Licensed Rights include Sui Generis Database Rights that apply to Your use of the Licensed Material: a. for the avoidance of doubt, Section 2(a)(1) grants You the right to extract, reuse, reproduce, and Share all or a substantial portion of the contents of the database; b. if You include all or a substantial portion of the database contents in a database in which You have Sui Generis Database Rights, then the database in which You have Sui Generis Database Rights (but not its individual contents) is Adapted Material, including for purposes of Section 3(b); and c. You must comply with the conditions in Section 3(a) if You Share all or a substantial portion of the contents of the database. For the avoidance of doubt, this Section 4 supplements and does not replace Your obligations under this Public License where the Licensed Rights include other Copyright and Similar Rights. Section 5 -- Disclaimer of Warranties and Limitation of Liability. a. UNLESS OTHERWISE SEPARATELY UNDERTAKEN BY THE LICENSOR, TO THE EXTENT POSSIBLE, THE LICENSOR OFFERS THE LICENSED MATERIAL AS-IS AND AS-AVAILABLE, AND MAKES NO REPRESENTATIONS OR WARRANTIES OF ANY KIND CONCERNING THE LICENSED MATERIAL, WHETHER EXPRESS, IMPLIED, STATUTORY, OR OTHER. THIS INCLUDES, WITHOUT LIMITATION, WARRANTIES OF TITLE, MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, NON-INFRINGEMENT, ABSENCE OF LATENT OR OTHER DEFECTS, ACCURACY, OR THE PRESENCE OR ABSENCE OF ERRORS, WHETHER OR NOT KNOWN OR DISCOVERABLE. WHERE DISCLAIMERS OF WARRANTIES ARE NOT ALLOWED IN FULL OR IN PART, THIS DISCLAIMER MAY NOT APPLY TO YOU. b. TO THE EXTENT POSSIBLE, IN NO EVENT WILL THE LICENSOR BE LIABLE TO YOU ON ANY LEGAL THEORY (INCLUDING, WITHOUT LIMITATION, NEGLIGENCE) OR OTHERWISE FOR ANY DIRECT, SPECIAL, INDIRECT, INCIDENTAL, CONSEQUENTIAL, PUNITIVE, EXEMPLARY, OR OTHER LOSSES, COSTS, EXPENSES, OR DAMAGES ARISING OUT OF THIS PUBLIC LICENSE OR USE OF THE LICENSED MATERIAL, EVEN IF THE LICENSOR HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH LOSSES, COSTS, EXPENSES, OR DAMAGES. WHERE A LIMITATION OF LIABILITY IS NOT ALLOWED IN FULL OR IN PART, THIS LIMITATION MAY NOT APPLY TO YOU. c. The disclaimer of warranties and limitation of liability provided above shall be interpreted in a manner that, to the extent possible, most closely approximates an absolute disclaimer and waiver of all liability. Section 6 -- Term and Termination. a. This Public License applies for the term of the Copyright and Similar Rights licensed here. However, if You fail to comply with this Public License, then Your rights under this Public License terminate automatically. b. Where Your right to use the Licensed Material has terminated under Section 6(a), it reinstates: 1. automatically as of the date the violation is cured, provided it is cured within 30 days of Your discovery of the violation; or 2. upon express reinstatement by the Licensor. For the avoidance of doubt, this Section 6(b) does not affect any right the Licensor may have to seek remedies for Your violations of this Public License. c. For the avoidance of doubt, the Licensor may also offer the Licensed Material under separate terms or conditions or stop distributing the Licensed Material at any time; however, doing so will not terminate this Public License. d. Sections 1, 5, 6, 7, and 8 survive termination of this Public License. Section 7 -- Other Terms and Conditions. a. The Licensor shall not be bound by any additional or different terms or conditions communicated by You unless expressly agreed. b. Any arrangements, understandings, or agreements regarding the Licensed Material not stated herein are separate from and independent of the terms and conditions of this Public License. Section 8 -- Interpretation. a. For the avoidance of doubt, this Public License does not, and shall not be interpreted to, reduce, limit, restrict, or impose conditions on any use of the Licensed Material that could lawfully be made without permission under this Public License. b. To the extent possible, if any provision of this Public License is deemed unenforceable, it shall be automatically reformed to the minimum extent necessary to make it enforceable. If the provision cannot be reformed, it shall be severed from this Public License without affecting the enforceability of the remaining terms and conditions. c. No term or condition of this Public License will be waived and no failure to comply consented to unless expressly agreed to by the Licensor. d. Nothing in this Public License constitutes or may be interpreted as a limitation upon, or waiver of, any privileges and immunities that apply to the Licensor or You, including from the legal processes of any jurisdiction or authority. ======================================================================= Creative Commons is not a party to its public licenses. Notwithstanding, Creative Commons may elect to apply one of its public licenses to material it publishes and in those instances will be considered the “Licensor.” The text of the Creative Commons public licenses is dedicated to the public domain under the CC0 Public Domain Dedication. Except for the limited purpose of indicating that material is shared under a Creative Commons public license or as otherwise permitted by the Creative Commons policies published at creativecommons.org/policies, Creative Commons does not authorize the use of the trademark "Creative Commons" or any other trademark or logo of Creative Commons without its prior written consent including, without limitation, in connection with any unauthorized modifications to any of its public licenses or any other arrangements, understandings, or agreements concerning use of licensed material. For the avoidance of doubt, this paragraph does not form part of the public licenses. Creative Commons may be contacted at creativecommons.org. flycheck-35.0/doc/Makefile000066400000000000000000000071451500215546300154460ustar00rootroot00000000000000# Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors # This file is not part of GNU Emacs. # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . PIP = pip3 SPHINXOPTS = -j4 SPHINXBUILD = sphinx-build SPHINXAUTOBUILD = sphinx-autobuild OPTIPNG = optipng BUILDDIR = _build # Whether to build offline HTML that loads no external resources, for use in 3rd # party packages, see https://github.com/flycheck/flycheck/issues/999 OFFLINE = ALLSPHINXOPTS = -d $(BUILDDIR)/doctrees $(SPHINXOPTS) . ifdef OFFLINE ALLSPHINXOPTS += -Dflycheck_offline_html=1 endif IMAGES = images/*.png .DEFAULT_GOAL := help HAVE_SPHINXBUILD := $(shell sh -c "command -v $(SPHINXBUILD)") ifndef HAVE_SPHINXBUILD $(warning "$(SPHINXBUILD) is not available. Please run make help.") endif HAVE_SPHINXAUTOBUILD := $(shell sh -c "command -v $(SPHINXAUTOBUILD)") HAVE_PIP := $(shell sh -c "command -v $(PIP)") .PHONY: help help: @echo 'Available targets:' @echo ' html: Build HTML documentation to $(BUILDDIR)/html' @echo ' html-auto: Like html, but automatically rebuild on changes' @echo ' linkcheck: Check all links and references' @echo ' clean: Remove generated documentation' @echo ' optimise-images: Optimise all images in the documentation' @echo '' @echo 'To build the documentation you need $(SPHINXBUILD).' @echo 'For *-auto targets you also need $(SPHINXAUTOBUILD).' @echo '' @echo 'Available make variables:' @echo ' OFFLINE: If set build HTML that loads no external resources' @echo '' @echo 'Available programs:' @echo ' $(SPHINXBUILD): $(if $(HAVE_SPHINXBUILD),yes,no)' @echo ' $(SPHINXAUTOBUILD): $(if $(HAVE_SPHINXAUTOBUILD),yes,no)' @echo '' @echo 'You need Python 3.4 or newer to install Sphinx for Flycheck.' @echo '' @echo 'Run make init to install all missing tools. It is recommended' @echo 'that you use virtualenv (https://virtualenv.pypa.io/en/latest/)' @echo 'to avoid a global installation of Python packages. make init' @echo 'will warn you if you do not.' .PHONY: init init: ifndef HAVE_PIP $(error "$(PIP) not available. Please run make help.") endif ifndef VIRTUAL_ENV $(warning "No virtualenv active. Installing Sphinx globally is not recommended.") ifndef FORCE $(error "Aborted. Run make FORCE=1 init to override or make help.") endif endif pip install -r requirements.txt .PHONY: clean clean: rm -rf $(BUILDDIR)/* # HTML and related formats .PHONY: html html: $(SPHINXBUILD) -b html $(ALLSPHINXOPTS) $(BUILDDIR)/html @echo @echo "Build finished. The HTML pages are in $(BUILDDIR)/html." .PHONY: html-auto html-auto: ifndef HAVE_SPHINXAUTOBUILD $(error "sphinx-autobuild not available. Run make help.") endif $(SPHINXAUTOBUILD) -b html $(ALLSPHINXOPTS) $(BUILDDIR)/html # House-keeping targets .PHONY: linkcheck linkcheck: $(SPHINXBUILD) -b linkcheck $(ALLSPHINXOPTS) $(BUILDDIR)/linkcheck @echo @echo "Link check complete; look for any errors in the above output " \ "or in $(BUILDDIR)/linkcheck/output.txt." .PHONY: optimise-images optimise-images: $(OPTIPNG) $(filter %.png,$(IMAGES)) flycheck-35.0/doc/_static/000077500000000000000000000000001500215546300154255ustar00rootroot00000000000000flycheck-35.0/doc/_static/favicon.ico000066400000000000000000000130761500215546300175550ustar00rootroot00000000000000@@((@vv $$$(((---000222333777888999???AAABBBEEEFFFHHHMMMPPPSSSWWW\\\]]]^^^___aaabbbdddeeemmmnnnpppqqqrrrsssvvvwwwxxx{{{<<??JJRRXXffttvvxxyyzz{{||~~Ϝǡ͝Λ̜ˣũĦǡ˜Λ͟ʞɦĬƥȞʹ]@6Nh#5@UswRixω}}BDq?`) 0pyy.1od8Ryy.S4.44t9^P :QI2 Lϳ.l? 4xknEʶ.l?YM%xcFϳy{.l?, uQVO\Ϩyz.l?u +v *TXA$CϞyy.l?KW& ug<&ϗyy. l? xRM bJ&ϐyy.77777=l?h6w !X-B)&ϋyy.l?>a'mD"&ςyy.l?;(3Z(([_/0eH(Gρyy.l?πyy.jjjjjjjqrj^?~yy.)1?|yy.)1?Ϲg]]]]]]]]]fh]]]]lflycheck-35.0/doc/_static/favicon.png000066400000000000000000000030121500215546300175540ustar00rootroot00000000000000PNG  IHDR@@sBITO pHYsvv}ՂtEXtSoftwarewww.inkscape.org<tEXtTitleFlycheck Logo2Y?tEXtAuthorSebastian WiesnerRtEXtCopyrightCC Attribution-ShareAlike http://creativecommons.org/licenses/by-sa/3.0/^ZpPLTE $$$(((---000222333777888999???AAABBBEEEFFFHHHMMMPPPSSSWWW\\\]]]^^^___aaabbbdddeeemmmnnnpppqqqrrrsssvvvwwwxxx{{{<J j@&TVbd03r.E 6`zeaX 109" I@ bS0$@@ ϫ1p XPlʪcA|tTq0p20 1Hxjb z_Aܐ ؼ`~b' U b乂 Հ``Ț@3x=x|`|7A*e Y["$-l4B2HJc2( Dg`DVTbd#Lt`z9|AAfJA`AX?s9ʃl۾kӞG_xzιg矚wrّ5ݾmφ}k-=1NnҴesNJe} &L6y֤=WkдmM}s'N?aֵGGQF 5`8?ǻ0ޘIENDB`flycheck-35.0/doc/_static/logo.png000066400000000000000000000111421500215546300170720ustar00rootroot00000000000000PNG  IHDRiSgAMA a cHRMz&u0`:pQ< oFFsWA?K pHYs  w5 vpAg  WbKGDtIDATx TTAVx,|!#4|/% S(ihxr$G|IE*Ij e&Bܽw.=ݙgwgGP(Կ,@ y@/$?_Wm)..!ݽ{w x[SSPy(+#zzJrrO+Cڲe doZ<)yhkU[AJPU< :R<47#ȃ0z4; FFH <&Mby@t_fay eay ,aaƌ!""Qmjmm즦&JVVVȃ6΃oYܿAybaBy v`!$y@t8v֯GvnE!={A7xeay \a)y6reeɓU_ijjzxa#Acy~:|駪U~@@`KJJ.Ԃe;;*x1H<'R"Pz]fnn.=x(00P Ə0`Cnӟ)0___z1ڵKÿkxHK{7-<ܻw@0Ӡ͛|ґ#Ghq!+ȃV}FffSZJJٳG ~ɓȃ@+vcҥ>TK***b{BWzG]< j*NIrww+Cy9=z\[0 =w?rÆ /端U<婲v#00QFqJL[[H$x >}<>}U<+#(k7`xI7:W\ꘘy tJ1z CTȃoB GOeeeJ1O>)7&A}sonnn\SyDxprσ<>ՑvҒ򭸸8ɨpMa<<<$%%q]qiW oɨ?hyy۔x뭷(K)%ش4aZ2nDMu2 v‚r'%tPCOyPΝ; S+++_2[;nooڍ P\ld@,)DII rY.5{]v]|YBWWWC5qDzS{ 5ykРAK6ݭ"v orO-dE:}4CJ4VXq}x]խXݟ@NXrrrڱc QOs8r<%uh&999գY_]c8.\ظq'vCC߹sk\zꫯ蕌c84'''?~<===??\?b9^c8b1bѝNɉ'pJ̎m#(9by@i )+**&L9P (ի6[[[gff޸q4'''44~0TAP=&WWWW oC/ԣG ԗ_~<^0"sP#ڶm0:uC/i>Y d\LI L׭2=8e 8.e7`Ci8!x/!Cd=4Çdb溕B潓r6VW//# Aܜ?NʘCʼnlB״?11SpQKEMZHk~$#Cr2E\ԩDQOJ$|%%ERW&=7ng玠QΖ|:zqB%-_NJy#((oAȈ6IZexIJ ХH] T%f(.s<<|WZ qQd#?1l7ܺFJcD$vecCΝf#t5Ajdd"s4p cmip` Xł c2na1kn*wBC#$^}^ R͌ttL%־}N@o`,6~C Xtl\P+\m %~ˬ/ro9E| :;;C"\T+%_vB(9-Fod#XƮzmck06V y@ y@J%Zrn]+7tEXtAuthorSebastian WiesnerRtEXtCopyrightCC Attribution-ShareAlike http://creativecommons.org/licenses/by-sa/3.0/^Z%tEXtdate:create2014-06-06T14:52:59+02:00ڛ%tEXtdate:modify2014-06-06T14:52:59+02:00ƭb'tEXtSoftwarewww.inkscape.org<tEXtTitleFlycheck Logo2Y?IENDB`flycheck-35.0/doc/_templates/000077500000000000000000000000001500215546300161345ustar00rootroot00000000000000flycheck-35.0/doc/_templates/about.html000066400000000000000000000030141500215546300201320ustar00rootroot00000000000000{% if theme_logo %}

{{ project }}

{% endif %}

{% else %}

{{ project }}

{% endif %} {% if theme_description %}

{{ theme_description }}

{% endif %} {% macro badge(badge, href) -%}

{%- endmacro %} {% if theme_github_user and theme_github_repo and not flycheck_offline_html %} {% if theme_github_button|lower == 'true' %}

{% endif %} {% endif %} {% if not flycheck_offline_html %}

MELPA Stable

MELPA

{% endif %} flycheck-35.0/doc/_templates/layout.html000066400000000000000000000013121500215546300203340ustar00rootroot00000000000000{% extends "!layout.html" %} {% block extrahead %} {% endblock %} flycheck-35.0/doc/_templates/tables.html000066400000000000000000000003331500215546300202730ustar00rootroot00000000000000

Tables

flycheck-35.0/doc/changes.rst000066400000000000000000000000721500215546300161400ustar00rootroot00000000000000========= Changes ========= .. include:: ../CHANGES.rst flycheck-35.0/doc/community/000077500000000000000000000000001500215546300160235ustar00rootroot00000000000000flycheck-35.0/doc/community/conduct.rst000066400000000000000000000113721500215546300202200ustar00rootroot00000000000000.. _flycheck-conduct: ========================== Flycheck Code of Conduct ========================== Our Code of Conduct defines the social norms and policies within Flycheck’s community. Whenever you interact with Flycheck or Flycheck developers, whether in our official channels or privately, you’re expected to follow this Code of Conduct. Conduct ======= **Contact**: :ref:`Any moderator ` * We are committed to providing a friendly, safe and welcoming environment for all, regardless of level of experience, gender, gender identity and expression, sexual orientation, disability, personal appearance, body size, race, ethnicity, age, religion, nationality, or similar personal characteristic. * Please avoid using overtly sexual nicknames or other nicknames that might detract from a friendly, safe and welcoming environment for all. * Please be kind and courteous. There's no need to be mean or rude. * Please do not curse or use bad words. Foul language will not help us to build a great product. * Respect that people have differences of opinion and that every design or implementation choice carries a trade-off and numerous costs. There is seldom a right answer. * Please keep unstructured critique to a minimum. If you have solid ideas you want to experiment with, make a fork and see how it works. * We will exclude you from interaction if you insult, demean or harass anyone. That is not welcome behaviour. We interpret the term "harassment" as including the definition in the `Citizen Code of Conduct`_; if you have any lack of clarity about what might be included in that concept, please read their definition. In particular, we don't tolerate behavior that excludes people in socially marginalized groups. * Private harassment is also unacceptable. No matter who you are, if you feel you have been or are being harassed or made uncomfortable by a community member, please contact a :ref:`moderator ` immediately. Whether you're a regular contributor or a newcomer, we care about making this community a safe place for you and we've got your back. * Likewise any spamming, trolling, flaming, baiting or other attention-stealing behaviour is not welcome. .. _Citizen Code of Conduct: http://citizencodeofconduct.org/ Moderation ========== These are the policies for upholding our community's standards of conduct in our communication channels, most notably in Flycheck’s Github organisation and in Flycheck’s Gitter channels. 1. Remarks that violate the Flycheck code of conduct, including hateful, hurtful, oppressive, or exclusionary remarks, are not allowed. 2. Remarks that moderators find inappropriate, whether listed in the code of conduct or not, are also not allowed. 3. Moderators will first respond to such remarks with a warning. 4. If the warning is unheeded, the user will be "kicked," i.e., kicked out of the communication channel to cool off. 5. If the user comes back and continues to make trouble, they will be banned, i.e., indefinitely excluded. 6. Moderators may choose at their discretion to un-ban the user if it was a first offense and they offer the offended party a genuine apology. 7. If a moderator bans someone and you think it was unjustified, please take it up with that moderator, or with a different moderator, **in private**. Complaints about bans in-channel are not allowed. 8. Moderators are held to a higher standard than other community members. If a moderator creates an inappropriate situation, they should expect less leeway than others. In the Flycheck community we strive to go the extra step to look out for each other. Don't just aim to be technically unimpeachable, try to be your best self. In particular, avoid flirting with offensive or sensitive issues, particularly if they're off-topic; this all too often leads to unnecessary fights, hurt feelings, and damaged trust; worse, it can drive people away from the community entirely. And if someone takes issue with something you said or did, resist the urge to be defensive. Just stop doing what it was they complained about and apologize. Even if you feel you were misinterpreted or unfairly accused, chances are good there was something you could have communicated better — remember that it's your responsibility to make your fellow Flycheck people comfortable. Everyone wants to get along and we are all here first and foremost because we want to talk about cool technology. You will find that people will be eager to assume good intent and forgive as long as you earn their trust. --- Adapted from the `Rust Code of Conduct`_. | Copyright (c) 2015 Sebastian Wiesner and Flycheck contributors | Copyright (c) 2014 The Rust Project Developers .. _Rust Code of Conduct: https://www.rust-lang.org/conduct.html flycheck-35.0/doc/community/extensions.rst000066400000000000000000000132211500215546300207530ustar00rootroot00000000000000.. _flycheck-extensions: ======================== Recommended extensions ======================== The Emacs community has produced a number of extensions to Flycheck. This page lists all that we know of and can safely recommend to our users. *Official* extensions are (co-)maintained by the :ref:`Flycheck maintainers ` who will take care to update official extensions in case of breaking changes in Flycheck and work to provide extra API for extensions if needed. If you'd like to make your extension an *official* one and move it into the `Flycheck Github organisation`_ please contact a :ref:`maintainer `. If you do know extensions not in this list, or would like to see your own extension here, please feel free to `add it`_. We would like to thank all people who created and contributed to Flycheck extensions for their awesome work. Without your help and support Flycheck would not be what it is today. .. _add it: https://github.com/flycheck/flycheck/edit/master/doc/community/extensions.rst .. _Flycheck Github organisation: https://github.com/flycheck User interface ============== These extensions change Flycheck’s user interface: * :flyc:`flycheck-color-mode-line` (*official*) colors the mode line according to the Flycheck status. * :flyc:`flycheck-pos-tip` (*official*) shows Flycheck error messages in a graphical popup. * :gh:`liblit/flycheck-status-emoji` adds cute emoji (e.g. 😱 for errors) to Flycheck’s mode line status. * :gh:`Wilfred/flycheck-title` shows Flycheck error messages in the frame title. * :flyc:`flycheck-inline` shows Flycheck error messages in the buffer, directly below their origin. Language support ================ These extensions add support for new languages, or improve support for built-in languages. They are grouped by the corresponding language so you can jump directly to the languages that interest you: .. contents:: Languages :local: Cadence ------- * :gh:`cmarqu/flycheck-hdl-irun` adds a syntax checker for hardware description languages supported by `Cadence IES/irun`_. .. _Cadence IES/irun: https://www.cadence.com/content/cadence-www/global/en_US/home/tools/system-design-and-verification/simulation-and-testbench-verification/incisive-enterprise-simulator.html Clojure ------- * :gh:`borkdude/flycheck-clj-kondo` adds a Flycheck checker using ``clj-kondo``. * :gh:`clojure-emacs/squiggly-clojure` adds syntax checking for Clojure. C/C++/Objective C ----------------- * :gh:`Wilfred/flycheck-pkg-config` configures Flycheck to use settings from `pkg-config`_ when checking C/C++. * :gh:`Sarcasm/flycheck-irony` adds a Flycheck syntax checker for C, C++ and Objective C using :gh:`Irony Mode `. .. _pkg-config: https://www.freedesktop.org/wiki/Software/pkg-config/ D - * :flyc:`flycheck-d-unittest` (*official*) adds a Flycheck checker to run unit tests for D programs on the fly. Deno ---- * :flyc:`flycheck-deno` (*official*) makes linting for Deno_ project available via deno-lint_. .. _Deno: https://deno.land/ .. _deno-lint: https://deno.land/manual@v1.15.2/tools/linter Elixir ------ * :gh:`tomekowal/flycheck-mix` adds an Elixir syntax checker using the ``mix`` build tool. Emacs Lisp ---------- * :flyc:`flycheck-cask` (*official*) makes Flycheck use Cask packages for Emacs Lisp syntax checking in Cask_ projects. * :flyc:`flycheck-eask` (*official*) makes Flycheck use Eask packages for Emacs Lisp syntax checking in Eask_ projects. (Similar to Cask) * :gh:`purcell/flycheck-package` checks Emacs Lisp packages for common problems with package metadata. .. _Cask: https://github.com/cask/cask .. _Eask: https://github.com/emacs-eask/cli Julia ----- * :gh:`gdkrmr/flycheck-julia` makes linting for Julia_ available via Lint.jl_. .. _Julia: https://julialang.org .. _Lint.jl: https://lintjl.readthedocs.io/en/stable/ Haskell ------- * :flyc:`flycheck-haskell` (*official*) configures Flycheck from the Cabal settings and sandbox in Haskell projects. Kotlin ------ * :gh:`whirm/flycheck-kotlin` adds a Kotlin_ syntax checker using ktlint_. .. _Kotlin: https://kotlinlang.org/ .. _ktlint: https://pinterest.github.io/ktlint/ Ledger ------ * :gh:`purcell/flycheck-ledger` adds a syntax checker for the Ledger_ accounting tool. .. _Ledger: https://ledger-cli.org/ Mercury ------- * :flyc:`flycheck-mercury` (*official*) adds a syntax checker for the Mercury_ language. .. _Mercury: http://mercurylang.org/ OCaml ----- * :flyc:`flycheck-ocaml` (*official*) adds a syntax checker for OCaml using the :gh:`Merlin ` backend. PHP --- * :gh:`emacs-php/phpstan.el` adds a PHP static analyzer using PHPStan_. * :gh:`emacs-php/psalm.el` adds a PHP static analyzer using Psalm_. .. _PHPStan: https://phpstan.org/ .. _Psalm: https://psalm.dev/ Python ------ * :gh:`Wilfred/flycheck-pyflakes` adds a Python syntax checker using Pyflakes_. * :gh:`msherry/flycheck-pycheckers` adds a checker for Python that can run multiple syntax checkers simultaneously (Pyflakes_, PEP8, Mypy_ 2/3, etc.). * :gh:`chocoelho/flycheck-prospector` adds Prospector_ checker for Python syntax. .. _Pyflakes: https://github.com/PyCQA/pyflakes .. _Prospector: https://github.com/PyCQA/prospector .. _Mypy: http://mypy-lang.org/ Rust ---- * :flyc:`flycheck-rust` (*official*) configures Flycheck according to the Cargo settings and layouts of the current Rust project. Shell scripts ------------- * :gh:`cuonglm/flycheck-checkbashisms` adds a shell script syntax checker using ``checkbashisms`` which is part of `Debian devscripts`_ and checks for common Bash constructs in POSIX shell scripts. .. _Debian devscripts: https://salsa.debian.org/debian/devscripts flycheck-35.0/doc/community/get-help.rst000066400000000000000000000011471500215546300202650ustar00rootroot00000000000000.. _flycheck-get-help: ========== Get help ========== Please ask questions about Flycheck on `Stack Exchange`_ or in our `Gitter chat`_. We try to answer all questions as fast and as precise as possible. To report bugs and problems please please use our :flyc:`issue tracker `. Please note that we have a special policy for :ref:`Windows-only issues `. Please follow our :ref:`Code of Conduct ` in all these places. .. _Stack Exchange: https://emacs.stackexchange.com/questions/tagged/flycheck .. _Gitter chat: https://gitter.im/flycheck/flycheck flycheck-35.0/doc/community/people.rst000066400000000000000000000202741500215546300200460ustar00rootroot00000000000000======== People ======== .. _flycheck-teams: Teams ===== .. _flycheck-maintainers: Maintainers ----------- - **Bozhidar Batsov** (:gh:`bbatsov`, owner) - **Clément Pit-Claudel** (:gh:`cpitclaudel`, owner) - **fmdkdd** (:gh:`fmdkdd`, owner) We maintain Flycheck and all official extensions within the `Flycheck organisation`_, and set the direction and scope of Flycheck. We review and accept pull requests and feature proposals and fix bugs in Flycheck. Emphasized users are also owners of the `Flycheck Organisation`_, and thus have administrative privileges for all repositories in Flycheck. Notably only owners can currently make Flycheck releases, and their GPG keys sign release tags for Flycheck. Mention with ``@flycheck/maintainers``. .. _Flycheck Organisation: https://github.com/flycheck .. _flycheck-moderators: Moderators ---------- Our moderators help uphold our :doc:`conduct`. Currently, we do not have a dedicated moderation team; all our :ref:`flycheck-maintainers` also serve as moderators in our Github organisation and in our official communication channels. Mention with ``@flycheck/moderators``. .. note:: If you’d like to help out with moderation, please contact a maintainer. .. _flycheck-language-teams: Language teams -------------- These teams provide support for particular languages in Flycheck. Elixir ~~~~~~ * Aaron Jensen (:gh:`aaronjensen`) * Kári Tristan Helgason (:gh:`kthelgason`) Mention with ``@flycheck/elixir``. Go ~~ * Dominik Honnef (:gh:`dominikh`) Mention with ``@flycheck/go``. Haskell ~~~~~~~ * Sergey Vinokurov (:gh:`sergv`) * Steve Purcell (:gh:`purcell`) Mention with ``@flycheck/haskell``. Javascript ~~~~~~~~~~ * Saša Jovanić (:gh:`Simplify`) Mention with ``@flycheck/javascript``. Lua ~~~ * Gordon Gao (:gh:`ghprince`) Mention with ``@flycheck/lua``. Mercury ~~~~~~~ * Matthias Güdemann (:gh:`mgudemann`) Mention with ``@flycheck/mercury``. PHP ~~~ * USAMI Kenta (:gh:`zonuexe`) Mention with ``@flycheck/php``. Puppet ~~~~~~ * Romanos Skiadas (:gh:`rski`) Mention with ``@flycheck/puppet``. Ruby ~~~~ * Saša Jovanić (:gh:`Simplify`) Mention with ``@flycheck/ruby``. Rust ~~~~ * :gh:`fmdkdd` * Michael Pankov (:gh:`mkpankov`) Mention with ``@flycheck/rust``. TypeScript ~~~~~~~~~~ * Saša Jovanić (:gh:`Simplify`) Mention with ``@flycheck/typescript``. Packagers ========= We would like to thank all people who package Flycheck on behalf of distributions and support our development efforts with their feedback, their patches and their testing: * Sean Whitton (:gh:`spwhitton`) and the `Debian Emacs addon team`_ (Debian packages) .. _Debian Emacs addon team: https://pkg-emacsen.alioth.debian.org/ Acknowledgments ================ We would also like to thank the following people and projects: * Sebastian Wiesner (:gh:`swsnr`) for creating Flycheck in the first place, for taking the time and dedication to maintain it for over 4 years, while maintaining high standards of code quality and nurturing a healthy, active community around it, giving Flycheck the best chances to thrive after his departure. * Bozhidar Batsov (:gh:`bbatsov`) for his valuable feedback and his constant support and endorsement of Flycheck from the very beginning. Notably he added Flycheck to his popular :gh:`Prelude ` project at a very early stage and thus brought Flycheck to many new users. * Magnar Sveen (:gh:`magnars`) for his :gh:`dash.el ` and :gh:`s.el ` libraries, which support considerable parts of Flycheck internals, and greatly helped to overcome Sebastian’s initial aversion to Emacs Lisp. * Martin Grenfell (:gh:`scrooloose`) for the Vim syntax checking extension :gh:`Syntastic ` which saved Sebastian’s life back when he was using Vim, and served as inspiration for Flycheck and many of its syntax checkers. * Matthias Güdemann (:gh:`mgudemann`), for his invaluable work on Flycheck’s logo. * Pavel Kobyakov for his work on GNU Flymake, which is a great work on its own, despite its flaws and weaknesses. * Simon Carter (:gh:`bbbscarter`), for his patient in-depth testing of automatic syntax checking, and his very constructive feedback. * Steve Purcell (:gh:`purcell`) for his valuable feedback, the fruitful discussions and his important ideas about the shape and design of Flycheck, and his indispensable and dedicated work on MELPA, which drives the continuous distribution of Flycheck to its users. Contributors ============ The following people—listed in alphabetical order—contributed substantial code to Flycheck: * Aaron Jensen (:gh:`aaronjensen`) * Alain Kalker (:gh:`ackalker`) * Alex Reed (:gh:`acr4`) * Atila Neves (:gh:`atilaneves`) * Ben Sless (:gh:`bsless`) * Bozhidar Batsov (:gh:`bbatsov`) * Clément Pit-Claudel (:gh:`cpitclaudel`, maintainer, owner) * Colin Marquardt (:gh:`cmarqu`) * Cristian Capdevila (:gh:`capdevc`) * Damon Haley (:gh:`dhaley`) * David Caldwell (:gh:`caldwell`) * David Holm (:gh:`dholm`) * DEADB17 (:gh:`DEADB17`) * Deokhwan Kim (:gh:`dkim`) * Derek Chen-Becker (:gh:`dchenbecker`) * Derek Harland (:gh:`donkopotamus`) * Dominik Honnef (:gh:`dominikh`) * Doug MacEachern (:gh:`dougm`) * Drew Wells (:gh:`drewwells`) * Erik Hetzner (:gh:`egh`) * Fanael Linithien (:gh:`Fanael`) * :gh:`fmdkdd` (maintainer, owner) * Fred Morcos (:gh:`fredmorcos`) * Gereon Frey (:gh:`gfrey`) * Gordon Gao (:gh:`ghprince`) * Guido Kraemer (:gh:`gdkrmr`) * Gulshan Singh (:gh:`gsingh93`) * Iain Beeston (:gh:`iainbeeston`) * Ibrahim Awwal (:gh:`ibrahima`) * Jackson Ray Hamilton (:gh:`jacksonrayhamilton`) * Jim Hester (:gh:`jimhester`) * Jimmy Yuen Ho Wong (:gh:`wyuenho`) * Joe DeVivo (:gh:`joedevivo`) * John Shahid (:gh:`jvshahid`) * Juergen Hoetzel (:gh:`juergenhoetzel`) * Kári Tristan Helgason (:gh:`kthelgason`) * Krzysztof Witkowski (:gh:`kwitek`) * Lee Adams (:gh:`leeaustinadams`) * Loïc Damien (:gh:`dzamlo`) * Lorenzo Villani (:gh:`lvillani`) * Łukasz Jędrzejewski (:gh:`jedrz`) * Magnar Sveen (:gh:`magnars`) * Malyshev Artem (:gh:`proofit404`) * Manuel Uberti (:gh:`manuel-uberti`) * Marc Sherry (:gh:`msherry`) * Marcin Antczak (:gh:`marcinant`) * Marcus Majewski (:gh:`hekto`) * Marian Schubert (:gh:`maio`) * Mario Rodas (:gh:`marsam`) * Mark Laws (:gh:`drvink`) * Mark Hellewell (:gh:`markhellewell`) * Mark Karpov (:gh:`mrkkrp`) * Martin Polden (:gh:`mpolden`) * mats cronqvist (:gh:`massemanet`) * Matthew Curry (:gh:`strawhatguy`) * Matthias Dahl (:gh:`BinaryKhaos`) * Michael Pankov (:gh:`mkpankov`) * Michael Alan Dorman (:gh:`mdorman`) * Miles Yucht (:gh:`mgyucht`) * Miro Bezjak (:gh:`mbezjak`) * Mitch Tishmack (:gh:`mitchty`) * Moritz Bunkus (:gh:`mbunkus`) * Omair Majid (:gh:`omajid`) * :gh:`papaeye` * Per Nordlöw (:gh:`nordlow`) * Peter Eisentraut (:gh:`petere`) * Peter Hoeg (:gh:`peterhoeg`) * Peter Oliver (:gh:`mavit`) * Peter Vasil (:gh:`ptrv`) * Philipp Stephani (:gh:`phst`) * Robert Dallas Gray (:gh:`rdallasgray`) * Robert O'Connor (:gh:`robbyoconnor`) * Robert Zaremba (:gh:`robert-zaremba`) * Romano Skiadas (:gh:`rski`) * Saša Jovanić (:gh:`Simplify`) * Sean Gillespie (:gh:`swgillespie`) * Sean Salmon (:gh:`phatcabbage`) * Sean Whitton (:gh:`spwhitton`) * Sebastian Beyer (:gh:`sebastianbeyer`) * Sebastian Wiesner (:gh:`swsnr`, founder, former maintainer, former owner) * Sebastian Schlueppel (:gh:`s3bs`) * Sergey Vinokurov (:gh:`sergv`) * Stephen Lewis (:gh:`stephenjlewis`) * Steve Purcell (:gh:`purcell`) * Sven Keidel (:gh:`svenkeidel`) * Sylvain Benner (:gh:`syl20bnr`) * Sylvain Rousseau (:gh:`thisirs`) * Syohei Yoshida (:gh:`syohex`) * Ted Zlatanov (:gh:`tzz`) * Tom Jakubowski (:gh:`tomjakubowski`) * Tom Willemse (:gh:`ryuslash`) * Tomoya Tanjo (:gh:`tom-tan`) * Troy Hinckley (:gh:`CeleritasCelery`) * Usami Kenta (:gh:`zonuexe`) * Victor Deryagin (:gh:`vderyagin`) * Ville Skyttä (:gh:`scop`) * Vlatko Basic (:gh:`vlatkoB`) * Wieland Hoffmann (:gh:`mineo`) * Wilfred Hughes (:gh:`Wilfred`) * William Cummings (:gh:`wcummings`) * William Xu (:gh:`xwl`) * Yannick Roehlly (:gh:`yannick1974`) * Yasuyuki Oka (:gh:`yasuyk`) * Zhuo Yuan (:gh:`yzprofile`) For a complete list of all code contributors see the `Contributor Graph`_ or ``git shortlog --summary``. .. _Contributor Graph: https://github.com/flycheck/flycheck/graphs/contributors flycheck-35.0/doc/conf.py000066400000000000000000000234031500215546300153000ustar00rootroot00000000000000# Copyright (C) 2017, 2018 Flycheck contributors # Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors # This file is not part of GNU Emacs. # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . import re import sys import os from pathlib import Path from docutils import nodes from docutils.statemachine import ViewList from docutils.transforms import Transform from docutils.parsers.rst import Directive, directives from sphinx import addnodes from sphinx.util.nodes import set_source_info, process_index_entry from sphinx.util import logging logger = logging.getLogger(__name__) sys.path.append(str(Path(__file__).parent)) ON_RTD = os.environ.get('READTHEDOCS', None) == 'True' needs_sphinx = '1.3' extensions = [ 'sphinx.ext.intersphinx', 'sphinx.ext.extlinks', 'sphinx.ext.todo', # Domain for Emacs Lisp 'elisp', # Cross-references to info nodes 'info' ] # Project metadata project = 'Flycheck' copyright = ' 2014-2025, Sebastian Wiesner and Flycheck contributors' author = 'Sebastian Wiesner' def read_version(): """Extract version number from ``flycheck.el`` and return it as string.""" version_pattern = re.compile(r'^;;\s*Version:\s+(\d.+)$', re.MULTILINE) flycheck = Path(__file__).resolve().parent.parent.joinpath('flycheck.el') with flycheck.open(encoding='utf-8') as source: match = version_pattern.search(source.read()) if match: return match.group(1) else: raise ValueError('Failed to parse Flycheck version from ' 'Version: of flycheck.el') def read_minimum_emacs_version(): """Extract minimum Emacs version from ``flycheck.el``.""" version_pattern = re.compile( r'^;; Package-Requires:.*\(emacs\s*"([^"]+)"\).*$', re.MULTILINE) flycheck = Path(__file__).resolve().parent.parent.joinpath('flycheck.el') with flycheck.open(encoding='utf-8') as source: match = version_pattern.search(source.read()) if match: return match.group(1) else: raise ValueError('Vailed to parse minimum Emacs version from ' 'Package-Requires of flycheck.el!') release = read_version() version = '.'.join(release.split('.')[:2]) # Source settings source_suffix = '.rst' master_doc = 'index' rst_prolog = """\ .. role:: elisp(code) :language: elisp .. |min-emacs| replace:: {emacs_version}+ """.format(emacs_version=read_minimum_emacs_version()) # Build settings exclude_patterns = ['_build'] default_role = 'any' primary_domain = 'el' templates_path = ['_templates'] # The name of the Pygments (syntax highlighting) style to use. pygments_style = 'sphinx' # Warn about all undefined references, but exclude references to built-in # symbols which we don't document here. # TODO: Resolve built-in symbols to the Emacs Lisp references? nitpicky = True nitpick_ignore = [ ('any', 'default-directory'), ('any', 'package-initialize'), ('any', 'package-archives'), ('any', 'user-init-file'), ('any', 'user-emacs-directory'), ('any', 'check-declare-file'), ('any', 'declare-function'), ('any', 'exec-path'), ('any', 'sh-shell'), ('any', 'rx'), ] # HTML settings html_theme = 'alabaster' html_theme_options = { 'logo': 'logo.png', 'logo_name': False, 'description': 'Syntax checking for GNU Emacs', 'github_user': 'flycheck', 'github_repo': 'flycheck', 'github_type': 'star', 'github_banner': True, 'travis_button': False, } html_sidebars = { '**': [ 'about.html', 'tables.html', 'navigation.html', 'relations.html', 'searchbox.html', ] } html_static_path = ['_static'] html_favicon = '_static/favicon.ico' # Ignore localhost when checking links linkcheck_ignore = [r'http://localhost:\d+/?'] # Cross-reference remote Sphinx sites intersphinx_mapping = { 'python': ('https://docs.python.org/3.5', None) } extlinks = { 'gh': ('https://github.com/%s', None), 'flyc': ('https://github.com/flycheck/%s', None) } # While still have work to do :) # FIXME: Remove when the old Texinfo manual is completed ported todo_include_todos = True class SupportedLanguage(Directive): required_arguments = 1 final_argument_whitespace = True has_content = True option_spec = { 'index_as': directives.unchanged } def run(self): language = self.arguments[0] indexed_languages = self.options.get('index_as') or language index_specs = ['pair: {}; language'.format(lang) for lang in indexed_languages.splitlines()] name = nodes.fully_normalize_name(language) target = 'language-{}'.format(name) targetnode = nodes.target('', '', ids=[target]) self.state.document.note_explicit_target(targetnode) indexnode = addnodes.index() indexnode['entries'] = [] indexnode['inline'] = False set_source_info(self, indexnode) for spec in index_specs: indexnode['entries'].extend(process_index_entry(spec, target)) sectionnode = nodes.section() sectionnode['names'].append(name) title, messages = self.state.inline_text(language, self.lineno) titlenode = nodes.title(language, '', *title) sectionnode += titlenode sectionnode += messages self.state.document.note_implicit_target(sectionnode, sectionnode) self.state.nested_parse(self.content, self.content_offset, sectionnode) return [indexnode, targetnode, sectionnode] class SyntaxCheckerConfigurationFile(Directive): required_arguments = 1 final_argument_whitespace = True def run(self): option = self.arguments[0] wrapper = nodes.paragraph() docname = self.state.document.settings.env.docname template = ViewList("""\ .. index:: single: Configuration file; {0} .. el:defcustom:: {0} Configuration file for this syntax checker. See :ref:`flycheck-checker-config-files`. """.format(option).splitlines(), docname) self.state.nested_parse(template, self.content_offset, wrapper) return wrapper.children.copy() class IssueReferences(Transform): ISSUE_PATTERN = re.compile(r'\[(?:GH-|#)(\d+)\]') ISSUE_URL_TEMPLATE = 'https://github.com/flycheck/flycheck/issues/{}' default_priority = 999 def apply(self): docname = self.document.settings.env.docname if docname != 'changes': # Only transform issue references in changelo return for node in self.document.traverse(nodes.Text): parent = node.parent new_nodes = [] last_issue_ref_end = 0 text = str(node) for match in self.ISSUE_PATTERN.finditer(text): # Extract the text between the last issue reference and the # current issue reference and put it into a new text node head = text[last_issue_ref_end:match.start()] if head: new_nodes.append(nodes.Text(head)) # Adjust the position of the last issue reference in the # text last_issue_ref_end = match.end() # Extract the issue text and the issue number issuetext = match.group(0) issue_id = match.group(1) # Turn the issue into a proper reference refnode = nodes.reference() refnode['refuri'] = self.ISSUE_URL_TEMPLATE.format(issue_id) refnode.append(nodes.inline( issuetext, issuetext, classes=['xref', 'issue'])) new_nodes.append(refnode) # No issue references were found, move on to the next node if not new_nodes: continue # Extract the remaining text after the last issue reference tail = text[last_issue_ref_end:] if tail: new_nodes.append(nodes.Text(tail)) parent.replace(node, new_nodes) def build_offline_html(app): from sphinx.builders.html import StandaloneHTMLBuilder build_standalone = isinstance(app.builder, StandaloneHTMLBuilder) if app.config.flycheck_offline_html and build_standalone: logger.info( 'Building offline documentation without external resources!') app.builder.theme_options['github_banner'] = 'false' app.builder.theme_options['github_button'] = 'false' def add_offline_to_context(app, _pagename, _templatename, context, _doctree): # Expose offline setting in HTML context context['flycheck_offline_html'] = app.config.flycheck_offline_html def setup(app): app.add_object_type('syntax-checker', 'checker', 'pair: %s; Syntax checker') app.add_directive('supported-language', SupportedLanguage) app.add_directive('syntax-checker-config-file', SyntaxCheckerConfigurationFile) app.add_transform(IssueReferences) # Build offline HTML that loads no external resources, for use in 3rd party # packages, see https://github.com/flycheck/flycheck/issues/999 app.add_config_value('flycheck_offline_html', False, 'html') app.connect('builder-inited', build_offline_html) app.connect('html-page-context', add_offline_to_context) flycheck-35.0/doc/contributor/000077500000000000000000000000001500215546300163515ustar00rootroot00000000000000flycheck-35.0/doc/contributor/contributing.rst000066400000000000000000000274271500215546300216260ustar00rootroot00000000000000.. _flycheck-contributors-guide: ===================== Contributor’s Guide ===================== Thank you very much for your interest in contributing to Flycheck! We’d like to warmly welcome you in the Flycheck community, and hope that you enjoy your time with us! There are many ways to contribute to Flycheck, and we appreciate all of them. We hope that this document helps you to contribute. If you have questions, please ask on our `issue tracker`_ or in our `Gitter chatroom`_. For a gentle start please take a look at all the things we `need your help with`_ and look for `beginner-friendly tasks`_. Please note that all contributors are expected to follow our :ref:`Code of Conduct `. .. _issue tracker: https://github.com/flycheck/flycheck/issues .. _Gitter chatroom: https://gitter.im/flycheck/flycheck .. _need your help with: https://github.com/flycheck/flycheck/issues?q=is%3Aissue+is%3Aopen+label%3A%22needs+help%22 .. _beginner-friendly tasks: https://github.com/flycheck/flycheck/labels/beginner%20friendly .. _flycheck-bug-reports: Bug reports =========== Bugs are a sad reality in software, but we strive to have as few as possible in Flycheck. Please liberally report any bugs you find. If you are not sure whether something is a bug or not, please report anyway. If you have the chance and time please `search existing issues`_, as it’s possible that someone else already reported your issue. Of course, this doesn’t always work, and sometimes it’s very hard to know what to search for, so this is absolutely optional. We definitely don’t mind duplicates, please report liberally. To open an issue simply fill out the `issue form`_. To help us fix the issue, include as much information as possible. When in doubt, better include too much than too little. Here’s a list of facts that are important: * What you did, and what you expected to happen instead * Whether and how you were able to `reproduce the issue in emacs -Q`_ * Your Flycheck setup from ``M-x flycheck-verify-setup`` .. _search existing issues: https://github.com/flycheck/flycheck/issues?q=is%3Aissue .. _issue form: https://github.com/flycheck/flycheck/issues/new .. _reproduce the issue in emacs -Q: https://emacs.stackexchange.com/questions/28429/how-do-i-troubleshoot-emacs-problems .. _flycheck-windows-issues: Windows-only issues ------------------- As Flycheck does not support Windows officially we generally do *not* attempt to fix issues that only occur on Windows. We will move all Windows-only issues to the `list of open Windows issues`_, and leave them to Windows users and developers. We welcome anyone who wants to fix open Windows issues, and we will merge pull requests for improved Windows compatibility. If you know Windows and Emacs, please take a look at the list of open Windows issues and try to fix any of these. .. _list of open Windows issues: https://github.com/flycheck/flycheck/labels/arch%3A%20windows%20only Feature requests ================ To request a new feature please open a new issue through our `issue form`_. A feature request needs to find a core developer or maintainer who adopts and implements it. The build system ================ Flycheck provides a :file:`Makefile` with some convenient targets to compile and test Flycheck. The Makefile requires Eask_, the Emacs Lisp dependency manager. Run ``make help`` to see a list of all available targets. Some common ones are: - ``make init`` initialises the project by installing local Emacs Lisp dependencies. - ``make check`` checks all Emacs Lisp sources. This target requires Emacs 25. - ``make compile`` compiles Flycheck and its libraries to byte code. - ``make format`` formats all Emacs Lisp sources. - ``make specs`` runs all Buttercup_ specs for Flycheck. Set :makevar:`PATTERN` to run only specs matching a specific regular expression, e.g. ``make PATTERN='^Mode Line' specs`` to run only tests for the mode line. - ``make unit`` runs all ERT unit tests for Flycheck. We are phasing ERT out in favour of Buttercup; no new ERT unit tests will be added and this target will eventually be removed. - ``make integ`` runs all integration tests for Flycheck syntax checkers. These tests are dependent on the checker programs and their versions; expect failures when running this target with bleeding-edge checkers. Set :makevar:`SELECTOR` to run only tests matching a specific ERT selector, e.g. ``make SELECTOR='(language haskell)' integ`` to run only integration tests for Haskell. ``make LANGUAGE=haskell integ`` is a shortcut for this. If you want to replicate the integration tests that are run on the CI, continue reading. .. _Eask: https://emacs-eask.github.io/ .. _Buttercup: https://github.com/jorgenschaefer/emacs-buttercup Running all the integration tests ================================= To run all the integration tests, you need to have all the syntax checkers installed. As that can be tedious work, and since your locally installed tools can have different versions than the tools used on the CI, we have created a Docker image with most of the supported checkers. To use the Docker image locally and replicate the integration tests that are run on the CI, first you need to build the image:: cd flycheck docker pull flycheck/emacs-cask:26.2 docker pull flycheck/all-tools:latest docker build --build-arg EMACS_VERSION=26.2 --tag tools-and-emacs:26.2 -f .travis/tools-and-emacs . Replace ``26.2`` by the Emacs version you want to test. See the available versions on `docker hub`_. Once the image is built, you can use it to run the integration tests:: docker run --rm -it -v `pwd`:/flycheck --workdir /flycheck tools-and-emacs:26.2 /bin/bash -c "make integ" Note that the ``all-tools`` image is rebuilt each month, so the versions of the its syntax checkers will change accordingly. You can check the version of each installed tool by running the ``check-tools`` script in the image:: docker run --rm -it -v `pwd`:/flycheck --workdir /flycheck tools-and-emacs:26.2 check-tools .. _docker hub: https://hub.docker.com/r/flycheck/emacs-cask/tags Pull requests ============= Pull Requests are the primary mechanism to submit your own changes to Flycheck. Github provides great documentation about `Pull Requests`_. .. _Pull Requests: https://help.github.com/articles/using-pull-requests/ Please make your pull requests against the ``master`` branch. Use ``make check specs unit`` to test your pull request locally. When making changes to syntax checkers of a specific language, it’s also a good idea to run :samp:`make LANGUAGE={language} integ` and check whether the tests for the particular language still work. A successful ``make integ`` is by no means mandatory for pull requests, though, the continuous integration will test your changes, too. .. important:: To contribute to Flycheck you must sign our CLA_ (Contributor License Agreement). The CLA Assistant bot will automatically ask you to do this when you open a pull request, and will let you sign the CLA through your Github account. We require this process mostly to make you aware of the licensing implications of contributing to Flycheck and to obtain your explicit approval of our licenses for your contribution. .. _CLA: https://gist.github.com/swsnr/c9c0d656fe7e704da2f734779242ec99 All pull requests go through a two-stage review process: * :ref:`Maintainer ` review the general idea and direction of the pull request and leave a ``LGTM`` comment if they believe that the change is a good addition to Flycheck. We currently require at least one approval from a maintainer. * :ref:`All contributors `—language teams in particular—check the technical implementation of a pull request through `pull request reviews`_, and either approve it or request changes. We currently require at least one approval and no requested changes. .. important:: We have a comprehensive :ref:`flycheck-style-guide` that explains what features we will accept, how our code should look likewise, what tests we require, how commit messages should look like, and so on. Take a look at it to see what we look for in a code review. Additionally all pull requests go through automated tests on `Travis CI`_ which check code style, run unit tests, etc Feel free to mention individual contributors or entire teams (e.g. ``@flycheck/maintainers`` or ``@flycheck/javascript``) to ask for help or feedback or request a review. Please mention the maintainers (``@flycheck/maintainers``) if you think that your pull request has been waiting for review too long. You can expect a first response to any pull request in a couple of days. Once the pull request passed review and automated tests we will merge it. We may also ask you whether you'd like to join Flycheck and help us, thus giving you commit access to our repository and let you merge your own pull request. .. _pull request reviews: https://help.github.com/articles/about-pull-request-reviews/ .. _Travis CI: https://travis-ci.org/flycheck/flycheck/pull_requests Writing documentation ===================== Documentation improvements are very welcome. Flycheck’s manual is written in reStructuredText_ and built with Sphinx_. The source of the manual resides in the ``doc/`` directory. You need Python 3.4 or newer to install Sphinx_ for Flycheck’s documentation. On macOS it is recommended that you use Homebrew_ to install the latest Python version with ``brew install python3``. On Linux you should be able to obtain Python 3.4 from the package manager of your distribution. With Python 3 installed change into the ``doc/`` directory and run ``make init`` to install Sphinx and related tools required for Flycheck’s documentation. We recommend that you use virtualenv_ to avoid a global installation of Python modules. ``make init`` will warn you if you do not. When editing documentation run ``make html-auto`` to view the results of your edits. This target runs a local webserver at http://localhost:8000 which serves the HTML documentation and watches the documentation sources for changes to rebuild automatically. When you have finished your edits it is a good idea to run ``make linkcheck`` to verify all links in the documentation. Note that this target can take a while especially when run on a clean build. Run ``make help`` to see a list of all available Make targets for the documentation. Documentation pull requests work in the same way as other pull requests. To find documentation issues sort by the `documentation`_ label. .. _ReStructuredText: http://docutils.sourceforge.net/rst.html .. _Sphinx: http://www.sphinx-doc.org .. _Homebrew: https://brew.sh .. _virtualenv: https://virtualenv.pypa.io/en/latest/ .. _documentation: https://github.com/flycheck/flycheck/labels/documentation Issue management ================ We use Github labels for basic issue management: - **The red “bug” label denotes critical bugs in Flycheck that must be fixed urgently.** - Violet labels describe the area of Flycheck the issue belongs to. - The green “beginner friendly” label denotes easy tasks for newcomers to the project. - Orange labels denote blockers. - Grey labels indicate resolutions to issues. Out of tree contributions ========================= There are many ways that you can contribute to Flycheck that go beyond this repository. Answer questions in our `Gitter channel`_ or on StackExchange_. Participate in Flycheck discussions in other Emacs communities and help users with troubles. Write :ref:`extensions for Flycheck `. .. _Gitter channel: https://gitter.im/flycheck/flycheck .. _StackExchange: https://emacs.stackexchange.com/questions/tagged/flycheck -------------- This contributing guide is heavily inspired by `Rust’s excellent contributing information `__. flycheck-35.0/doc/contributor/maintaining.rst000066400000000000000000000267601500215546300214140ustar00rootroot00000000000000.. _flycheck-maintainers-guide: ==================== Maintainer’s Guide ==================== Issue triage ============ Please label incoming tickets accordingly according to these rules: - Add the “bug” label to things that you think **must be fixed urgently**. Please don’t use this label for bugs that do not severely impede Flycheck’s functionality. - Add the “needs review” label to new bugs and pull requests that need to be reviewed. - Add the “beginner friendly” label to really easy things. If you add this label please also add a comment that outlines a possible solution. - Add “blocked” to bugs that need further comment or help from the reporter, and to pull requests that need to be improved. - Add “needs help” to anything that no contributor will work on, to mark the issue as available for external contributors and inform users that we will not work on the issue. - Add “windows only” for bugs that appear to only affect Windows operating systems. **If you’d like to review a bug or pull request please assign the corresponding ticket to you.** In issues for specific languages that Flycheck support please mention the corresponding :ref:`language team ` if one exists. Git workflow ============ Our Git workflow is simple: * The ``master`` branch is always shippable. * Every feature and every non-trivial change goes through a pull request. GitHub calls this the “GitHub Flow” and has a very nice `visual guide`_ for this model. .. _visual guide: https://guides.github.com/introduction/flow/ .. _flycheck-branch-rules: Branch rules ------------ Our workflow implies a couple of rules about which branches to push code to: * Please commit new features, larger changes and refactorings and updates to documentation to separate branches and open a pull request for review and discussion. * The ``master`` branch is protected. Only :ref:`owners ` can push directly to it. Everyone else needs to open a pull request. Github requires maintainer approval and passing Travis CI tests before a pull request can be merged to master. .. important:: When creating a new branch please use a *descriptive name* to communicate the purpose of the branch to other developers and maintainers. ``fix-bug-42`` is not a great name, but ``42-fix-void-function-error-in-error-list`` is. .. _pull request: https://help.github.com/articles/using-pull-requests/ .. _flycheck-pull-requests-reviews: Pull requests reviews --------------------- We review all pull requests, and require two different kinds of approval: * At least one maintainer must approve the idea and direction with a ``LGTM`` comment. * At least one contributor (maintainer or otherwise) must approve the implementation by leaving an approved `pull request review`_, and no contributors must have requested changes. .. _pull request review: https://help.github.com/articles/about-pull-request-reviews/ As a maintainer ~~~~~~~~~~~~~~~ * Consider whether you personally think that the change is a good addition to Flycheck. * Weight the expected benefits and impact of the feature against the expected complexity. * Check whether the pull request complies with our :ref:`style guide `, but don't go too much into technical details. * Don't review for technical details. It's the idea and direction that counts. If you would like to see the pull request in Flycheck leave a ``LGTM`` comment. As a contributor ~~~~~~~~~~~~~~~~ * Check the technical implementation. * Consider the impact on syntax checking for a language. * Check whether the tests pass. * Check whether the PR complies with our :ref:`style guide `. * Challenge the technical implementation of a pull request, and ask questions about dubious code. * Consider whether there might be a simpler approach or a better solution to the problem that the PR solves. If you find any issues please leave a `pull request review`_ that requests for changes. Please try to leave an inline comment wherever possible and try to suggest a better solution, to make it easy for the PR author to discover and fix the issues. If you didn't find any issues leave a `pull request review`_ that approves the changes. In doubt request changes first and let the PR author explain their intention and implementation. You can still approve the review afterwards if you are satisfied. Merge guidelines ~~~~~~~~~~~~~~~~ Any contributor may merge approved pull requests. Our protection rules for the ``master`` branch ensure that only approved pull requests can be merged, but you still have to check a few things before merging: * Are commits squashed? Before merging please take an extra look at the commits to make sure that the commits were properly squashed and have good commit messages. If needed, ask the contributor to improve the commit messages and squash the commits first, by requesting changes with a pull request review. * Does the PR pass the integration tests? Not all checkers have integration tests, and not all tests are run on CI, so contributors should make sure to run them on their side. * Should the PR warrant a line in the changelog? User-facing changes should be documented in ``CHANGES.rst``. For new features: * Does the PR include tests? A new syntax checker should have at least one accompanying integration test. * Does the PR include documentation? New syntax checkers or options should be documented in :ref:`flycheck-languages`. If all the points above have been addressed, then go ahead and click that green button :) .. note:: We require proper merges for pull requests, to preserve the fact that a change came from a pull request in the git history and to retain any commit signatures that may exist. As such you can't squash-merge or rebase-merge through GitHub's UI. .. _flycheck-git-signatures: Signatures for commits and tags ------------------------------- We sign all release tags as part of our :ref:`flycheck-release-process`. Thus you need a GPG key pair for Git. Github provides a great guide which helps you to `generate a key`_ and to `tell Git about your key`_. Please also `add your key`_ to your Github account. We also recommend that you sign all your commits with your key. Again, Github provides a good guide to `sign commits`_. .. seealso:: `Signing Your Work`_ For more information about signing commits and tags take a look at the section in the Git manual. .. _Signing Your Work: https://git-scm.com/book/uz/v2/Git-Tools-Signing-Your-Work .. _generate a key: https://help.github.com/articles/generating-a-gpg-key/ .. _tell Git about your key: https://help.github.com/articles/telling-git-about-your-gpg-key/ .. _add your key: https://help.github.com/articles/adding-a-new-gpg-key-to-your-github-account/ .. _sign commits: https://help.github.com/articles/signing-commits-using-gpg/ Tooling and Services ==================== In addition to Github_ where we host code and do code reviews we use a bit of extra tooling and some 3rd party services for Flycheck: * ReadTheDocs_ hosts http://www.flycheck.org and automatically rebuilds it on every change. It works mostly automatically and requires little configuration. * `Travis CI`_ runs our tests after every push and for every pull request. It's configured through ``.travis.yml``. * `CLA assistant`_ checks signatures to our CLA_ and allows contributors to sign the CLA through their Github account. All :ref:`maintainers ` have administrative access to these services so in case of an issue just contact them. .. _Github: https://github.com/flycheck .. _ReadTheDocs: https://readthedocs.org/projects/flycheck/ .. _Travis CI: https://travis-ci.org/flycheck/flycheck .. _CLA assistant: https://cla-assistant.io .. _CLA: https://gist.github.com/swsnr/c9c0d656fe7e704da2f734779242ec99 .. _flycheck-maintenance-scripts: Maintenance scripts =================== Administrative processes are tedious and time-consuming, so we try to automate as much as possible. The :file:`maint/` directory contains many scripts for this purpose. ``make -C maint/ help`` provides an overview over all administrative tasks. Most of these scripts require Python 3.5 and additional Python libraries. On OS X it is recommended that you use Homebrew_ to install the latest Python version with ``brew install python3``. On Linux you should be able to obtain Python 3.5 from the package manager of your distribution. To install all required libraries run ``make -C maint init``. We recommend that you use virtualenv_ to avoid a global installation of Python modules. ``make init`` will warn you if you do not. .. _Homebrew: https://brew.sh .. _virtualenv: https://virtualenv.pypa.io/en/latest/ Versioning and releases ======================= We use a single continuously increasing version number for Flycheck. .. important:: Breaking changes may occur **at any point**. Please feel free to make a release whenever you think it’s appropriate. It’s generally a good idea to release when - you fixed an important bug that affects many users, - there are a couple of new syntax checkers available, - there’s a major new feature in ``master``, - etc. In doubt just make a release. We aim to release early and frequently. If anything breaks anything we can just publish another release afterwards. .. _flycheck-release-process: Release process --------------- First, check that 1. you are on ``master``, 2. your working directory is clean, i.e. has no uncommitted changes or untracked files, 3. all commits are pushed, 4. and Travis CI passes for the latest commit on ``master``. If all is good a new release is a simple as .. code-block:: console $ make -C maint release This runs the release script in :file:`maint/release.py`. If any of the above requirements isn't met the release script will signal an error and abort. The release script bumps the version number, commits and tags a new release, and pushes it to Github. .. note:: The tag is *signed*; you must configure Git for :ref:`signing commits and tags ` before you make a release the first time. After pushing the new release to Github, the script bumps the version number again, to the next snapshot, and commits the changes again. Once the script is completed please 1. Edit the `release information`_ on Github and add a short summary about the release. Don’t forget to add a link to the complete changelog and upload the package TAR file. 2. Enable the new release on the ReadTheDocs `versions dashboard`_. 3. Announce the new release in our Gitter_ channel, and wherever else you see fit. .. _release information: https://github.com/flycheck/flycheck/releases .. _versions dashboard: https://readthedocs.org/dashboard/flycheck/versions/ .. _Gitter: https://gitter.im/flycheck/flycheck New maintainers =============== To propose a new maintainer open a pull request that adds the user to ``MAINTAINERS`` and ``doc/community/people.rst``. The pull request is subject to the :ref:`same rules ` as all other pull requests. Notably it goes through the same approval process. Once merged please also - add the new maintainer to the ``Maintainers`` team of the Github organisation. This does not award additional privileges, it's just to support ``@flycheck/maintainers`` mentions for the sake of convenience, - invite the new maintainer to the internal `Maintainers channel`_ on Gitter, .. _Maintainers channel: https://gitter.im/flycheck/maintainers flycheck-35.0/doc/contributor/style-guide.rst000066400000000000000000000155371500215546300213510ustar00rootroot00000000000000.. _flycheck-style-guide: ============= Style Guide ============= This document describes our code style. It tells you what to look for when making changes to Flycheck, or when reviewing pull requests. Features ======== Flycheck’s scope and focus is providing the infrastructure and foundations for on-the-fly syntax checking. Flycheck provides the basics but deep integration with particular programming languages is best left to :ref:`separate packages `. Whether a feature is within the scope of Flycheck is the :ref:`maintainer’s ` judgement call. Generally we reserve the right to reject any pull request for being out of scope. * Avoid a *disproportionate amount of code* for a single syntax checker or language. Look at the built-in checkers for judgement. A syntax checker that requires a lot more code than any built-in checker is likely to be rejected. * Avoid *deep integration* with a particular UI or completion framework. Emacs’ standard is our standard: We will reject code that is tied to Helm or Counsel. * Likewise do not deviate from Emacs’ default behaviour too much. Stick to Emacs’ standard for key bindings, interactive functions, etc. Backward compatibility ====================== Checkers and languages evolve over time, and their error format often change as a consequence. It is not a goal of Flycheck to work with every version of every checker ever supported. However, the latest Flycheck version *should always work* with the contemporary version of a checker. As a rule of thumb, if maintaining backward compatibility is trivial (i.e., does not incur code maintenance costs), then we should do it. For example, a slightly more complex parsing regexp is OK, but doing version detection to add a flag would most likely be too much. Keep in mind that users may not have the choice of updating to the latest version of a checker (e.g., ``gcc`` on Debian-based distributions). On the other hand, npm or Python packages are usually trivial to update. Making an extra effort to maintain backward compatibility for these hard-to-update checkers is reasonable. The integration tests that are run on our CI should always reflect the latest supported version. Style ===== .. important:: ``make check compile`` must pass on Emacs 25 or newer. This command checks for some formatting issues and compilation errors. Run ``make format`` with Emacs 25 to automatically reformat the Emacs Lisp source files. * Generally try to fit into the style of the code you see. * Indent with the default indentation rules. * Follow the :infonode:`(elisp)Programming Tips` for Emacs Lisp. * Whitespace: * 80 characters per line. * Avoid tabs and trailing spaces. * Naming: * Prefix all variables and functions with the name of the containing library, i.e. ``flycheck-`` for everything that is in :file:`flycheck.el`. * End boolean predicates with ``-p``, i.e. ``flycheck-valid-checker-p``. * Avoid macros, and use them for syntax only. * Adhere to the :infonode:`(elisp)Key Binding Conventions`. Particularly do not define keys in Emacs’ reserved keymaps or in the :samp:`C-c {LETTER}` space for user bindings. Libraries ========= * Do **not** advise built-in or 3rd party functions and commands. * Do **not** redefine built-in or 3rd party functions, unless for compatibility, but then copy the newer definition verbatim. * Do **not** use ``with-eval-after-load`` and similar functions. * Dependencies: * Use built-in Emacs libraries freely. * Introduce external dependencies with care. Prefer built-in libraries. * Avoid dependencies on language-specific libraries. * Avoid ``cl-lib``: * Prefer ``seq`` over ``cl-lib``. Use list functions from ``cl-lib`` only as the very last resort. * Prefer ``let-alist`` and ``pcase`` over ``cl-destructuring-bind``. Tests ===== * Add comprehensive buttercup specs for new functions and commands to :file:`test/specs/`. Check whether the specs fit into an existing spec file, or add a new file instead. In doubt, use a new file. * For new syntax checkers add at least one syntax checker integration test to :file:`test/flycheck-test.el`. Make sure that the test passes with :samp:`make LANGUAGE={language} integ`. Documentation ============= * Add docstrings to all functions and variables. * Follow the :infonode:`(elisp)Documentation Tips`. * Take care to update our manual: * Document new interactive commands and user options in the :ref:`user guide `. * Document new syntax checkers and new options for existing syntax checkers in the :ref:`list of languages `. * Document new or changed version requirements for syntax checkers in the :ref:`list of languages `. * Document changes to our build system and tooling in the :ref:`contributor’s guide ` or the :ref:`maintainer’s guide `. Commits ======= * Make each commit self-contained. * Squash trivial fixes into previous commits so that no commit in and by itself violates this style guide. * Write commit messages that adhere to the style illustrated below. * In doubt prefer long messages over short messages. Take the time to write a good message that explains the intention of the change and illustrates noteworthy aspects of the implementation. * If the commit fixes a bug try to reproduce a brief description of the bug in the message and make sure to mention the corresponding GitHub issue (e.g. ``Fixes GH-42``). Commit message style -------------------- This model commit message illustrates our style:: Fix a foo bug The first line is the summary, 50 characters or less. Write in the imperative and in present tense: “Fix bug”, not “fixed bug” or “fixes bug”. Explain the intend of the change not the actual contents which the diff already provides After the summary more paragraphs with detailed explanations may follow, wrapped at 72 characters. Separate multiple paragraphs by blank lines. You may use simple formatting like *emphasis* or _underline_, but keep it to a minimum. Commit messages are not in Markdown :) Commit messages may reference issues by number, like this: See GH-42. Please use `GH-` to prefix issue numbers. You may also close issues like this: Fixes GH-42 and closes GH-42. `Git Commit`_ and Magit_ provide Emacs mode for Git commit messages, which helps you to comply to these guidelines. .. seealso:: `A Note About Git Commit Messages`_ Further information about good commit messages, including some motivation for our rules for commit messages. .. _Git Commit: https://github.com/magit/magit/ .. _Magit: https://github.com/magit/magit/ .. _A Note About Git Commit Messages: https://tbaggery.com/2008/04/19/a-note-about-git-commit-messages.html flycheck-35.0/doc/developer/000077500000000000000000000000001500215546300157645ustar00rootroot00000000000000flycheck-35.0/doc/developer/developing.rst000066400000000000000000000417161500215546300206630ustar00rootroot00000000000000.. _flycheck-developers-guide: ================= Developer's Guide ================= So you want to extend Flycheck, but have no idea where to start? This guide will give you an overview of Flycheck internals, and take you through adding a syntax checker to Flycheck. An overview of Flycheck internals ================================= The goal of Flycheck is to display errors from external checker programs directly in the buffer you are editing. Instead of you manually invoking ``make`` or the compiler for your favorite language, Flycheck takes care of it for you, collects the errors and displays them right there in the buffer. How Flycheck works is rather straightforward. Whenever a syntax check is started (see :ref:`flycheck-syntax-checks`), the following happens: 1. First, Flycheck runs the external program as an asynchronous process using ``start-process``. While this process runs, Flycheck simply accumulates its output. 2. When the process exits, Flycheck parses its output in order to collect the errors. The raw output is turned into a list of `flycheck-error` objects containing, among others, the filename, line, column, message and severity of the error. 3. Flycheck then filters the collected errors to keep only the relevant ones. For instance, errors directed at other files than the one you are editing are discarded. The exact sementics of which errors are relevant is defined in ``flycheck-relevant-error-p``. 4. Relevant errors are highlighted by Flycheck in the buffer, according to user preference. By default, each error adds a mark in the fringe at the line it occurs, and underlines the symbol at the position of the error using *overlays*. 5. Finally, Flycheck rebuilds the error list buffer. Flycheck follows this process for all the :ref:`many different syntax checkers ` that are provided by default. .. note:: Specifically, the above describes the process of *command checkers*, i.e., checkers that run external programs. All the checkers defined in ``flycheck-checkers`` are command checkers, but command checkers are actually instances of *generic checkers*. Many external packages, such as ``dafny-mode``, ``fstar-mode``, etc. use generic checkers, which allow you more flexibility, including running Flycheck with persistent subprocess such as language servers. See :flyc:`flycheck-ocaml` for an example of how to use a generic checker. .. seealso:: :infonode:`(elisp)Asynchronous Processes` How to run and control asynchronous processes from inside Emacs. :infonode:`(elisp)Overlays` How to add temporary annotations to a buffer. .. _adding-a-checker: Adding a syntax checker to Flycheck =================================== To add a syntax checker to Flycheck, you need to answer a few questions: - How to invoke the checker? What is the name of its program, and what arguments should Flycheck pass to it? - How to parse the error messages from the checker output? - What language (or languages) will the checker be used for? For instance, if I were to manually run the Scala compiler ``scalac`` on the following ``hello.scala`` file: .. code-block:: scala object { println("Hello, world") } Here is the output I would get: .. code-block:: console $ scalac hello.scala hello.scala:1: error: identifier expected but '{' found. object { ^ one error found The compiler reports one syntax error from the file ``hello.scala``, on line 3, with severity ``error``, and the rest of the line contains the error message. So, if we want to instruct Flycheck to run ``scalac`` on our Scala files, we need to tell Flycheck to: - Invoke ``scalac FILE-NAME`` - Get errors from output lines of the form: ``file-name:line: error:message`` Writing the checker ------------------- Once you have answered these questions, you merely have to translate the answers to Emacs Lisp. Here is the full definition of the ``scala`` checker you can find in ``flycheck.el``: .. code-block:: elisp (flycheck-define-checker scala "A Scala syntax checker using the Scala compiler. See URL `https://www.scala-lang.org/'." :command ("scalac" "-Ystop-after:parser" source) :error-patterns ((error line-start (file-name) ":" line ": error: " (message) line-end)) :modes scala-mode :next-checkers ((warning . scala-scalastyle))) The code is rather self-explanatory; but we'll go through it nonetheless. First, we define a checker using `flycheck-define-checker`. Its first argument, ``scala``, is the name of the checker, as a symbol. The name is used to refer to the checker in the documentation, so it should usually be the name of the language to check, or the name of the program used to do the checking, or a combination of both. Here, ``scalac`` is the program, but the checker is named ``scala``. There is another Scala checker using ``scalastyle``, with the name ``scala-scalastyle``. See `flycheck-checkers` for the full list of checker names defined in Flycheck. After the name comes the docstring. This is a documentation string answering three questions: 1) What language is this checker for? 2) What is the program used? 3) Where can users get this program? Nothing more. In particular, this string does *not* include user documentation, which should rather go in the manual (see :ref:`flycheck-languages`). The rest of the arguments are keyword arguments; their order does not matter, but they are usually given in the fashion above. - ``:command`` describes what command to run, and what arguments to pass. Here, we tell Flycheck to run ``scalac -Ystop-after:parser`` on ``source``. In Flycheck, we usually want to get error feedback as fast as possible, hence we will pass any flag that will speed up the invocation of a compiler, even at the cost of missing out on some errors. Here, we are telling ``scalac`` to stop after the parsing phase to ensure we are getting syntax errors quickly. The ``source`` argument is special: it instructs Flycheck to create a temporary file containing the content of the current buffer, and to pass that temporary file as argument to ``scalac``. That way, ``scalac`` can be run on the content of the buffer, even when the buffer has not been saved. There are other ways to pass the content of the buffer to the command, e.g., by piping it through standard input. These special arguments are described in the docstring of `flycheck-substitute-argument`. - ``:error-patterns`` describes how to parse the output, using the `rx` regular expression syntax. Here, we expect ``scalac`` to return error messages of the form:: file:line: error: message This is a common output format for compilers. With the following ``:error-patterns`` value: .. code-block:: elisp ((error line-start (file-name) ":" line ": error: " (message) line-end)) we tell Flycheck to extract three parts from each line in the output that matches the pattern: the ``file-name``, the ``line`` number, and the ``message`` content. These three parts are then used by Flycheck to create a `flycheck-error` with the ``error`` severity. - ``:modes`` is the list of Emacs major modes in which this checker can run. Here, we want the checker to run only in ``scala-mode`` buffers. That's it! This definition alone contains everything Flycheck needs to run ``scalac`` on a Scala buffer and parse its output in order to give error feedback to the user. .. note:: ``rx.el`` is a built-in Emacs module for declarative regular expressions. Look for the documentation of the `rx` function inside Emacs for its usage. Flycheck extends `rx` with a few constructs like ``line``, ``file-name`` and ``message``. You can find them the full list in the docstring for `flycheck-rx-to-string`. Registering the checker ----------------------- Usually, you'll want to register the checker so that it is eligible for automatic selection. For that, you just need to add the checker symbol to `flycheck-checkers`. The order of checkers does matter, as only one checker can be enabled in a buffer at a time. Usually you want to put the most useful checker as the first checker for that mode. For instance, here are the JavaScript checkers provided by Flycheck: .. code-block:: console javascript-eslint javascript-jshint javascript-gjslint javascript-jscs javascript-standard If a buffer is in ``js-mode``, Flycheck will try first to enable ``javascript-eslint`` before any other JavaScript checker. There are other factors governing checker selection in a buffer, namely whether a checker is disabled by user configuration (see :ref:`flycheck-disable-checkers`), and whether this checker *can* be enabled (see the ``:enabled`` property in `flycheck-define-generic-checker`). .. seealso:: flycheck-get-checker-for-buffer This is the function that looks through `flycheck-checkers` to find a valid checker for the buffer. Writing more complex checkers ----------------------------- Here are two examples of more complex checkers: .. code-block:: elisp (flycheck-define-checker protobuf-protoc "A protobuf syntax checker using the protoc compiler. See URL `https://developers.google.com/protocol-buffers/'." :command ("protoc" "--error_format" "gcc" (eval (concat "--java_out=" (flycheck-temp-dir-system))) ;; Add the file directory of protobuf path to resolve import directives (eval (concat "--proto_path=" (file-name-directory (buffer-file-name)))) source-inplace) :error-patterns ((info line-start (file-name) ":" line ":" column ": note: " (message) line-end) (error line-start (file-name) ":" line ":" column ": " (message) line-end) (error line-start (message "In file included from") " " (file-name) ":" line ":" column ":" line-end)) :modes protobuf-mode :predicate (lambda () (buffer-file-name))) .. code-block:: elisp (flycheck-define-checker sh-shellcheck "A shell script syntax and style checker using Shellcheck. See URL `https://github.com/koalaman/shellcheck/'." :command ("shellcheck" "--format" "checkstyle" "--shell" (eval (symbol-name sh-shell)) (option-flag "--external-sources" flycheck-shellcheck-follow-sources) (option "--exclude" flycheck-shellcheck-excluded-warnings list flycheck-option-comma-separated-list) "-") :standard-input t :modes sh-mode :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-remove-error-file-names "-" errors)) :predicate (lambda () (memq sh-shell '(bash ksh88 sh))) :verify (lambda (_) (let ((supported (memq sh-shell '(bash ksh88 sh)))) (list (flycheck-verification-result-new :label (format "Shell %s supported" sh-shell) :message (if supported "yes" "no") :face (if supports-shell 'success '(bold warning)))))) :error-explainer (lambda (err) (let ((error-code (flycheck-error-id err)) (url "https://github.com/koalaman/shellcheck/wiki/%S")) (and error-code `(url . ,(format url error-code)))))) The ``:command`` forms are longer, as the checkers pass more flags to ``protoc`` and ``shellcheck``. Note the use of ``eval``, ``option``, and ``option-flag`` for transforming Flycheck checker options into flags for the command. See the docstring for `flycheck-substitute-argument` for more info, and look at other checkers for examples. The ``shellcheck`` checker does not use ``source`` nor ``source-inplace``: instead, it passes the buffer contents on standard input, using ``:standard-input t``. The ``protoc`` checker has three patterns in ``:error-patterns``; the first one will catch ``notes`` from the compiler and turn them into `flycheck-error` objects with the ``info`` severity; the second is for errors from the file being checked, and the third one is for errors from other files. In the ``shellcheck`` checker, on the other hand, ``:error-parser`` replaces ``:error-patterns``: ``shellcheck`` outputs results in the standard CheckStyle XML format, so the definition above uses Flycheck's built-in CheckStyle parser, and an ``:error-filter`` to replace ``-`` by the current buffer's filename. Both checkers use a new ``:predicate`` property to determine when the checker can be called. In addition to the ``:mode`` property which restricts the ``protoc`` checker to buffers in ``protobuf-mode``, the ``:predicate`` property ensures that ``protoc`` is called only when there is a file associated to the buffer (this is necessary since we are passing the file associated to the buffer ``protobuf`` using ``source-inplace`` in ``:command``; in contrast, the ``shellcheck`` checker can run in all buffers, because it sends buffer contents through a pipe). The second checker has a more complex ``:predicate`` to make sure that the current shell dialect is supported, and a ``:verify`` function to help users diagnose configuration issues ( ``:verify`` is helpful for giving feedback to users; its output gets included when users invoke `flycheck-verify-setup`) Finally, the ``shellcheck`` checker includes an error explainer, which opens the relevant page on the ShellCheck wiki when users run `flycheck-explain-error-at-point`. There are other useful properties, depending on your situation. Most important is ``:enabled``, which is like ``:predicate`` but is run only once; it is used to make sure a checker has everything it needs before being allowed to run in a buffer (this is particularly useful when the checks are costly: running an external program and parsing its output, checking for a plugin, etc.). .. seealso:: flycheck-define-generic-checker For the full documentation of all the properties you can pass to `flycheck-define-checker`. Look also in the docstring for `flycheck-define-command-checker` for additional properties. .. note:: Don't be afraid to look into the ``flycheck.el`` code. The existing checkers serve as useful examples you can draw from, and all core functions are documented. Sharing your checker -------------------- Once you have written your own syntax checker, why not `submit a pull request `__ to integrate it into Flycheck? If it's useful to you, it may be useful for someone else! Please do check out our :ref:`flycheck-contributors-guide` to learn how we deal with pull requests. Issues with auto-quoting in `flycheck-define-checker` ----------------------------------------------------- You may have noticed that lists passed to the ``:command`` or ``:error-patterns`` in the snippets above are not quoted. That is because `flycheck-define-checker` is a macro which automatically quotes these arguments (not unlike ``use-package`` and other configuration macros). While this makes for less noisy syntax, it unfortunately prevents you from defining a checker with compile-time arguments. For example, you may be tempted to have a custom checker in your Emacs configuration written like this: .. code-block:: elisp (flycheck-define-checker my-foobar-checker :command ("foobar" source) :error-patterns ((error …)) :modes `(foobar-mode ,my-other-foobar-mode)) The idea is that you know statically one mode that you want to use the checker in: ``foobar-mode``, but another mode can be given via the variable ``my-other-foobar-mode`` before the checker is defined. This won't work, because the ``:modes`` property is auto-quoted by `flycheck-define-checker`. The issue arises not just with ``:modes``:, but with almost all the other properties since they are also auto-quoted. If you do find yourself in need to define such a checker, there is a solution though. The `flycheck-define-checker` macro is just a convenience over `flycheck-define-command-checker`, so you could define the checker above as follows: .. code-block:: elisp (flycheck-def-executable-var my-foobar-checker "foobar") (flycheck-define-command-checker 'my-foobar-checker :command '("foobar" source) :error-patterns '((error …)) :modes `(foobar-mode ,my-other-foobar-mode)) Using `flycheck-define-command-checker`, you now need to quote all the list arguments, but now with the confidence that no auto-quoting will take place, since `flycheck-define-command-checker` is just a function. Also note that you need to explicitly define the executable variable for the checker. Using `flycheck-define-command-checker` is the recommended way to define a checker with compile-time arguments. .. note:: The `flycheck-define-checker` macro is an autoload, so using it inside a `with-eval-after-load` form will load all of Flycheck. While this ensures the macro is correctly expanded, it also defeats the purpose of using `with-eval-after-load`. For the background behind this state of affairs, see `issue 1398`_. .. _issue 1398: https://github.com/flycheck/flycheck/issues/1398 flycheck-35.0/doc/elisp.py000066400000000000000000000363761500215546300155040ustar00rootroot00000000000000# Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors # This file is not part of GNU Emacs. # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . from collections import namedtuple from sphinx import addnodes from sphinx.util import ws_re from sphinx.roles import XRefRole from sphinx.domains import Domain, ObjType from sphinx.util.nodes import make_refnode from sphinx.directives import ObjectDescription def make_target(cell, name): """Create a target name from ``cell`` and ``name``. ``cell`` is the name of a symbol cell, and ``name`` is a symbol name, both as strings. The target names are used as cross-reference targets for Sphinx. """ return '{cell}-{name}'.format(cell=cell, name=name) def to_mode_name(symbol_name): """Convert ``symbol_name`` to a mode name. Split at ``-`` and titlecase each part. """ return ' '.join(p.title() for p in symbol_name.split('-')) class Cell(namedtuple('Cell', 'objtype docname')): """A cell in a symbol. A cell holds the object type and the document name of the description for the cell. Cell objects are used within symbol entries in the domain data. """ pass class KeySequence(namedtuple('KeySequence', 'keys')): """A key sequence.""" PREFIX_KEYS = {'C-u'} PREFIX_KEYS.update('M-{}'.format(n) for n in range(10)) @classmethod def fromstring(cls, s): return cls(s.split()) @property def command_name(self): """The command name in this key sequence. Return ``None`` for key sequences that are no command invocations with ``M-x``. """ try: return self.keys[self.keys.index('M-x') + 1] except ValueError: return None @property def has_prefix(self): """Whether this key sequence has a prefix.""" return self.keys[0] in self.PREFIX_KEYS def __str__(self): return ' '.join(self.keys) class EmacsLispSymbol(ObjectDescription): """An abstract base class for directives documenting symbols. Provide target and index generation and registration of documented symbols within the domain data. Deriving classes must have a ``cell`` attribute which refers to the cell the documentation goes in, and a ``label`` attribute which provides a human-readable name for what is documented, used in the index entry. """ cell_for_objtype = { 'defcustom': 'variable', 'defconst': 'variable', 'defvar': 'variable', 'defface': 'face' } @property def cell(self): """The cell in which to store symbol metadata.""" return self.cell_for_objtype[self.objtype] @property def label(self): """The label for the documented object type.""" return self.objtype def handle_signature(self, signature, signode): """Create nodes in ``signode`` for the ``signature``. ``signode`` is a docutils node to which to add the nodes, and ``signature`` is the symbol name. Add the object type label before the symbol name and return ``signature``. """ label = self.label + ' ' signode += addnodes.desc_annotation(label, label) signode += addnodes.desc_name(signature, signature) return signature def _add_index(self, name, target): index_text = '{name}; {label}'.format( name=name, label=self.label) self.indexnode['entries'].append( ('pair', index_text, target, '', None)) def _add_target(self, name, sig, signode): target = make_target(self.cell, name) if target not in self.state.document.ids: signode['names'].append(name) signode['ids'].append(target) signode['first'] = (not self.names) self.state.document.note_explicit_target(signode) obarray = self.env.domaindata['el']['obarray'] symbol = obarray.setdefault(name, {}) if self.cell in symbol: self.state_machine.reporter.warning( 'duplicate description of %s %s, ' % (self.objtype, name) + 'other instance in ' + self.env.doc2path(symbol[self.cell].docname), line=self.lineno) symbol[self.cell] = Cell(self.objtype, self.env.docname) return target def add_target_and_index(self, name, sig, signode): target = self._add_target(name, sig, signode) self._add_index(name, target) class EmacsLispMinorMode(EmacsLispSymbol): cell = 'function' label = 'Minor Mode' def handle_signature(self, signature, signode): """Create nodes in ``signode`` for the ``signature``. ``signode`` is a docutils node to which to add the nodes, and ``signature`` is the symbol name. Add the object type label before the symbol name and return ``signature``. """ label = self.label + ' ' signode += addnodes.desc_annotation(label, label) signode += addnodes.desc_name(signature, to_mode_name(signature)) return signature def _add_index(self, name, target): return super()._add_index(to_mode_name(name), target) class EmacsLispFunction(EmacsLispSymbol): """A directive to document Emacs Lisp functions.""" cell_for_objtype = { 'defun': 'function', 'defmacro': 'function' } def handle_signature(self, signature, signode): function_name, *args = ws_re.split(signature) label = self.label + ' ' signode += addnodes.desc_annotation(label, label) signode += addnodes.desc_name(function_name, function_name) for arg in args: is_keyword = arg.startswith('&') node = (addnodes.desc_annotation if is_keyword else addnodes.desc_addname) signode += node(' ' + arg, ' ' + arg) return function_name class EmacsLispKey(ObjectDescription): """A directive to document interactive commands via their bindings.""" label = 'Interactive command' def handle_signature(self, signature, signode): """Create nodes to ``signode`` for ``signature``. ``signode`` is a docutils node to which to add the nodes, and ``signature`` is the symbol name. """ key_sequence = KeySequence.fromstring(signature) signode += addnodes.desc_name(signature, str(key_sequence)) return str(key_sequence) def _add_command_target_and_index(self, name, sig, signode): target_name = make_target('function', name) if target_name not in self.state.document.ids: signode['names'].append(name) signode['ids'].append(target_name) self.state.document.note_explicit_target(signode) obarray = self.env.domaindata['el']['obarray'] symbol = obarray.setdefault(name, {}) if 'function' in symbol: self.state_machine.reporter.warning( 'duplicate description of %s %s, ' % (self.objtype, name) + 'other instance in ' + self.env.doc2path(symbol['function'].docname), line=self.lineno) symbol['function'] = Cell(self.objtype, self.env.docname) index_text = '{name}; {label}'.format(name=name, label=self.label) self.indexnode['entries'].append( ('pair', index_text, target_name, '', None)) def _add_binding_target_and_index(self, binding, sig, signode): reftarget = make_target('key', binding) if reftarget not in self.state.document.ids: signode['names'].append(reftarget) signode['ids'].append(reftarget) signode['first'] = (not self.names) self.state.document.note_explicit_target(signode) keymap = self.env.domaindata['el']['keymap'] if binding in keymap: self.state_machine.reporter.warning( 'duplicate description of binding %s, ' % binding + 'other instance in ' + self.env.doc2path(keymap[binding]), line=self.lineno) keymap[binding] = self.env.docname index_text = '{name}; key binding'.format(name=binding) self.indexnode['entries'].append( ('pair', index_text, reftarget, '', None)) def add_target_and_index(self, name, sig, signode): # If unprefixed M-x command index as function and not as key binding sequence = KeySequence.fromstring(name) if sequence.command_name and not sequence.has_prefix: self._add_command_target_and_index(sequence.command_name, sig, signode) else: self._add_binding_target_and_index(name, sig, signode) class XRefModeRole(XRefRole): """A role to cross-reference a minor mode. Like a normal cross-reference role but appends ``-mode`` to the reference target and title-cases the symbol name like Emacs does when referring to modes. """ fix_parens = False lowercase = False def process_link(self, env, refnode, has_explicit_title, title, target): refnode['reftype'] = 'minor-mode' target = target + '-mode' return (title if has_explicit_title else to_mode_name(target), target) class EmacsLispDomain(Domain): """A domain to document Emacs Lisp code.""" name = 'el' label = 'Emacs Lisp' object_types = { # TODO: Set search prio for object types # Types for user-facing options and commands 'minor-mode': ObjType('minor-mode', 'function', 'mode', cell='function'), 'define-key': ObjType('key binding', cell='interactive'), 'defcustom': ObjType('defcustom', 'defcustom', cell='variable'), 'defface': ObjType('defface', 'defface', cell='face'), # Object types for code 'defun': ObjType('defun', 'defun', cell='function'), 'defmacro': ObjType('defmacro', 'defmacro', cell='function'), 'defvar': ObjType('defvar', 'defvar', cell='variable'), 'defconst': ObjType('defconst', 'defconst', cell='variable') } directives = { 'minor-mode': EmacsLispMinorMode, 'define-key': EmacsLispKey, 'defcustom': EmacsLispSymbol, 'defvar': EmacsLispSymbol, 'defconst': EmacsLispSymbol, 'defface': EmacsLispSymbol, 'defun': EmacsLispFunction, 'defmacro': EmacsLispFunction } roles = { 'mode': XRefModeRole(), 'defvar': XRefRole(), 'defconst': XRefRole(), 'defcustom': XRefRole(), 'defface': XRefRole(), 'defun': XRefRole(), 'defmacro': XRefRole() } data_version = 1 initial_data = { # Our domain data attempts to somewhat mirror the semantics of Emacs # Lisp, so we have an obarray which holds symbols which in turn have # function, variable, face, etc. cells, and a keymap which holds the # documentation for key bindings. 'obarray': {}, 'keymap': {} } def clear_doc(self, docname): """Clear all cells documented ``docname``.""" for symbol in self.data['obarray'].values(): for cell in list(symbol.keys()): if docname == symbol[cell].docname: del symbol[cell] for binding in list(self.data['keymap']): if self.data['keymap'][binding] == docname: del self.data['keymap'][binding] def resolve_xref(self, env, fromdocname, builder, objtype, target, node, contnode): """Resolve a cross reference to ``target``.""" if objtype == 'key': todocname = self.data['keymap'].get(target) if not todocname: return None reftarget = make_target('key', target) else: cell = self.object_types[objtype].attrs['cell'] symbol = self.data['obarray'].get(target, {}) if cell not in symbol: return None reftarget = make_target(cell, target) todocname = symbol[cell].docname return make_refnode(builder, fromdocname, todocname, reftarget, contnode, target) def resolve_any_xref(self, env, fromdocname, builder, target, node, contnode): """Return all possible cross references for ``target``.""" nodes = ((objtype, self.resolve_xref(env, fromdocname, builder, objtype, target, node, contnode)) for objtype in ['key', 'defun', 'defvar', 'defface']) return [('el:{}'.format(objtype), node) for (objtype, node) in nodes if node is not None] def merge_warn_duplicate(self, objname, our_docname, their_docname): self.env.warn( their_docname, "Duplicate declaration: '{}' also defined in '{}'.\n".format( objname, their_docname)) def merge_keymapdata(self, docnames, our_keymap, their_keymap): for key, docname in their_keymap.items(): if docname in docnames: if key in our_keymap: our_docname = our_keymap[key] self.merge_warn_duplicate(key, our_docname, docname) else: our_keymap[key] = docname def merge_obarraydata(self, docnames, our_obarray, their_obarray): for objname, their_cells in their_obarray.items(): our_cells = our_obarray.setdefault(objname, dict()) for cellname, their_cell in their_cells.items(): if their_cell.docname in docnames: our_cell = our_cells.get(cellname) if our_cell: self.merge_warn_duplicate(objname, our_cell.docname, their_cell.docname) else: our_cells[cellname] = their_cell def merge_domaindata(self, docnames, otherdata): self.merge_keymapdata(docnames, self.data['keymap'], otherdata['keymap']) self.merge_obarraydata(docnames, self.data['obarray'], otherdata['obarray']) def get_objects(self): """Get all documented symbols for use in the search index.""" for name, symbol in self.data['obarray'].items(): for cellname, cell in symbol.items(): yield (name, name, cell.objtype, cell.docname, make_target(cellname, name), self.object_types[cell.objtype].attrs['searchprio']) def setup(app): app.add_domain(EmacsLispDomain) return {'version': '0.1', 'parallel_read_safe': True} flycheck-35.0/doc/glossary.rst000066400000000000000000000041651500215546300164020ustar00rootroot00000000000000========== Glossary ========== The glossary explains most of the special terms we use in this documentation. some of these are originally explained in the `Emacs manual`_ or the `Emacs Lisp reference`_, but we reproduce them here for convenience. .. _Emacs manual: https://www.gnu.org/software/emacs/manual/html_node/emacs/index.html .. _Emacs Lisp reference: https://www.gnu.org/software/emacs/manual/html_node/elisp/index.html .. glossary:: init file user init file Your main Emacs configuration file. It’s typically located in your :term:`user emacs directory` at :file:`$HOME/.emacs.d/init.el`. Emacs also looks at :file:`$HOME/.emacs`, but this location is not recommended anymore. To find out the actual path to your init file of your Emacs session inspect the value of the variable `user-init-file` with :kbd:`C-h v user-init-file`. You can visit it directly with :kbd:`M-: (find-file user-init-file)`. .. seealso:: :infonode:`(emacs)Init File` More information about the init file. :infonode:`(elisp)Init File` Programming interface for the init file. user emacs directory The directory for all Emacs related files of the current user, at :file:`~/.emacs.d/`. Many Emacs packages create data files in this directory, and it holds the recommended location for the :term:`init file` at :file:`~/.emacs.d/init.el`. registered syntax checker A syntax checker in `flycheck-checkers`. Flycheck will only use these syntax checkers when checking buffers automatically. verification buffer A buffer shown by `M-x flycheck-verify-setup`. This buffer contains information about the Flycheck setup for the current buffer. executable option executable options Options to override the executables of syntax checkers that run external commands. They are named :samp:`flycheck-{checker}-executable`, e.g. ``flycheck-c/c++-clang-executable`` for `c/c++-clang`. Flycheck implicit defines these options for all syntax checkers defined with `flycheck-define-checker`. flycheck-35.0/doc/images/000077500000000000000000000000001500215546300152445ustar00rootroot00000000000000flycheck-35.0/doc/images/flycheck-annotated.png000066400000000000000000006706121500215546300215310ustar00rootroot00000000000000PNG  IHDR NK |sRGB pHYs  q/IDATx{TG-zӹ3c{!`llD!9 B(V+rNnVlsQsҭBbֳ~vT+UoU /w p8x^J/`0#H`^^|\x_|:ςApG`x8 t 0Px >^׃_p| EEi DFxwQL ';=0gL%/ |?8v@փ@Q[<(_v(Dt1~%<òoAqC_]^Lx%,Exj+uE>g ^B\`dPq?xaFFt/*bR'T~( qxA?*0P P(&0Iaw^%Q J*E 5|#TPhㅐP K)+oURP†OX  b EJV8Bdt$㙄Ui4ءi%| CRG`k3/kN+x=^e8ls7+x.R< 5eVf !}JC'{8t e%NJ78%GcQ/,SZvJ !Ѝ@Ɏ.bBA7́b@)ɔ<E\J 0Pe=}a1y/08ÚAQ8EoUQ9PaBp8ĖRH(-yʍK[-T&Q_rGÙ1EMn 02bۄd|e >8XBрWF9 +<+,,Rd @5vɩjOia`Ժ-گ»;( ,(Du1E_wQ bW)idK#PV\f5mxB% A\P +Z\9?:GL""szx ģp";L1F%*,SHBA,h*^ɚ܉A%>KQPAu&PEMXa ~ e68S kDe5x*ᅛ&*::vC-w5<%ݏb[T%p%,0HǠ!: %H&2Qg ($3Ba&ڐx&2VHRB`/P  P8l /-HQ9xRK :"9;6 u7:nB]d$pN-ƄBVFyM)鏟MSP])ĀjM9bm(_(JmDEu!wA/H ćEK(BB:p٥9,f\Yu3`Mni6fjM=iTMld#{B2 I.$_HĀ/vwEĂbyդV1O*% \4~لɄ`Ioļld#~O/.e7j Xp1`dˀG#݀-h};v&uٸV%ld#F6VV x3hԀk/h:2d,Bb 93RblA`Q3hԀkSn60NMFJ``2bxTLIa 5`mduUlL+%VŴ(@Kg4uzV ~)ɨ3&>o2jl7:}I*jttT,d2I`gll,REU0B@hԀk@Y8 粈 `hFAײչW[W-_-k]^#_-Ӕt'&4G<}ޱ>c(_:~G, T EؙV(uZJѿzZ$y ~ 5`m|ҮO xj\()0ԭ;[l}V>Z- I߰gן_wßn 8| U;6fZ,@"JR&vfgghhjjj:^ xG52U5\lYKd4I .j:`jP4kQ,hif^1&⍂(p iMk-۷Zo%c+8޻W=9 y;?!П38oܪN^Š3~/M?>3{wN'5: $ BMj쏎BcXYo(.f5 ubl`0i۩)<51h2ssVр.7&H<uh0[mhN8fZMF=U^`jfpgt&=KqV֦4 n0h 48fg  /SpK̪{._Z¿X5V9s8oWg9/6`]=}i˷|@$ %dKcrHE*;SW]~6Zҙ.:uWm0.V̚ &zMscUS9w 32>Ng2OBohur=T%-h\6[{.5%Yv@S4<]јMnBN66w-Z%hԀk+ܧ![v#_#jFAmʎ4_m͖m-'~-qp ~J7hT ] a?)k;ZѮ{#nclgF ~>8NӾ  R)hף!eYA5jEUw\\PS|n߁Ietz}rG3MFxΝ]{xȁ7'Yo>==tHuϸ˾yp?ifW?]LgTݓ#aQ,+eOWU9nC FbQC`805kW9ҀfeiRR`P}M_J L$/${k[u1Oo5fh=?/.:yЬ~9r1:ennjX86(je{GF׫gjБ#^xtY{fyY)\savz/WѪ%zTZvuoֶ9%S+Ƿܪf5ڙg;~@aN)D% B7͛X:> ;$B$ bH{ױ  -{E[@#* Әvt}o?zp흟g KDR b;3fS>3g5 vuvȺd۷}[ynJ$V\%ϥ>M >&m=(\K?YP7gnۼĕ{Ok=#ΐW,6z usdlVa\!wLrX-xusG{bD03\WUʪDğf $ ;O2J0؜q\c,ZIaAaQC' \$exTa=/,a R`oVord6UYTx+Zyd#;l=BԀk?4 @SLf9Cqo;F#m7_D `@$X,E@@@@@@> 5`ms8%%֠qx=# o7kABjV| X;%i+;VA$ܱN< ԀkрziE*iN\ }Ib$&1`gp 05kp` Ev::7P¡I- QnJ%I@@@@?(385`mS0%46Z N Y#3h˪CQ Xb%g9Pg8/̉&, Ιg 52//R<Z¡7qȯB d$ x;a"׀XtR\rр'@a|ujtD AKi0 Vxq\: FJi4ﯱ!(meef0Bhpkso--%J5`mhicK rF&9h8gLcz͚3C29qˌ+Mv`֠iGff8`nޑSpE;l}uq#wFjxԫ\@_qm1aɛheop]~&W3ӟQiq/QiuE̢DG_;rZ"^HoKjr9r87ץ4\/.d̨;eɮ5i ފhL 6., n a6^DK)/[{Y3*kj垰gn(Bո X4ySe nmuqE۟,?,woN{2`[ofi V yhgζvwa\{ɮ1:h0ą e2{O&g]¦&ڧ)y^5I}j>o`j5W4J?5(ۡ{OU-&O֒ץ 5oNeE"~i݂59=Y+>?yqɪt5Ԯ8ir7v޹V魙vtM^ THtƹBg[> ՏcՁ*7OMOie+389 r=64rzẫzmh>bN\?8Mo 4}{rjy*~&X )hX~&_FbizS} }75.?ߤZQxnl*|-"i\_YydV*WrY U?<^7j (._qNi?$YvJ0eD7b2Ptfc}Tq>fkx3l{Mܽ/2fJʇE% 9 0.fݚBȳٵՙ{p[2ՌDU;!N4O/*v{§M/DCr#)ɪv'8e+nY=aPe wl>rc")KTo+ U;3+η{:n3aU8XXQSe&OT~||['.Ujpc>t#LZ"7c(x=tI۷t_K}vۙ/Y7ԀkTP4@a Ѝ;=S;: ]+p~әz74O)ېSu)h/DC?~=lmjMG*iWnHoؚCD\%Q\Orׯ(XvvkVtf ˿nn{HכenT!aV\4xUWCrs:^|7Y-1{L̆-o$qG\\o 6~upI\[U9ۥ쳫6L4ݖ#Y]Jr!,xxt~Zhusi_^`lDߚzBqCs6^iUᛟi4|sB4@@A7o Q9jÙosV_r$8i-T׹KvЩ@u =.$_*OkqbOQSL_w_i}0t(>ptuzNt_D;.~EX% M05kP.@3Ò w]38 YͨĦA~^7rnamIzoEi1 _7up]1NˍRNZJ;>U,Il^ '%bQ聋BH&lQ0]*>  Ֆ ./CB=3葫_9gh Mz@5$0 D,AMf 5*aYxge$"0@|fJ 2u m=mUCv"[5`mhD"K(`h8vVh xE`j׀Gtai}MwVh xE`ꮄh< }iE> ct@@@@@@ފԀkT|i@Ca5w4@@@@@@ދrhYghlXBt:Q`0*qP6JD{,Z_ֆ6w1t 67@@@@@@׀qĥ4;$@̦f_  hL 6N>MH4x@K((hle 6@@@@@@ފԀkn? KKH4@:(PxC -=D405kp ȡ.o+ }44 K(B:6 /XwKkڀNK.'5z@@@@@@3 qTÒO-D4.RGw ~W~tX08Nc4Ѱ(:<~%n@[lOk8ez"W6"KrDZȩԁٻӻ4=!U7 n hĭYUv" ~hL 61xGоo-j"!^cѧ8NtħN7 w3[W9="^tŷjVoX7^0N5[]2YçgR􀈡g_\35reΟwײX fFDS}%BUOh%MԽH԰G ۑ~cBui*zY:O}mq^b;%v < _`xGS.Ѭ9C=qK܎u=S Φѷvr(MY Fbш*Hmo/`65)L4a MKt_1YTS=UG*i 162ĚStO8lxS&goX6y [lZSvEq"ޡ(K3pxV4OŝЬK!Ow}t<6asa'v< >~[FժԖ+MNtǝi>Bvi)ݠ25gi/42 [ޮ|®77ר]5fVsiC$֖i}?yWfݞ ԦxuS.C]aj")m݇RJW^H_ͣ1tDmujDDF3]KK~Tzg^;+nC9R%j٦ zOVv̪XZq@;w.YW,*Drgzj7+ڷrh"sIl<\1ȂLuv<:W|㣘8ٻA9?jTٿnNۗI<¬J,5Qٖk.OUbH{W}8[8ѐA|,rPӬ]>&3lDF-V+`l:f5)U7XBzh: %JQ[ؑ]F[._jt)ßHdz@-RVJʱR5ocȗs5[)DJ6zAi2LZ@'AmɓKQ8x dAT9ZVfKK/ACo*k)TFي #]M=:=V|ČojD;ieͲ[-MٳPAtHKGpմA[{#r4TOSz #& $ϗ =,|ˑ`hN~A|\A[GU7rw~/ɋzzuzbuтk`'<+]5_zvl:޿;?I*k*ϔHR7^RI_!}S(h)Di똨"Gc|2n''`g0 @?8:7\x7M-}SW7hiYşyƌRQ\R;`V2iH)ap43=[MNg,zxk#Ž~ׇY_ǧ Y aya_u^8&W\[SP=4-*8?u dOۍAӋ2E+blexm{q@1/~Zz_62P)]߰۔zso_^X]e:52OWieYŶhY8(IRo'LWmܚڒF7OV2ID Kki@߷g{ [ĥ ~-Dq`$KnBl݂C6yR1H!: Qa)m]N浇n)&/D`3h7T(g0KD_=x4q4To+0 \m't-'!sp)^uGw)/`#3W_T,~fCT.M8١$tqI"t{QKCo_víAy5>T>V~hT/-a]g-둆P.:Exr;5ټTN X?rE"#!qYq} `b zȋPP[{kb֜*5zJ FE K(2R p iU d&r's x ״B#h h (QpqM|sd Z+2 7I0 4=YJҁCiÅnآ `'/~;%MБp8 oDF"hBIʢ` /7V Q\M݅Ea ;< w\odDz20+`Ë|2tRwo[W!^/<#'#JʾѹCMs:u5>mrM:">Ai7ENf'줋 J?c!Ioޠ]UjWy%De;BEӚPؼ[6ոn@4`C?riTx^(eE4ĢA?m7~0`5|qibNJlN7/I/?ej1x|޲TKq|֌i^/ta *},789W7Xy8$7H2م)+ +v̹n%qUJev<˔]2kEü[1Yp_q!7b , LcSpBʌ\q[tCڰA-b55 KeTno2!ą<+a%G_ g(ςF)H 1 >>>pC1  Y- #~4 wpDrs?tCY hk` yG'c"H0wA M01T!HQ{"ǭk(M)((4AU%8O%#jIX QwFcu[.8bgwͯr +_}6nCv!dW(]J[u`#6eіo;Y mMJ +Gʕ/"ֆoҾXɦ=pdTyj]zSy!x㹹UkR_Ѿ8ޣE4h_dHt_ٟa# r%~E;3sߪrjC:"bm*}mV9 ?ƭ*eV2"!}o}/לjr 7mܘzvCfӁr?Utn?_l3sWAuoˋbx$X@IE(Dg+A| b"꘩en"EuZb{h=?Pu+Q_oQ;[ Y]Ā?Jzq#nu#p-|<>S/tHN0nP D+tGK: +9Hu)V nTq_eRKx2mxLC3O@\T!-.(*0f0̀û@Q,[nB;XXc0T~Kd٦4xN"SsjLv9{݌X8m9z,q9z8Իͮ,ԀۭAkFB?yJJn)v-C#QbK'&貸رH8+PŢzi,Ŗʢ~TAdWO$1TU[6/(ʑ_Ln<NjPʆoYNndT}:= {<ѮƠDi`)_E܏P . P %D1WpA((CQ1%P h//AI(|d%>U$))4q4n%|)Ti h3GhL~]woΕOl!ҀlKӀO|,BҸuW#F,xZQp%SCX.,be7Ǎe dcu2iQf̄A)b$p"!:'#hdbx[pE4t.Vpm4&PAaF0q01IvDcOC6'$p 8.a!I2GGAħh8ty-V鐓HEj yh{fW#w$5 aGK!AD Jt?EqA@" nA5)Θ8!B56$^ 6.\㸅" 1OI ^IXN&? M8Zt1g^rA_ wEޑJ< % MP[X /iޥhHt}р;6@hikF1DvxpjX28$n"9 ao NmV '/ #[wp%zMa1{1x(@DX%nGm:eRx#D*Y)KDu[EvPɊi5P&:RXh ҙƧcAQ('W4%%΋4$Q ) "g%, $ /҃3]p9%b!7]d|dS n d .J(|LqmPRl)}w`.'&4[0ٷ_S/dA9P:qEARl] Om$⪥"kܥo{,<:В ʥ,vS^-圓x@&~5\c4qj/[N 3U&SP@THyx Ј)8 [nDQ(y K7+P)Β$ 9W@KBᚆa(4<2j̓212րϤh e$()"JYAeoAK$H|@ { E*xX@}_k>qG陒~_` 2HY'rC .<0p8ܢn uu}fwdDp݉ǯ8/3hخl.j=O98IΎM+X ٨&R){gԳ+VE'j!~؜)1nh[ԣҾ??c_EFcR5! _CVl:Aj-?2>EHI:||0#rܔIQD |p|LP_z6j8{BO׊[ 7n\pCgN]eieJ-v]ȩ\;paڟD_KO{qѠn=Zp頶b呪WkVٖvY(/RւRGAh[8xI]W4}/6T{nǙbh\(3[՟npB.1'~͆㵻v]fAE] c_qBTD+dqžmܞS}6γEgc ɬg/>nߟU3rd ✡W}voΛ`Jr'lL1DCT۸\7_*ҩ' odwߤp珅 ii!Q4PK\ZGHʇ!^#'p Sop)'O= eg|!ʔQ[x/29X 6tģ-U9a$ޙƃF̊>3Z Iq 7ApgI2J.&ܡ# E')|܄(# ܶRƳ_&opY(+C^щN(^|Vg:SEc vz$h8=n99Gc1;Yx_9M+e*y(W/?ScΝ'rzp*?xY8 h+j../F+|P58qۗX:S"E&Sleg,f,_y~O* {4 ; s AgF Vd_/"}֙/22M{Պzh(Loxd{Ngt$KSF=vB4" n^Ǣ.=(LA+M j?OOosXP0̇uGzUݢ'(xW5pK͇e]/Diz["Yt.PGCs87fMF&`u:_ axc D;vX$cW;w\6}h`(Shh.֩#1ff5W.KQ(]~enfNrIBK;^I1wS:X5%qtU]e<Ӣ]2A#֔+>vrrXgyz0^Xԝ=|3śoQF,ӄj(  EC) j3>Dx|E&4"liwq?M_ȩ*!pnPu)w4#^AqK eJ$9.E+U0?`p )Q8 ) ^72ٕp,Bmʬ6`vk9j ޸gb-kA;S%'6U4ː}ڊ0ņ{W$;h2,d" ܏^,,sSqpeC{>fk]dpO>TϚh0<'vh>cs]+]>tgSokvrmV7y|N"Ɩ)ćM)Y=O8P4TYAAAh[Wt>/mn#1_6UyyTCٲjKs7V+C{!\4m/jF赬Q{h[[|ĄhH۰/Vu }3q.-*6ԉ g+D ShHZTYUԗqR?IlG.3DඔQrlXszdp[b6u󫗝c_˜'}r 8 #Y)ehAhX@1^4lʗg9!FǷ(+HZc\/RPhnI^nQ]i֚yo{{_Lt;18c06`mL!!(sB9\YʹJ*U>K[$kjNpSR3H(X 85foKkuYSEs2UTS6(S:IL:9 (xd&ug;3:`l) EE$蹛J0ÐDP0'' `dAN .w|M^E¶ڣn  ~U91$ Zܘ(>~2 gYדRˮyy!pPqfS.k\XLnҒTjSד=deԷFWƴ3룪r2MyGm +s\2Ypص̳1]x#kȬ(>pF$jLt*#8kbDK'~ܝz!Fm.ɜoE[0 s6$jcuN7j+ǵ΁]YU );y!\dWry{\rf1P:W \Mu=^c\MWXBo T}^ G|:Rd:,qŪ~1*J5/v5> ^*5;yC/y/[ߣ9=&vs3|fG}{?Wå㱂I=znIޜP /2Z2w7r }ڡiK LYuZi|p'|\VuCR0THFo/{:nfOhbQԄHҚY$ \5zY:(jB~bk7{"(%/$)Gb͵|XAE.ūA%$'yIh)L*#.kL0Q4 y)Vе4#T %I+94ؽ敪XC6qp*Ě"YFHgّ 1-+2QoZp}B45gΗ6d9:P#t%hG( Nz5 [7Uշe7,3JNk!~opK ZAOBnj%/CM}X)'T44&fjTO4drt:~4zgР rZqA*ѪIcoDb$.D%hf8:"Ѩdvh(ۍI./CiM^%M(@ i 6dv&{y#fFx8U&z̎#jpX4^/e?IIh,=6U#9hۃc: h;P6 w5UtszǴj Q%oi-M~Y3ke2$hBʟyitXVc Vdِ*|9SĪrԏ:L dvk 까Hj"ήzɴhW] ԏ wtJ#'<\]js3O6eҠHܽ]̚ Pgn~܏b+su_`Hʽ{=N^8'|z9snS9gJp v!X^*t-LG<8|ܿ?H <?tE*LKzQ_&LB׾se"a;㶜6vA©Ko B=?siϟ$ w>I$Gr:5v_6 67$h}h&FOT38xMTe=Vjk ӂHͪ{dujT-eF7C5-NSbb |;IdyIw=#hPEc7oywίN |][ AM !h,h\WbJfuq|[1`a7hh8~N+ )Q;4=4?N CK9BoMCboZ JUxo+G]4ܽ[`9/F摁qZK "4Dny~]S1il2:&L:tQ>$_y SZLu6sgK@@ÓC.0K`J?\7$CtlSX<8w1C"*lfZx;5=;{Qv?VLl͠ >HtmR٭L.!op曀ps0x<)̚X*A ֬3xwrWﵨBq !v"c܁xӫIb€R='xf}yR"z3ڍA,v[? A8t|&7XdUoJq-Ϧ;cbJk`/޳ Ib sFGEꀡ }1l9mRx!{dD2#v}:fWz1\##F9I:ΨO afJQ!\v9!'K_VlVk`Yw!1Odvlj7 GY2cuto&c| 8||/|"!o$-A6Q "q^,!vϩ",CGKYZX #fō yHbAKyR ݌;ba tީ^E`>H#RsNh`% :n a0;[&)اP$M%1;l<7ZO;~މ7Ohj<b :ܠ xԄE5WbIP&e4 :HiMl+ \.חHX2zʱ~+%({a hr꽽_5.oWXPw'T@r D؀*)xCs\m?a*acg+b+O 4PYv 4P@_ (R31LI,0#dy, 4h9-H]8"P3豒\IEZIǐ7ZضҼsE٭"牊4  Y/Wju;+@njd4!࡙(2,82v}?J)8O")[JIĆ~4 qOԄ,@2*FOCj@g hx,x,-JX^jtb6O[C 8ƛE<,XǬ>17M"TzMhq2H̽Tm4Gw>'(KAH]% c5`Vg$Q00=n^ql@1XRqҶb+b+K  4X{%ZZ!Y Xv_S#&`Ϲ`7vx=Οp;.:f ]<K5imFstfMf :-F9852{ږ!hUŮLǛWǫ ǜev˜#"CO8qel$~`12RHJ2VH:\sTt)O=CϛR]|TȥV1]7OCFrPh=n12$-20EX^‰Fk X% t{q‹lYDF+^x+!$ [IGE؛4-H~QHHX{@Ÿp"b)(”FpEéš5 ܃pU9?94jqՄ>@%9)؊R-2tk8a0cs蛿Ǽy=›X> 1Xz>x)?I[k @!3hD n3[=-%M>l h$HINm-SRwA΍5j;X0QX  XjB@20lI &IHR U|z:[U($j=[s~CI PDx8U[k;JJ^5Q3ILj ո#5c?BGHrlVliȋA=d󎐔.NڜdDƐo4>&@QrF~f$2 &&8dPO5C4EMmsg7kR0Xe iᦙگzM prIށoPJr\*Q +4ۀ8bnNe@L AQv:ZgXFK)h[ ni5 P࡯flNئNcR,caC#BE0E"rfʆ[[ȐM"lxNuFR-Ge$R@"ʲMAc [pXSܓIVOxD偤 3fR )W&hmI +j J{Di}(rqfehpmVlVhyKi Bȃ'3BO$Q´<4gP! {=tsQB9æ4ֱJ S=1Pٟ8!ǔ1rM)29"11E){5! \2f0tKH$񓜖DC30zR2|LN9UPOfPy8azLk usвc b+@[KY*ֿI ;PsjÌD A@{ (Cb4LPNAtfmH>AQn ",*5 2!v(W ΃@z(QoK5M"bI! 4؊S PBA%''𮋲[)5jP{;K z7 AvQN>S ETH3 yH(p''Jgn/ á@r~+mʭ脑XU $aAN<(WAk) G``-PO,6A` ])Xk@ҷAe7v[[yj0PKi';YXNDYbR10" r'[:(7<0މu (Ո \pJaC:(2@p}}Zr0R ٚ~DfCTGLT@7OxHk>p@PLT%q$ۅ0IЂ7Uh$/d b+45 p~L Qvhфw'OY!ѝ799z]Srh݇tĴOi)< Iy(ݡBHDOѱdAEPp(I}5h3} v'tw>X.zP$݀e*TY/";ʊ^BuA@ x@B<-F@lIПYW@؊<5@9/#$6nXF9RBzJ piZ:WEdUG4ؔZ{CQdm҅bh^o&kof";~?\OЉ)7P};(?^R2rWQ؎^Keـn Lј קDpп}Uu2AÂ-BnNȯE ZB& p7lVli_BЀ!(P[A~ȶ5ZyO)0` ;w=7PKD9A(JkoGJ(D8K~ yrmA741J6fVp '@+JC tzP*"*a@9\Qoy{0D *w-h {2h&VlV~ @,!h y2hBRJi%(k(Pyvs%f(;=gPxX#-_Hd?`ĄEAD@qEZBA?k&J [j Y+hO~Ds~e"L&d0킜=9YoZ#B|!!584'Y^kH\ς*=[_4@M'ONMUD?L9AoPIT(v)Hx>!$5j/N㱓M( s7|Vvr@'jmB&22%+8)EAkR&ܐ I`NHɬ =OdА{IVlV~ @ryt'J@cM$SiP ,3l ` 酬M=LED ܈C5AEYHH AÂVvA@FJe!t#/JAi2n r<WIZ*<:B ^9o( ` P(T( m$FyhN y$K>"8[|W_|3XArnw }Ǟr>tUFo|fZ2rM_sm`؊ 4,=eВGOA}Eg4oW^U~uImBWFH9\|swC=/ޓ"E'+ݾyO;xݱw^|v|?:ٙÇ6۹{\߿a~>u:'aB ]b{ùxpi'NR~nNm YP33 qC|]TjznfZZē7m+zcG<:]o-KiD뽯:>U3CYh E-Sjj X5SrVi[5\;Q5|f]8)f]y45x~߮㕳&/.%x%4?{M޲[{JϞDգ )Tou"w9us.^p٫Y]d nw0"_~7V|mŊ7M53y,fZΛs0hQπݨ5ƒWVrQJ9//1Z@X'.e/ `%T͚ĉnNz\NڸqeAIu&+/g}"t϶Ϸ<* [²h8H3M6g|l1^ϷPxLt_,$'Xn/¼FN̫/|)7ܻ}lD)Cd gg5ª/.{~4 ;h-OyֽlWҟ?P1kC?_3% "t*V'Vy:9T5kh~oehQ_[bيqE]idѵ˖šMii* [Dr[ 3")2J PXTL:"[͙ ŎOyzQD>X{[كL*!F tü< CWsѳHH)ɀMY4t=y+z44VzMk~4P3t"RfUg­^xkjà7`8W>kuMt&G@&uz(iQ̂3p{[ZQiA#RBGjXpk *ܜI2FrѠ՗~t@6k<<A7F$4{^ ץVfMFB:^q`$烕G+:喾,Cu5  %$Κ.6t|ާ%3 nZx^ }Kq|c e=J0T3[=chF}۲#~Ңҫ}f5TiwV}^ E-aپi*=6J=1~%1Z08r ~K ,'9!o2.yV:f䗠D$Mpsoe)q֨nMcW/CCP |*D=m*buBbd(-MΉR. n pQ7։s D6ÐrHA I+Ňxc.?`vW] Tj+ n^3OVwa[XG6F=NIΠw~3"㼋%8k4$:_ʎ*q<ҚލrTl cw+5]*}GFd_TR?-묺y>&`8zL{'ڣ5?n`Ǿnn7.HA'KeޯW=BA|htv͎߾g5]yo+JA8Tgێ]s35iz'\]<}(+.XX2k*K/ݺ.F4XÕ&Uۮs"v{vg pwk\SܝVL%G׼炋ӽ:Fz(՟spu;ajl_ n L&}&2oKL-7dw6{gw!GOҶ?7p/1ײ\ʪ? S_#w1Рf7ݼr ;JDV|{徛o-uji&<8m ,8g ׷}Nv$]Z'goE=oΌعv^^'cL8eO44%T~C|&Pz΍sR0)A$ fA$4.P?A *;1P#RLY*a@B0\s||c66T+Aޟir)@pP5»3EG9%}#cuS'bz$iV6t,y46.Mryom*كj)ޟ}#%#aܚ*NxU:SgmJ_A+lomkc~La!Fzkꇬ4Ya<%mřA!>[luєޑ1EeU'EV=j#CK&S䲒 K3ڱVs'[["9o1"4 %*;hkߗ2;-k- (2noia\G9hC-͸6TsAd&GWϻ a}Ȑ|ml j4718?2&8myi%Er8%)KIf?`TwVF <5/8 /xU&6KS~VAA?| SҖRzg&PC"sx2c驊,nn`dPCQIΨS@&;F9Wu;f ‚C k:T茂qVLT8ZӰA&џy*!8%x&ߡvJ6H1 +/iCRW  m@іP) e5 Bb}Dm$ʌIQ)N/@p2BRN+O٧>$Oӆ*yF3^;m֞-i9.{ =ǻCRf1~Ä9_ᖢ('˝_شcܸnl^ ֚Hd_ТO !y?Hd0'0 &UCQ[;0RNTBk>xXR0L!,֚^Ϛ:U5;;i]! 0O]Zod*|Wڤ]yZ1dtE陿ݠVdv*FIXPw-q[>uA<)R"P"EN!VV\l+VFuhѧX[(;J< LR0=Q~ aڅlrlӥrX; PyzVcB/ >P \T*U`FgL@8xV@h`ex~v^UɾV:-`96|,a̖n]dT[k$ADĒh扌ϭBA텁E='tjI(A)-ŶH "p]``*"$Ϟ#$ys4lD{t@QoJ}M')cU)hAbcma+!hX0ʑ\žo HDPҔ h';$Uv8㊹{s/υr}'+Q? &*gHK E>c.=@R@I4R;I F-XJctch(h [y>5 zbR~HDB#F%,HC ];C@+0Q-T8VAPB7PPQD̏u*;2g,zfO#zb@`’dvU=~Sf#)F1QQ dE!)\6P\bH&@3i3<*_Yvw<>JvlRV7Ѐ `J(G)>%fJv@6R@2Ro$(Lr  $8xh1QH HF (a֩P!$0-8]AUlHADz"'IE*9iC&I2w.5h@;1FL{j1C.)X+AHθ͙<®?q7:t=v". E{}bk＿%{V7޲qشuoJ#2.mx>|֤z>M}q,uʕ82޺y+%('cB7gqpfT)[7FĝZ 4\IKmCcjQ:Lcۛ:$aV)>)'|ːkftEw'άlj-CR_.Yh5EruIFe-dۤ'vW03#;ɿlqA{-Vԃ ިwߗ̕_mRyQooMwEzb%/)^F^4Ll j i3+l]DKhƤMj-.~V*,N&OƄ3j9BDᢆ!04usRa4:ѱ'65{LjV$m *i/}:dA&DYw"c"SDž;rȩ5a"RlXَe! @)@Sb$~ 0V@ ٬It ſD\!9%G+QuKvQIj+ X4OX%7O@᥎0%KU_fxV6hyjXeɇ}?14e3_D') UM-j81$ʩ6̲qrq{b&ל&(c퉍,bKJvٜHl0ty_D%Wp"wI_Dz[6g"pu6)b+!h P Ul$5bP~C72>@52 X 84ڙ4 } " C'jr˲:sÐul-: AׅevH|&Ϊ(Mfţ>{Li,,bSgR@ RKaL蒂J8ߍjOHzEca?$zg}WP:8h|,aȳ.TԔ%xS=fEj"-1+>GͶJ5"Р畔sp }G'6(85#1 _5.~JMVECS;RFe쉋-%bkjV4(&'600pve||j'xLѾ:c:1!44PU"x70e.C/9P٫Pxm. ya3s&S B:.ڠ Z@H#E % L! '\BX_\AvA$DؐLΧMKQ3r4 jMIC+89GbxhKk{4d^A?I+iАV#+h`_'鄷AȤX=k2; }<46D~[}$_Jk~Ӷh84 5S?xU ߗurT/JG3R19%khڸ])!\F5W6l5zAw>/kux+s]J [y@Lǰ`4"Ivg!JLb[{ >nCdd\\('Nl,ezem`H7!8%GnLu&z9?!s|ϭFiV4%~¡1YNR/qd&T_f<0333Ֆs >yp\E?Z_6Tf!Ӝ ۂ *M#h}3FyQ_˃WX;gtP2X:sdb7۩v_e@[Hەrэn7)Pw?IGբc=w<=?Tђx}';˒\B =kC֒[ҒSr>"8ӘեYf-) ˞!mٲWXϰA&8|m/]rHG3;#8ꫯxmw2Sw'9Xc9б:W/__0 6{+?WW|;N~&JsRvy%㔘w,)rctƘ]9E(Oc,%ҋ+*t, \KMޝ'L( %3Y*1s8LkWIҳ-&u?jOb \?[y>@_DE5>R2e|FŞWtu܌-KH?"hs9>"\:3.Z$5wuJ۵KQ.b&?>Z$TP\Zc'HY{nob0ʃnT[TV;WM((DmdȆj-pOfBJ63C;k3X-Ԩ, zź`R@m` C=QM9[nrπL]>Q@3`҂Bgҁ ǷBnv/]yco6 42= ZY+ ݷ vx3Absi8Mbz =X4Jhkb27Q0D(QnEul)!+c2v:5ezjk7.si3FXxx2# s'$Z頌a@-*pGF^,Gbij˹˘Zp[w:p%4O=i2shŻjaㆂ.)"F4uI'?]5.l2ꖶ t1-1Plc{to$_:Gܦ4H};mQl$[y@Lhj`1Ow:8BrkK)}Πλn J9Kρj0f( Y8E΁)44Ї7"P苤~_[zZ(> ҫ]W~WpVju+ƈdsO㨈,9愕 1%AW>)!B5u4e\[Q>v&Z qP~v Yph"A*3`w#+3[ѯ ;ΛwULO=7=U-NÂ~"ϹK4 G$ϤyB.-4 Y˴KhϊuZl_2һ{B'ڄ0f߰oZ񸸯YF*E™_ԨN)r(ረYXl9gL% c1Lkt*o;_v7h d\ >1 iEFMbc )/==Zc:YayA'ќ |)ABbZi5 owP&Yv鿪ͤxWeT>\xmOC/\>Sy7i sWvY<[T eoDx䬢,?F[j}B7 aNp3OR ylrrb`R ܌BN1Y$<0{RUB.=&kq>#́!7ܼ>0=nҼT)8"8{B89 d0(H —+-U*Ĥ@>gMPsǸD–\l@p=ƕ(SwBgէҊ/m D< e>m1 ك~; S簘ă^#͓R_s7Y|++y4 dN_%i b_w";\ԥTL쮚ؿ%kϬvQ5N!OiDsBcj]VċXcSټS\wd[B[!h&EKP{G,3iuɆ0OiN~unjCs۲ނz+]OvW =0ݩ*K}5EЖV>b.مqɍN~\v+WipA'c;V_*aj%dŝ$=o3 Ӫ Xy^='23"~qW.E{&Dz_L7>~G@PJrÌyajJT0C&0q61PٶHmDUC "2\Tk읔:Z$ԀTܨERIzK$ ~MM;F

{YGAŮF3hti85N۫APeǞ㬱w[DOǝaIf5e]t ]G|"ZF+ *uL7ggT?/ T*sJn+E 0Ēz|&B 96?rl*o~ݕTzkцnEW2b (gspZŭ>8Xg8EWE*jVS\ϭAqJg9{ES#tzgC{`_ XPi@$aVZT~96>xGwb2;GW. 55J9cjӫ#l\<٢ 0U'cAK'QwzioӭʼBIkR_&S{];dL7{}S(뗍5w|ה.|h{;,|>3䌍LG2L*5kvt mp#jxsZzU~Z584/j–'b:X|bd>2/AIٸ<[WI7|l_1:زnzLҊ_*k^8cxeҵw˘.u{2b7O%똅P9}fGx5U$%ds6v35zgC mg)l[$RXLD1@4  V0&M"@ZHw]A@$DE Ap "Y hWgP+*;> q=;C o]>.up.rx$RWMo >g*!jonɷ_zpݟc]+nwioCBVLFN<5=_Ui\\v;yb^I^gyCPZ{`ݗ.Y;Z,;NC/8[p.%#U^w/crEiiEm66ݧifzݨv4z<9]="5C٩*]}m?{oF Ͻ֛Y̛=0tafN'3'13;133Ɍ2Hf&ɖ,KYhY+e:Nt^d$gh>Ԡb T4(dy cmZCz#bg0^jeZjˀpm}*RKN`ӖUtrqBKlPc*n*o;^pמV5*noUå޼9ܺt鳧OYE#Mn\|w_#޲vrm- bhoz-6lڴsf/8?:fղYk7Rc[W-_Ӟa)=on~YQ4oZ HX5?k{dElQ(k;ա0eL:~ͽDtiurn}* ~`-mp\XX@+~<ҝtka=5*E0昊0VZH'&2Ὢa72? DH$@ l=0@AJ iE!v C|~dא[y[cã3H)@АlTjQ97oc9>hzGdpy6ɘR؟")_ Bu Wʣ3* b^nfERpX6nXR%8IknEFԡsZ/{1$]3!nŔĂVTvԲjK՛ E vTtX5^$26lHwRc-TرݛМ%AQoL-_:ފS_tWG:C4PZ* 7 U[Ƶda=br$PBYDC|,2=h`՘wiD*~Y?GARniK_l{4`@紅X t])2 \hk B▉Gڻ4;0F_iAC_n޾6b'HƧZ1\mo"6:* *?C.`Y |WHr_U"zKIKWɭiomK{uW^^;P#9ֺIn,}kfVMaP~#2[:J#וuBH[`tZ :;^r5wCuAzhhv֣L<ㆇGGv2^^[˚>޷R8]yF]TcNoZ@+] ^\iʭ7 б/vSnsM&詰:T_ !\ ;mjNR32x4P?zŎr\%z Q͍LC!"{e>h2>]f#)ܖח 0Άvg39s8bH{B/g0fU&WtwCU:)q1(qx<eJKe{*֬^}?ڶkˍ::0s6Ž%ڵ}ndL!^>f>V%+}w^u~KwؾBl/Ýv$Em[l .T.xdޤAf=-KT13vښul}-[|,Q-huw\au+ՐlgPHUOiB+e]&Ձf*l\ % Ag hLCa}GD 0@"-H@n9,GiO "`  @4i =A~aV!CdN|}XP(H嘬ix20pz@#vCZZ!f)ƹZ. r(ԦRZW[wf9t7P1#A!{PėMDh-ԖJfQcKWICL\PSE{]RW;Xn7K e|: Cmd"t u 7a\7҇H!<4Bd?qAp KUc*Kinj`eA,uY9jP4Xmpϖz(5r dPJ!w !T4&ۘZ*1ffi$/mTKr˸5Gi-Lb v1II2`PR-U^ȸv0( \>Wdzf\pPB Ar!KeGՏm`*.f.FfDg"snX5mԶ!OFwmEP 41jp+YzqHr }dyz$?DaKRX.ؕUt) A3dMώ>S/@{ײ#2[iGH"Z{yO- 8VȬ 5ٛ HyA" YH ZBj|!ClWPnX ' Jl41W>E}sنKԈW5u2OjJ+`֠_.X65AL `DYh2ȩ7hE嘠2ȏ`dU | ZqJpH BB78)RAx@Hܙy r !HU>@7]BD7}f[dcp,v6\֜ݭ~ tE( ks|d?B"DAq2 ZGZUapb$\ TD_<([!CJ2QM }Z(dVB"6\"o8z'C2*ugJ~ubǣ%: ZIP!&y4ײo/ofeZH vwL@!ۑPrh&?R;h s!8 2 |B ]*pjUF֍ @+`w \2##9Bp&7|yFu=,$az1@1їUOD)'g=F:WO=jU# {RJ1ay9Gsx\e]dIxJk̳ٞ1%I1*Dƪ(1??*10>"U>sf|9-Hleȧ񜉲ҿA jP)yQҘV&|GaHo+;:lMY:}@[R9$6p6@ Q^5|}>%Cj~!PX7l `-O _|!p RJ =nGDyR5eJgԼܸQ,bV[[P↚,x6‹!BiIFDJY;G+$\F\A#0B\2XEBPuW ;FIDJy`C?v&?_@A3|9id`@ 8f qx\HP_ Mݭ؂v"O hig+EEhDJ^\Xg@f%0 pzJR!IfQ0eEUd鬪_CS\y @ܰJ!SzE`TB %Q>g34>K"fw{p/[0PgkE. Y]Fu54!gT$WGSAvxP lDpF=gSYёq(*th ;ed>o|$>p9y+=#g{R#27E/úP9SӒby*:y^Рİ`&3rf_Wz '{Gf\_`17KťG:\!hTbS6nSdĶ&`卤z7ǭ91ނuE*ju?ł,ck$LTa u«a@Nh Q }P}@qM~,K =7E @çN|JlmۓoqLtㆷ bޤ#p+P0cyd6xJ%zw$ `EhH?`16h4Gv=fELt+gW~`dKJJ0LUUP555uollljjjnnniiimmmkkkPGGGgggWW===$fg@ wS/3= Qa Ό M侾>ԫ!" Z.`,{I[6`tttt t `OOϘV-Y =xۏ kN:,\{oڡ{ z?xG5Hoygjz@L 96DR->^Ŵ'8fPфgJYw69vo@hI"Wuڝ5s{b!3+L_4 ?=E 'vZS^Q<v S;^86x n_d pʾ-Pq+DdXhgA@BZR@=5M joŁ.}\}?Dh4:`0L&b###`PT;l'((Y.WphQ_!(VRi<\\\4́FAӀv ;@@GԨC9@;;:;;pLLٕ틖&d0%:h(vXd3I GH;Oه8sWIכw$0괌!(oȦw#jbd)<j.|~BB'uLfhla:)}kx/uht`=dN \eå[| V-jҗ7x .)b{XkY]4=Á99uacӤݮe(ҾM@6s=33Um/P `S젡4hӂ`@hWCid[^'C#S e4f ͚5 JИa`HFYx Kϟ4|ԋu ɕ~ .VGh@{q'd] }-'+od}G+z'pUO6^V'}y1 ɀP3:}h B*Md&!dd? TCWGO 0 @TJ9yMȕtUftƘoFbhv2Ŭ &:;pb@6P(Nvv6QqqF6 Y'G[AЯWAkFG;XR5jg33 'KHZbP<>T&,P*Q '&$Fu5Anw,!1;hs8m,hu 2e]$kW^֜LTvXѧ*ϯY{NAy H>^RУPEnO٫R/I FohhhjT@@w9X)Rz4qs 4UIhݯ+Eeq}H4@>>>@\G%G<[5!mʍ wKbģ _Ըnu1wFwɠN,:@\l a5 \cF?Z^V$0zxLTe\ k)${ fnTϮbݽ%NW}Uc11c UOBhlhX H3[ԊIщy-8cYWyzlljzZ&q{l>2 ":r\!:L` S'}ʠa7 pϷ /P-|].Ъn{/pss+--ӤA | l@u>X+|h[v6R,I@@ PsQVV`ܧ^])"EwEc:DAڋÃ869̩NH/ Z-p8&eT7CpdOOL6[<@mmABoXk J*8Q ooשּׁ,&1WZ1~m8 N21M|dlSmw4@ .?y\ė, n011>:ŔRlVخ [9:KЙtR) B1g~U{o^gaR116+p...EEE@W^V6LW*_aXb9_fz(*N< BƑ5 5]΃_o}%X穱BjYy\|pC}4:I.VT:m^ <'tg biW'`T.3.a2b>J>`I;l"+@;SzGFFh=]j]J!CAIdd$ Ż̧ K$7_kZJeJ Be}Kşszmx\% ƣrRJ'@]+f&/?%1\,k⪡ si'ަfy65kW;0> ܨ555j V!,nґq)OжkCWـcu^,U'}.YaeիR> $ "p`pT*M\| JaҚ.T+ *p}Z<@W)uV¡~MBꔋUvCF_L;YHTnյmK=W)b^-]nмևUF]e7n\ݼ߰TSZ;_;q7lI?{߿uİuD9b=7]j.q}]@.{z~O$RԒgObPZ2[ѯo;}XW;{FxDDYYYyy9PyUN4ooKxjC.^>p1a$T NdX \`*sٴdtY @|JJJssskk+PPEai4P@k v ;ZE$3| =K :yΩ)7I~ t:h@T8|n'iBWi;*%tΨ㮔IjڋR®5⻊z3mJwoC3=2p9హGU[W+vcd*AYq5_VTUGERvSzMv9QD{շ`~wJR}f70+Zk~\kYR\A(]-E{iعAU#F5:/xWw{x@C_o窍HРc6lUU,T4qN$;tx_F0L!#h"uwwpV7 H=(Tu]["-W`꠸E!9JGanVտezz:!H$l@C!@{a2r_+ Ho¿msUd~W= ^Ԓ!eUF@qބ){ MTNK Td$Go_zX.pjL8,D\.h iE4)f5blp=:pA¬iHG8k6b8nYeY%UJKoUhe~xpSX܏y  x+hzi5}x\. ȸudˇ^6 4ȻcJyU0'9޽c=XHή|YcGmH,рrd =ןv9~ЁGN޾/RffkCvJ\D{{ 0H()z?"'h&Xdx $HY9>uY"ussBDeaP+}WBn]u\s] .o\LLLtttuu5D"҃0;h@,+hpD#i}iNPꀀXD\4A]Ǖ ej;<.jL}_@EVA1MHEϤB\\YP&*nN]{`o~y Ϩ:NMGy\dBZ{k+'TEmomX\.[zI#~8E}^̡C:; L.Wh$Tr8V,*.5#55=#:2* O&4:::66(62{Z>,B9@~SĤ7]xroh`n*}N"`xK26{ԄbЋOi~G7lKJu6ضVl?<.\zINQR/;z^ pDϷ\VBl3~ h'8`~-EA/N9m ť`̹`cx8:b@Pd!222%%d[Nq8pqqAliI)xP(lRW%Ou6/ 4@)y@Ӏ𱃃Cqq1P0X,p $doPuu5࿨>Og?D;6 @i>62>H9Rw"A#0̦g3s3] $*$*9EBӔgiWW> hhO\](z;"Og;977ybt_8irQ)F[tދMu@uxHBiJQIge>ى"Q3J)!џn$UylrU;p ImTL) +Bz-[ E&F69O(4T1SNL9nǞDzIVNIM2s N'ͣRq76(4Z@@ӡyJS ,U%ɸ~> աqץ9slUI+ Y~^ &v1hz񚠕mba1vgPj Z>{bvWBYڝ+i |@@ |w7NL}7wPMn-m}'Hyqe}WOo/eTM#MEk7۩Ÿ Z⁹w/Rr i #5?Y+3{k-*|+燋h4x:89nқwG V8PWr[ʲ#.,Y;8g1v%?r|W}<4PjJ6| eABaЀ`!n m 3Y` JzRYY̧$l)cy#EUvGEb\>'ό;0XEDL j=~lQ׏͠VpJTcv+[[tJg4%&ero_}p+›R1:p8V^)+/*y?.|ӱAL,|Ƨ@Iy,B\\ FU*QOhK`c@@ 4 ?ZTZA@!XFGfTSC[76vƸTE:o#`{Ur󀨁 pm~}zf}QtV/Y٫<7&V}lnjf$Z{42wڷB(x欙]O W36cZ +Y1Ol}ܙ>7 v ϨJ{wYJ&0 _Y1L5nx-e\=}G49aA~꯫ MLlB 5{/3y~豣 깎\`\{yNw&6__4d.G6\648f\|Ld=j6Vw'\~ښXD,FݻN\}f‹[w↕ݳ-ᕒg.jM+ܵrjglijA>JWP3h={B 7|(Y(J? B"2{R@!hPɅjވP§u˵SY`S'<ނ!IяJ\̆),&6rLŭw;P bQ9lP"Id.9SL`\bZXhXP9D(ByK3͂.,iLYӻ F\/rg/lxbvӃUIHNT"c?٩@p1MR0Y, q}}`^5!+JXŻ / `wo/3 cͤ%"1\zE(O$HPasJdbP*!pE\P$+', v#Aʆym|n}9J[\!%=!u!MҢ 6Z6bz?L|O2rT%IU r'q^ZrT_?cP(P$.VJmQ^k[rnњ}Lo>T*V]]Ҝ_Kεc #ߢ}e="\(PP߮wkxdE&Ku(ϥ*"GQ8]dwoKp<Uu _$РR䘍E2X]t(F}}pRXX(%\& \/Ҵ4()eMC|d]GIhw%Z t3Ԙ\~੔ZT&Ȱ? `ˎ 0*.f>_3U2ePf&yygNTGc;t!)h =>} $T ,2}, : c5n6$S'=ZaL%Ĕ-|Vd?T @?wԫHA P㞸_U,7o嘬Phshy;k؞(4=^h@TL?(Z^=~aeu#** Rf4TRvdDž=oT((>wN˴Btb*h,ajB"q"@CltS4pkb׫}aWcN1 h^ &Io@k`2s"##}G$>H {am baW4-YpJȲI`P4P;_SSU|y䎷4L4DOف 4iUX00RT}1%^~&dQ nx$ 8M￿~˖/ :[u5踱Z <~Xq(/؍4x9mN ] +V#Mޔ1 @íMrs p"[zw-  a(%3u:axT+7 VX|=Vۈ^ W\s胒|aɂIQ48y#s&eo޲?V< ҧE -Zs ݦvC㲂^XS53m1j`75wRfqu˂.WF`3+IShz]Xg  (azKN+4@^Y';c5 MN NZ H_Lt iE $ B ?V缯6|&-CPo%AvǼSNݡTL"Q%2D.d$\7bѦM)UǤ䔕TK[}^;RPn~W:)~]Q8\u UIh e:Ux f>Y=XԚ)k^>hHO6$<+20*l000hlP0H`Kf A aF\8$h,i<\<@r>f~_ISj +hr͡,o]?IM}|\6HE07A;iP,b43/rwjX!Ԁo3pLhIMJOK`Y6߈ ?Mɕju/mg*|~yplԭ 'X<|$x~{kР7=֞O@րncF d{\dc`bBݥlaSeܣC,!@M'v|{9)1*!9T&<ݹ|gxZbks:,4C323Ӓ 0TX3߲~ԠW|'M{_1t|~߂DžI2rDV{| Z?Zpr4jsd}Uw[NyE'ţ!*6|uuR|Djf.T]-+:G&xvԒAsѵ)<0??pJitBC]BTSV8DJ)υ;E>ݽglPކG2^j,UM;SMaY60_xPa6?ZR3^dV>a{bX$ :`ƧLAa0}WWW0u  ܏\z4(%D/'Z)EWyz:0RF-WA(jϮR(h}~U<օY^[ WU&5 m,(qzu=%g׾~~!enEP@6;8i, " Q%NEQ >7)rM|~o wT4h;Al|N׮JBO:*`űDzhe@~"vqqg6Gi*fqOhB 3rOy9*FfmI&]j{ *1YdvO썚,Yiam{1dz&}0+-, ܚZJh]_}# 8WSdIJ v. |'/lj;9_Ē9^Yǎ?y|ٟ3)jNDq|I|TOHu4@O1 3[[[0䔔sEHP|d8^[EσXC(18]舧HDE] ӿ="߫^3WI|zpy.8}1W6:45gs#"Ho/j* p*5gw ;Ϝ=}A^0d99|~f%7_*<y%gP{Som-ʹq9:\yp>k?,4GԸAbm[s.yf &WʨEdnw $c:lA3'GDD̀ӕ#6 ݠ/ۂD"9;;gff%>%TAӽi|ZҎp~{UPk=?x]D >$͵h,ƝnJ^UVWRYϖ*qySoپ6 ~]U4`qm ۋ` põ)@pH%8f4dՕU&7؎tg 6qkj ^[[nA!Ch^^^].rrr 賺ym;21g-^0  =d&B RiR)py"9V•Lj4O)hgV~B":D@8/g٥Bapp@[ct/7)) (\.!Qυ w]Y` qdozЪ~͡XHʧ <==!6kX䞀whA.{qJNN T&*b2 u\(*cpL`rz| E'.@f `)))nW OhlfP0[ZYar"OJ ͦζY _UBK 77 _3@& d ^ d ꦦ&>"0q ׺ NɯNm'6 x>SMPci6J<0'}&` Q1p'go:c GN;x;1 fsgCƻG;3BJ/M6(2$M%Azw 666`(drrrJ]qL@@@@ȶς|+..0/qy?{Ւ|yf{n6\**((*b9d"I9 MΡhdt͠ivկ~u> (@c@5{D"SӐK*Xc 1;{IH$>rx<ۻw"5C EˍiCI0<< j1޻wOĄj!UP*r細 ENsX>t4d#tԓ7>3zdU&G) Im(fVK| V0% :n6|S;?`>Vְ$ϿfkWIHBf$RC]S@ t_^%tͬⰝ?(=MFCBBRRR@W642Sp@?Q@~ K@c Kb1XΝ o޼r.**"H]]]`ncRɭՕEs3L622 Ӆ` ?؞UfTb7f6D3y/9 MdY67iIW{?(Nb^ l3Ⳣ߶UU-]^ȝ+#.XŞd~Ʀ#W[5ݩ썵XDXNuVtT-3$|K$.1H\n:|[Ӫ*(e=<m:QGk)7dG\RSӍ;wI%Tg,WS|~nsͳ]83g_/ز"0a:::) ~h ]i}ꀑD7rūHٳPtzqQ*@F06@AAAE(GAZls΁B'.ZzΨgL! zTq]`%p[@m+A{AJI8KW#8  voCΊ͝4U젗&_?~{o^qbAƯ]Qk)y iض_$Q*5!ْPd|4Z.9T`X+W8x/d>}t?%%VZ%*ԃJ@\ [vBϿЪ00mg0ۃn"5ૃ?\bLIo~ O-Wu\E[0X %M.]WO P"D4ӧOG0`77: @jBHtVzΡQAmP+D"靝_zZDi=X-uf3 %r=<<@W>VȬ9=:IMNh}KV}.eD\ğkgYo Os%&t02XDo nJbyj_≲/.5yDzF_?}4tc+?z߼MTr=kR4CtL} 4qo.\T5T~Ւ]eZ@J~V:&oRV\/ ,[ SHLEP L9QZ6X78GfKtY|Zp8\AcF&T20ht*Ac0Lbtvu }&Ĕ s<=u6aT* á{( $%%%&&pzh#pL6;JP.(}?Id(w RN TJ"ʦ4D" %"\h՘#SkӞCґQx JP{uo@` L!!hUohh/  8^pp0lmО#Z5AN>$H:O@'{H NҠV?k5!$5>C&Ao:ohjO!) $ FǺS5<<  nnv|^RA#L*5<̃NA71h/,<(TTEr ,c{%oܸKstY za h/_W4PX_y3ܱ_I'IZ5 ͷUABExT)vEфe[tI(˯cgFQ& |>Oa-&08Es!cNN !8QJZI}[ZIW59$F(AѩcQ92&mehDڦw6C3rӰI#(~+U-@A$U`(AHHD>ۻ_ ጒLhHrosgt~{ʩ:RbӲ4\n/<?4|GHj~5 N@cG7S(aT JHߝjGtV!nk!ױc[cQ<J6 @=z01O+f]iYWQՊ2G]=363L_-GUCfBnԉܡV7kcOԊ0g6 UhgJzxZfM)S=!ۤkDEqC2WqO>t.v݉W&^e.KjVl4 ]4kh;wQr_&jR2U}_#6kZI#PaF7:DhNDW2߲eO,s):o?['uNM&-97v]||xU#Ak"&5WLfm|0&5)jѱ3DNDM8jy1'B'zEIW ߎ3`ԉ6CVWV]’'zS5C5ljs42IǞD%A{_m*ܪ[1mq;xA1}V 24s#X]]=Q4Hx}~I<94؆ Ɲ7Uxuűڹ&!Xu+?YY>1222?.모,g%QγgR7.;xрHO\T0W^50Dž!dM _:|a)83[ / T $vV;lռAJp8@5`^b``JUKV!GXgW.78v9a6o_#$m+؞z rNƘ4P`K[|Een'W/[Lss2^\nۀD? և:_dunbAsq.3ps >@`dW b)LCLF t NR`C6wĞ'I%FH|uR>6&1HTrX(D"لQgiiӧOcbbRbVVV}m~;kLާX냡!2y>had^,kO 4:++e >}PZ~q'wNGb"ȸNzrLCB/ VB p;aa郷h~>֯nI"/ߗmn_Yoxc*1]؝U/ׯ ds7$[Ө8&'19n 8w{[!M yɏ5m[D6IƂ7IT^42H)0091:A,y݁^zbDZ{o2PZ57n.tB4qq}#CQ9*pnې,k]wGaK),* %U Wn:q<җI8RPYoUJg}sW^wt78(k#LW~vk;ͽN 1?vыཏeK5 ڹL?GVKkۡz:2/u 鋱fQxy1тq957)m^pV{^^+kd颽5f=_nFaqXnbKW1;nLp3ȼi4 -Rk=Jfe̮$k+ r<|}0芝4~kueiW.t8-#ުɭ)xGZVk8+ewc3/**hIK&ժU+zͮ}ldx^Rrʣޜ㫖v>[Zxbgbl*0',jERe1=4)jNYԋj$8YDAFGF-cϷ.-m)|ҝN/Xl?dɫ$rW EU2K[ܸRrrcOs w-o+O{ۆȪF٪%5;^B7ٜaNIiOiA,/4 O(!\\cLɬ!]ݼjh4pgo822ߠA?qcHFKiEiWֿV"GkI-pBEy߰3LK &KW?v {t(FcLE%WS5S:v6$鳧6=6z 6R³O3xjcSc,pM5*_.o%]nWMԧ9/]ա@ڝ.xLhF|UPڭ~>EYfsnec3Vxm[h*ѦK6qmje7wO}6Hk>x򢃛%g:%<^e8kUws߷?yxb7~wMw>,}hV{6i(S]VF7ݼw{=eX2va}BI5+R h+!!a[|iR0[6z_yz/j أwe{g %7xTWcpǧJT0FoGѡMҭ]K/ЬٛM<>|)K?@f7qoĔbdF^@+wM%Fm`ctt98Cy$ w+h_i Zy&{{ f C iO>GY^wK7@ꐓt,j#?>P49.t*Q!ͮ+[lDj4ԔgGAC=8yxxڱZAɱzɄё{}9 I@s!(|4?\Xf͕f.57HuVy-ᴷKeԪ45TW{:]v9u1"oܫ$@bxEY}2PtG_[ZNal'+{7V&1zoi읝ץcV"V;UCAO{Ӑ\0 oίm,2O,ళ s|p 8ќJJj&ү:2S^q|lۉ`nٹa5_$c-6G; T )KU% [Vάs?m}`G^_?~D^B9z*-:MҠf^sϘ6He"2֗9n<0NoBڿv÷wK˓e5[Pޮ<@uU͸NYEӼLb5Ư@V{lnSKEdczN4Es=sf0H /1̩ {0Lgکe2tkgah"qx$gI=E/ҫs[) MYAE406-yUGd[}mۯh<ʻK~[6~8ІXPD졆-Iu U5D=Yf/ j6U!=\Qa1_JB:^xIV jҐpOK|,q*(){\m;Lb7[ڽO9yC`MgKj=Bg0`P# 3BB9}IN-νUǗ"DNk<j[)-*i?1}L0+8Wv5)+Th\*.:1wX{XIFIÅa|4͙2NNN(ͭg2\.Lޚ d6 p,;::TDYyO:2!:O9d0SZViO0y;?@'G!i qⲪ+qEio޽{w1Aӄ8yc֛,6/V)w<;"'HCC Ag7m^q7Hp#{9!u̶>xE #+0]kmġz3^il1K0g22clcp/)6oߺ[R6;Zӵ{X:bߚ .)uۭN曵8Fl4[K=ϛ0ݻeS&h$(%{X$5ւ¶7gNݻrMo݅Ñu'ٺ&ՠ2{m<kwEutՃD`E-{varWVymF6ueH@Am}6}6f&/c5yi?oֱ>C۾׵/pN숹0AHZ|>M4'?ёKXσ4:[-#bmcof8àҌmQž'#"OȅLzᣜKqkr9+ȌLyGid%/i0q YUC}@ШQu-ԟY[W"-+_=$"x WDƏ#R|?;_kd c#]҃Auݣ" +%S%.+ʈ}EKH5AՔrB`E;' $8m6E mdkIER.8;*iI(p*CkWvgG= ״JZ]YC*Q tDR\.F O/ qs;!_&? ԜduLv_zT rp\dHS[EbEh&tͯ˨③2pt ^0& w'EDDwց~Wjr'#)*y\BРײqZƘysMgDkIUB3ZPU] G7JzM4-iԞy c\c[JWFsLMsO jlk"&'!|\AGTG-F;&Q 1Cdxv}̐*(Ȏw j%f%DDz*@'d"B)*!f`(%oKK۸5rޱ8ğȮ%]IPCz{{iԱ4F4@^#i@k >qN-BL3鋳ϋĦ-uC*% ;ׅh>J?Q4Nz5aht|d@Y[Mщ/B\6)<ݒ94iBFˌ}td 9H?j#e8+OoG ƃMZ>{xC|,etCL O(]@d )))=<=HN㰋g&RRu"?i7k1g:'N'r=ǜH4F{tn92iΦXh׋LpHc;f|d&q_ }\%HoB)e&?u-MqjiKUs#b,T!INO7LpҽNڳTzz"dbK9OvN㰴yXTr~qYixM: ^}?[##,Wv[xjLX_D?!s5ܶkH?@t]ϯݞ&?4tN-A |x !<Pl!P^̨I@Brѧe~$izܰr% N:Kg' kw.}4{@~~Q4}QJݺkCC$E]||7 |ƳXok+D$NI)>ΧW,^킯YHHN0̓y=44--'55SN/* {+26χPGrE 9ލ4HAҼ;w\llM!;u)(3bJ}[_d7GJL I ٟR\jhL9PK2u=J 6ݞQ7TO4+Ӓ;)s& ʮ&15MK~NS|43?o|GX+kpFᢇS$r'e`𢗵ŷS̒;c REIlU 1 mʤ W7\pL$7:~<%,d؃ .ix%F> $=Ν%gCTQVglz\(YO >Q7 8В[1M|̾zFckRg?h1+%)%J9\@%hB|;QClzYY 4Y@$.ݽeiQm yOI[c@Sc8=n 3 ;A5A(Sjt2Q% D"# Xad$i(Ҁm5!6Sm=[zW-ݨZdr۶6'™ۻqժK݃?(֜;{4` KXHE W@HNt#r9F8vf[졤=mv6K(@xmmN_]_Б$ 4[*1Ҁ%,a @z@0ͿFȥH$5fi,a Kii4Hu0~P+HLӀ# X04@i# 0Ҁ%,a # ?9hHN`LK/X[v~Gӫ3}ő{>:#`Cq.GH%,a{' {1_? Q.;iPl|Cg.>U撤{]VY ri%4i@kӀDO] A(d؀3&)'cnhdB,t%Z2"р WJش9WZ)1BW}b)k/=nPAAHmRo@2uvvJuO+szF(yP]<?ŸF%,aIyr wAHѐr_/`s82$3NX&+U*yGZyĦ`#{jHyM2G!B^ Rolk|e퓄,´f mNzv894*݆%_/\Log𣪽*zK6[@![vmifEha…_=ԡpP@Oo# X0Ҁ9&i@}VX |U76 Mq URFpzEШ\2[ 9~h_Y^>{IJSjzȦuMq$~Xhe6H1}I>9hd>񌇊/w2Z$fs a0/; 1LoMhDxb԰׳d !+dbgh%O;ZL۶m0 4 M!7Ki?Ҁ:MGD7)@? ih, LY@i Zˤg)Y\7^GmZecuQ%Cmd4s8}@`+"'h~gv?05'8ٖ;yS\fFIVv+"t# 9%/0xjHjȶ:lU*IU"?`xL.oertO4KosZЖz䉧ccx%X$ gdccB@Kh'6 y>[Ah[$fQ2R5RiiDfLј4AF- t5mұIU VSƛ<}J~PBJZgeЃ-正,0?77]"%bJ[I\ 享m%KL{r%T }lw:#zy57VlX]_d!I&T@ "rP+<"k?]7A:XI-R2i+ghD%*%ɼ ڸГv j՞{w*4HqF~Wܞh˸-YhU1ND/RG|a2R.!Mc+ ;HZس,t Zj~4['u[ ^ye]a+Kl5^L# :X~Vr}=LLx{mEЮr[g?8TcaMH6s~kJ"mm՜ւJ-u;kLQvje)Wqmp&jh30:uYf&%IuږXhH2iS׾lGvkvAUQӨK? (˫IeծG|~iK؜N[K׬3p ϬuYlXSɗL<{cܾ_>J}|(1܎<8^I9dk:wC;4`in4|,iQ.Z̯!$@w(0>41#tIUC^z'HMO^{ |9pkZ(M}CBC;Syfp 7,t{q-̲0c:ewyݛmKi1A$ҊhGGNh<ݓڤjEۛZQSb"<ހ4t&>Uք-dHw~F!^;ٳ Ov=JjG=t .e7i"%6vW;yt֏#*o?@8iJk\;x(Z),Lgu㢂_$%]VpU}mV 4\1~6"̤( ! PҰ+T- ڴz <9RTs8*փu4 om+#ۖճ]{TT.!rH5Mߢ/7Fjy# Rh>7jTvbmEsEKA:Zy7NniICeR%Wp;% {Bj+iHy{# X3i I<R# 9]N@`I4 R(4"FGȴ,Xb.ڳҡK_Xe`f8{[eV.;seW~+~)i`*z_K KW,"%7}xݾ}gm)gz \aL 4?xAXUYwεT iȲ]jKZCqORcS/ VnlNhZw1MC2-$뼎mYfh BK+̯:3Z]nx2($rIAw,34-*k {me4Z9#iu]jk905R{M֛&ڶ(]H,A.mJ=_[W\Raemߌf>v2]/^%V7B1]o_ڼi(ng̞{%^ K©%g;zs˂k4! ׷2,͍4$ '(ir# (!צjzH" p|#QdRvJ'9ߚ=Ãb*%*H426Y9Tz=Go';:+fDRNp9ErVgG=9GlcdwU F$2X(恁&%BA$%VPHLTHZ2M|LX+vPZ̒^-_HP#5r#,H_ Zyp Qșmj5*]\W+%a1]VvS)=Jn3 FɎ/G bAMϢ1 4g:2a=l/獔;4VU:|JVA-[a0cbLؠe jDcuAц1 !pݵrYhhR$\vJ vzKI@y  # ߹=ݞ@ !# s+% `dd`Ѩ p:xUҦ~tefpƛu˥W LXʌhxv9PgB=G7|S͔M=OkaKDW/8i%@I *_4w7<>C0Ҁaݮ{d2ց^n$դ.,OTsXe,VՏbU,Fz,uB! @>)d@ndȴmFf4@rG50Ҁ3k@w(9D"(?0/ܜ|,})W۶?a=%t@&@Vf0w'ql-6b6 a]eCoooww7aX JH$ڊע T@! @2@b3h#im)4 z C{, okv6d2t:FjAKX/#BH dH +r2T͠{71w4fռP6`#(ok ڴ`M_>@&(c;dLQsOHj ovwwC $42H H 7ݛU3`aMyr e='4`Xw(38Pz]p1`>@2pWD8mo# 4| ? Hi> Ei(_ t`D€/~P 2Le 9f 4D"[(H" ӌdZ@*.@( ~@2\+C)FӦ=o)H9??l1M T节i.Q/yޙ!$li@QSU4`gx4r tNu>4 ]C{KTc $oFtca@e.]GIük1CH }.uF 0`A}M704 >aF չxί+ D0`aǒG Wu ,`=` ?-aAˆyr MQP+V4` ?!<+j0CH 0`E!jP4` ?!]| Ö/F0`i6S4G<1Ҁ 0H )BcCfH 0`" _Mԍ' 0`E5üGe*0Ҁ 0H{~ !A1 Ԭ# 0`O4L &iP 5T⡚^{ VVB-ix( j G '*tQ. l0T 3ԕ0Cuph nI\uX[͂ff;@uU- Ь- }XOÎLw! D`>6ʥ\|P;{٬"f̚wg{M#fD #LbEr:s9p䜫LٰڷusoUNUTgO}5f2t|ߨuEDN5-(wJh"Z#%oUQcd9ݣh{8%rZZڻ? d2%6YWG$_ hJ, Qi <fPJQtCAĀoxPu< D_`D0CL\ P=!)R@@UCF>#hiW?͝n>: Í5+TrRUde4Jzޤog 66uHQ$.B!qU-A4SG}0v;f`?fJO l8F۶lppv_H7e]D /4@Q>.(D3Tdb$~W@?+!VRC3|4:L%UӞLAށd;x=)$p!TJ{܏{Ŕ?Be<ٽ|j·ky-,QOX"?W۫ՃBf,xXJΰR&J' iZG?Ǐx90y#X8UPGΰ]iR(,>p~R6磓t~#?y~+'Aט}OO^ǹ&羬B=TA%]p[L#Qwը7ꅡ$ɍ@N@Q)4vV`G(@/&f4PS @P& Q2V/Y=aؤ4&4Рd7JJKkŁKd]rJ'̳!w ݠ3 JP򡨐Mwz^֝t",+(kx8O}KƵV-#beCbQ!^lV+2QN~'^3"5aބvaeZADZ2m DG ü#?k/]#J'{ '/lq-E 6,\|?]"L3}~V\Zj{҂{7/\\3VtĎ?7[$P{ir^$Pb/ ^.`M/BZJ_'7 P۵M].*I! w^)Eo_D.m`ַ ~N{&n"3 {)Ʒb3:G%FC[1Xz.~z f&{%c+zo |@@h4l"5 νL9A@C}uUfw`Ƅ`E%8 msQM[d22EJR\\h4"D?D@C}뚹FO _;/9WA'V~7cwh;e șyn^LM}EG^ _^щE͸vo$(W%Wٲ==\%S .ͷ\7Hv`wo O(>͉C9)AFU@[w Z?"ėG^uE,\KML`!OLO^Z/[h]}guq:BgTye2WxWίQ"'`֊a'*(,s72_^* {ST+5TP-$9%eas#NE!ֳ'K,-M {vK|]7 Ŗ' 8!1*` n2JZeKU|yva$$d֑/DS *c]Y;(\ˈs3.x."?l͜:b]7ìV [doisqa[oW0wv7,ܞ3^4S d&';{9Y1is{*hGF(AJAOMSLL 0 (BD@"nhfI Y{Y$FFPxi1( vJb:,7 K/jzh *!`XemS]J˫~gWXc#R-V |nALݙZ]z@];н!ⴳލM #LY@xZr "e}Ґ`̬nnsZfJZn^AnygSCKdWCmWxiݦR(KEyL_u#*2ߕ¶\~0,34H<%63 u;?e܉s̘Ң&yq5ai}:#ksqLsId!f+>j`g?E hk=s8hHްҭd /,S./(9A9NݼuLJ9}x;Y5FŅKșOOZypvO̎vڼtPuwv3,^؜QejL[ܓ\^i"KD`.g&7·c7Zw'QiNRKFsk7 **o"B%^WO_}%M7c+t̍+6+/sùSt">}7MSz%uGwy[rdէt p._9*g[k}Ew3[>BbPѥzxr.𛪈g%CGҾyRĞV9$!.BV{* QЀ:Pv̨ԇ2x" ,0,L\E裠=@rAjI@5:&BP65"h P,2фs"CfHr\'k 4ߒ_=ҼMyNƧ=["ڑk똘yD/nth?|>;qDH>q\c]>9ї_ڋu1@sw,P.*@C[ f VAaAC~ wb.0}aK|[4*' 8WPI\ј4%F~7tϒHdE^~Elcv+&qPGHwor~׽Z|-*g@;w KlĮv&L,w\ }4bP7 ܲqt%ÎXbtG9,e|>ӑ.&Ob zIp0LC~Bxk2QI{QM cP5ZgIf6=p6ۗyh8oWtF &6nyo`ozFwf,=L<^@8C(~ -=tXˆEY|S-{Kplgϝ'>t-K4;D&Պ^)ѧ7GYe̝1)Mt<"pVNݷ'266prʁ99#A"0߰{U11ZǺ峬V2no4^lʝ?mi1GL篴s9{WK/6G{[0L }{M ޘiՙ$TX*(}- MGx׷vJO;tq|6/u봹fLM-6ܼM9Q.}b5`{P8ϣN?OӇ/܍陆o(3e!t j #h唶G%ͽUC$:MXpji|*ak  ABԅCǸ &M@3-4phɗ4@6aY' 4=ed/%q[šktԼZO^rhBmi՛܌ DS@>*K, W[c7u i pܣC)p40ۯbUHwDt9j͜jMʧAy%4dv0^JN7֧'1dj_Z<,f7t:}+$73t"Y"AC4Z-J״x[ܫszE_&y={!tahHq'l!jN'}nO$[Ne1eӠAdnm=s{^OZ7<ݝ,%$O:àĤR3#kRX>k˕&>byN񷟿%5P!!*ed+?A^}DK4 +Qm1%BN#zmXA;h-8I@u@BKZldmaZXDd~x 2.ZRKus͝ɓB *Z!uåw|[?cX c^>|7GޭL_Qr p^YkcC/l/jDl 0v|]/tOLPuBC'O!magј5|G[6{Ke8,XwujG+vw/ő7.Ѓk7A&/G8Ah*-cJ({|^" ڸf̏zBgwHCIzcҸqR> (FV@}h) hu P=@Kq%jN@@ o8P& 4j\ADUY*DGt@f/b\L%SwReB%mU8=Ue<].t[T[mj e f x7٩?oow`v{1{E\Wl-{)czX4kMvPΌ~&l.l fy hh/6:'sO1N7_3Îx9mvbpo~Hyb`MUDn _}7}=~V:Tv"KVXjͼVmoa:}gG~6W⽦a &~~`+ W|lt2_ݒf28#-"ǀ}rѴG:xi ,tżv+c?:s?3ݷ+yſ{`>Z:0 L7kX)pzyz`KW.[`swX,Y~dʕe,z".59mٚEf/TL؝vf%+ /24iߍanи|NJ˰|ҨI;âc"7gSf"=h*Ks͠W6T*PMMAs2n2ژnb8ok8[Π ?\hVX@U3 !o/[eɌjU#[bFfFR>9o2m˗?2J%o._8-̷L~ ⡔cNpӕ}b\#˖=`I/nlu*s}~\+;ihC+VNȡ=EACkW"iKܾ揳.Y ӸJ+x}38 /0g }E_YB dTX3PyzL@*:!C?RJnb 'NOah(YɚQjusA/n( 94\Pj`p'M_лž>^'';n$EYPq5?˓PtF]HT,1V3T ]G QSA< N,ua5Z58v!wPPC.!@OIS3Ix0VR72HLVOH|N!SIumuxMN$5XbPE#j!C< {̉M%,+--kl~=/6RGj*J+AH )xDӊGx QZ9] #񝤮<79)9*) i}ў"2 L0T nNIΫ*ĸBه>`]Y[SVY?"0 Ve8RoH%+͉PJU .TL0ȑjR!/;ab\WZ\\(1m#/K7U ݭ~gSJ }ujt@߁et鑎2r,JT)D&aհFzrY/CPmWcYIYcc?_R-5ҮRUvsqjFY%y)́Ofj"VMyIyE3:x A[CMiIIcK+ץrK{zz;ʎҪNWOT0\]QLM2, p͇yJZ Qtl|iK;Dr޽eP(`_+D 8w'UTLV(D"vu n=. B (OHSC4-ؑ[/`!?AӶꃉV#5Do4ͽtnwiN i@I -G$RhԵw9{Y6꺇TkUUe2"c"m贪ƒ]U; 1&%nc{bNNv,6J&zeyo"};hj;Ə.m}s&Nv{={j?]VNA/fh3'U|t^3*py|3? \8`ogO^MO~QaA\b @@0(P7Oވ8(n@u"QSPK7*i~ E'>$ >w*'y3A]#p9MfMD`;#\Ss%oHsD%7Ic\^[N?j\-z E}"]~1j<_>pmԠXivG8QPnLhc"#c!SYq )>Ww,ҰZscܖ:81+;?C=6-q^އi4""6#<3p!4Ҵ:>TF)88FKJkXˑɄ2V&RnKbhĮΜ!??X 0 Z؊.s h3%Iʡ(+F[ >Yc#IPWsIg!ޛܜu1y>[xhw*$fSoP9O׻;TW;?Z_q\9ggSO-g64QX; ԒbW%|% }OI\U{ؿN΢[-*zA׮ D jq,RmOkꁢ 58B"~! := ~BSg%a7m0߸j飘J%qݲyZz $̗拿9qqJDG٭`~].w8yiilhjd݊Nzoftxi_w#^Ԥz͞9dm[ 2F ^ۿxն]М9~vw1[a0oJa!v;|l:zd fe'Y2_x;>%eF-?-uCcƫ.&q$V6ro|c3N ~o63ӕ&&b~VXk-%#tҾ+N6KVo02{ܫ1|4 wdqz+l'H F4V%aEs`Uf_bzOuGe},_C@/f[6-7Q7UK~Z ) `erŦZ-{_;~ÃEޯ IKgؐed<.?+1 zvI/ncTΊQ. ƞ8~?b% w` fQ$FQ}: xݡV]CY_'oS,fwR"w(%?~]pRby^Vҹ;)"r 3Z7v 7\ԥ!F#>CQҥY7y5T t*e=!zǓF4 (Lj;@$q| )מnf͖DsR&Z0ר9EC[#USخĈ=g}HNkF7{J!.-ljx5CYW\hD-jʖg)ko6S1ኔХ}׹Y> $T*`Yc&UȥbJm.a )UoWTCD" k;:NY@Z CAyk嶫$W|}iXI<3waF+aphl#):|!5QK%G8,Z7+-uPu\k&a| YM;$ՔK*k4EM9;E \-}W( 8clz&K&Edu9M<eǓj`UU[Kmۧ[]'쉭szT k曆t-Kpa\/ 9rxYQQ_7TuްFQ NN5FVFڭ*yG(;jPomj *+5!AQ1̞ Z3֝aov0Rr"G[GpGT)Ciߛ\X.4=n4t jP, H<3C*fLή94vdg~/2n(جGqħq(ը׋@WT- AcDv1eY'odip" KA Rhm Qˌ-z'ٕx\Ӝs6CJꛀp̑ $k[9QUؾ|>@9'4v%$rcJ9^['M2aMص]^7A 䘐`U**5Kw~og9M@O :BVm~N}ZeI"=,ܒ$:iYzv0[^'A^{XʒZ?0i׳=V,oZ"bGa˻Oyn%@ fΙ|Yf%z_^wܺ}'P9 jARhqu}"kN &4{3*!.!&"}PZE4cB{z=:tMb_hFpdיM'M- 猃oL E)eA79zU[R@ߚxG-6};]aNs'EDt7ڹؤQd-$hh)4W2hat(%PyL64)cwHc $vPzہk;aNQJ؅J> qtYK3S DG  hI4=Kήs7B%RQKNw̟}.=ł+.@)?߸^G.a W8x S[,}x>^QԽͶ\>6H>bGt(ݠd}{hR2y#fW}}S^etкm4c>]Ӹlж׻<e qjL51Yܗ+״daʑHI- b(pFxaUu} ɜw|ٿaL!Xqzrrr Uy2%;D0$xmuWŠderu}BRMۣSIАU$pItM$b\؍n\Ε8|܈R!fd J`*|63*K$k&FtaGL0 I&˯6wW,c`*Tk;_13wͭ~J$iD\T*zy;\[%ǂQLN`L 4D s$*"%{DBi[$R*x]"R]!Q`+`\L&a'~eެh>ZPq 0N0|B6 10 o! |  |#aBFv Ǽ0_>BF9_=3|ݚ M ăK[BL1 sp|PT@#cNu2l0`}kchei` I_ ~ŒJ|O  -LahZjFq#A\` @˻!G/S=zL"hѠhY eGEf'62ݴ# #"! oojw$>5-*,tX5$$u?w7)HC-ħqqgUF^t^2?:-ݗ1\e4+S+ nrnnunӰtvt7&lfl]˴Ò dP<>ç(z<{4ԸßLkY,9,Sh-"=vZ:߽fbCaIWxi0\ߺnf+`LӞb;6D]O_ 팵SȪJdSKT9'8.=)gO-h}+ Љ`ӷbgs: s+olqڈgx5Q7BT;ƾi.i}UZː^OIP|7QbʠgzK"y2?,~rw!~lgW -m .T Z*7w,6~-9++:Ӑqۂ9]zLU& g~?`…GRI0]P9*Pn~p356]4l -#2"g7^b(`:L*1rwtff`FsųjPyٮ_ޗ/c`0TV_F-y~juJh4PzpPܑ6nljz ClARʎx`2([ >W_=+TQ4Fk%"@t8x4K{oaDRH:K%<䕭03%zaЀDKIϕjsc+m+eM%&=ikt/jbC璒\S/q-u Co5= O0yeBⅼX-ґƋv_ ~>. =Co˖^zFS/SFpe6GxĤr& WC}(.Xl4:C:7,ȡ8t(AH{allqћיl#nشyӜ,)I$_0?|!j_7aҶJNH.z=$Rt )Y}kdޝ(&n@ÇMlz7Byo3OI~{Ǹ#ePƕJKj_2%Ϭwچ :.۪w݂ͧ逢! 1Ap,XB{J=-_ (qPO׽L%@>-F?c`=Jv1$$& ;# qDw[G]/C Ff9Fc CE M4ЀNzAh*:l#+#aA˃U ;o8I }lځbk^ϣv~V7WPd<:'CG=F~eFMB rgvqrOôU0hHy|$ f >FnYi ihFX022;,%c &sIXh zdzGcW#B6?@jYаW0}@K}rHj!p0ʘtfSx_QLV#SYR I yT en] ,Zglz'-k]@( D8PlHBM @Ɋ> /аDM1PD.@@I41+0aeAFM;8Jdop}û]`^uB>8prᔴCIQ=r3'ğH鉤ZWcÃJ~C+H)b?4;DnQe'Wjeѭ3H=CDx;Z/܎U#L(%k4s (4 ,[SUNLͲE_!)wj@58Hiwm:Bgn_ox0]IY Idq"""ZcfQMs{<bv(k', XyYΑ[#R'uZ#|}Rg_Mv\%iXˠTž&: `Kh8KQu@i"x!ٵ\>?44DԮQj y=(Dw6D% PL@__z'W=i 4N#Z:*BZauQƋF\I&V@᷶;;CM#O=Q`{դ<`xX{בl1zx1qW)*͋>i+ANNEIIyqܜovY.t|{j5ܯy!ƹ-540(h~djV~hWV{^7_޹r{\>뭝QTqxZF&#I^f`6vkuDc^R߾ xlv1@LV6KQϾ:Y7s))ҚY!N߱7ϏdUV zLJ$ZmHa6=*`^WhWZg[XrcûXN7E퍩ۖu+FU/t +k=bY F᧺ʪ[w[)͏?{|UmUIi)Eʲą% $Fڴ{܆BYK.' 5/0(\rbn=Tߵb#ָ.n}T0jCާuQg-o[:{ Gz_^u˨UP%S E@\8r+\AGH>od}؛!+&|_VdX->8]A;Pͯ4:(8M-BaHx(hBZ'`>PTwz @^^CM|؁Z.##_P3>u _I^4@jOD7%i@374Uڸ} N"hYNiW9~p^THHDؙsl%gݭm>NZtbE(*+}`4]G;!yx˞q7#bTߔ-7-G):,f}p'<,,?N{[1T z G/޸[ oYv˞gUcUHL v (?M55 u5u\JGpNDDv &E(gv+a% ~+CwnOi0#8w22Lw‹͐q\y}0u^KyԈb߇s;ZF RPmuU]9}|=lpK`-Pm}q-EA4=34\?faz' )x#6yt|5vg0F )qL~]PA~ &A;JF#4>귉F|."-MBYy %(Z*{ 2J߶%gI gE D:/:Gci̙w eҠwk~άm?}龏_tn:m#z\/<~$-,'‹҃m+2_J]1uOkmbYL-TI m/|iHX85j~m;:pӑȘeAD16YelP_'kh,Ǥ\U{C4N${Kbi"ϸ8'!>>>)) x4x49$< YDF.[C #ko @[FB7\==Me ׀4J$#0`b{@؅f:4,?5z]\s(>"RW"'? T*qB@T0` $YmH'(@t1q #Ytι\FU;hXۭ ߸[o{yܚF5֐(w4V̾l#'^:dB]knُΆ"{u*u؟#ENm]}SN~: 1\@CPx4B{b;BlpRw1<#h(/emQer7W^SSQ뼽=4}MYQES]RΏ=i\IGݲ9?M\h$[wd<,=jJb#0PI᳭CBlltoJJ @ȠFtd2Y,p8Pk P(bD"dr#)n****)))---3RyyyeeeUUUEEEEWp~ 4g$fVVV@Gpw0000*060B0N0Z0f0r0~]_)Ho`BBB<<\հhVNťZt@,hIAS.YU-O7 =1 e5~a.Fiⶳ{E6-fL?v'kz !v12hikq']~sw3M8 9s&*B1E•It%)b *49D||/ ؛1"w{c%isX䶘ح1cMF|݄|uArEF\;T'=nqk,Dvy[ }H#FoSVn?|\P ̝'t0gNS0q6 }]bՍ3ǎ;j>%:sHFDg SJon ?ߺaF.KCk9;wyEg( m1π'T.a}x#qĪ3>fmXdEcksC=6f_ /^p@) ~T ~XٜRKꗖa~uuuMMMmmR OUkEG’RƝ&a !z}Aw0v `0#''L\!3~p#555 1::Et>(̂WCբ"ٗ->U ժUi}}3t}x'"|’k-PX{x'iCv@"oc 0575w +#^Ԥ3޻bnwr ";7 ra2M& 19_B">VtGo`r'4=arZf4yjo()mh+Jkkuٍ-ݎ_CG Z5*mqGKSk, *[QktVuVtH:/СZE}KCC{W:y%`k`a*d2v4 ^H*@:MnGh;x|ةasǜ`! KDt&f$Π.Եh;-W&V Ƨ`낅Jn 'i5xW DMjTk-`|w{# fj) nR`Ue[: nToLGcwr\S01$ X : 129b@@NLrp#h@ >0@[ɧ|xU 6 (&I uK Hutn$ ܐ3*g QY R60\g}T:|6Z {'f6Xgsl̽{n9g `X5@d7жxAakډw7=*@]m0Y\@'wJ n0Ixtni0a$ KbRpT#D#CqjtuzgЎZfC^IU0iYͲdኵC/􆭭999KL#ݿ 5M*O8mV0'L&(hl UvBB|Ɗ!PNoKj`7l>2kw9iAաQ%- &u~4؇T@WB:::]ۤ: $f?Zx~/Xܐ@aͤ`WWWQL3=O?d+jxbh rw wbJL@$NHq%n@^8 }zt F @Cfm잀πm. %i`n=q|>'.(خ@HMSt}<@Ft`.6(C, HL %468v ?+!'+B8]> g lMA&zF<85Dψۇ{LOp=d'otޗFK Ft: ?--,t5K$4x1zTFqDj;TWU[ɚ0,G/UWVVhճPթU)Йzق3@w=(S# x0&iӳ8I L!Lt;ѱorL%Al#B%Aˏ 2ZXY%0l C7jU'iƔ*ѭk %䈅yІY_F=mZk+f5/7d8G ܦ QOZf!Jr|%gAZ+m$eMyBsQUeu2byR} [( pH2kՠc'L~ID6ĭLnuuߚB&mr?44d/=ѫPw&0h``+xwon힃ػrSĴ$F@Qdgprp1]n 4+F#3Q _fd WZeaOwc#G6 o6vHFt dk!`M\,Z6#7 ڛ@LHZtYmtr'vԳ:8brGr[!)Љ4hٿ$_b"VҶk$RN8-jO{$yE-Dv a[ %zuʥЩǧpk6+!vmY9̪| > 8aXAURԉbZqV$X$N\UUM)C¨)hNwoƦ!GPu/(KÿӝE+:"gz+u+Z_cϳAif8;)33}@C茋OApd5jF#HqqqՈ0>虍 Vw8,5(m7#hIdrl :q5#G]|䩞ժЁ01IVOD@4aN2H%01 ( hh'-vi44C$m%XYF :'5@"X`[kĴUR(GUbi7rAM7.Ъ;լcVn݃#wwk)ϥ]FxDaݒzW"WL)ː7"o?W -}7[0k.D:ZɝQY1{,Ӝ8})|QGܘ!HnrhK t/w*Q|o8x2l ) ~yԱvC~<A8%I[mqlح781PḞ+$]$]v ZpPQgh.<23h^wJmN c7(1>]_ N\bx.z!h{){_Oad  -|kQ8ad}y B~;s+>)')+k̺lE^;46Q컊MｰvNLb2JP`^ 0687 }DB>|1 [u =i3OBvݨ^a'A$ IW"w=ydJP5-A5]$ 440(^f+V-L®ɰsn_lt[YL?j=#( H$\ue՟z 蘆ѭ*AP凞= r`t|?)a13T+ ݠL7hta}&A E6If`B G -T`rZ)񌳣4Im0>m@;wp;=Mi09ӿS РoSP O:E2X24ՖK9uVӮy\*{bە=$->jٰҮa!+=[v]1UFTDOu(jjl bcV=,mS,uz}Sx7]&'iQNBnG HŎ^E ԝav?:zGUIS}+|A ̈%7k{7w,T77TUkhOe´B<)ZZND*Cg{{cUitIޭmP}~UM܋dx"RV!1K@lio=s_5:uc3ohPQD?l)AoBt)4A@C[xkO4rzVBJs'.-]{#vU<"iD.}_L,]T mnCd?vGDnbܘW ؤ$rM&W&̦Vj5?o1x XF.4tCBBL D4Iv@G0IsvFWDb7:0F.=N*\?#$$^ 8nuF@Cg}QiM~_sSvrCkoolhRhL̪2i]--us u"$UM`^'o`5MKsK}m%ȑptJ]9SO3L=z-іd 0t47w@A.z6 UQʱ8|1H@I? {c| LuwhX,hhɎAr>M0풐|n«U: #޳}Q< ӯW^)uݹ.jJT4޺u ֿ[o_,ТWSvt9 {&YI~rShS &]"h3 2Zxheӿ dk 4Wݢ =b^ ;IJ11+XSDU m vܫTkS$<&6;u J6;N%'A>z kN}^zʓ$/P^ѡo&m8/i1sJRƎjݤ J/uG-"i.lÓNG "UU-O:tey9zomqgv#gP #Vy`m%;θx1޵Z+r%9Y dMAZY7's灆6eA 25g}WgiH\znUd,z\m@$>{.RNTV5v6xW6H ?sR'tj[Nbe8Y"Ю [c S;/w)p>'58*j ՄtG4T#* nRf*89r w/8vwyEDaȇޠ/_t:QJ#63 V K;.PBx胀 xL&oJkM CKㅯNZ[wplAAAh]s2yi7I|@46 g"Ј'i d0tT#p"  9: =SL&7OIRBdϴܔnA%I|R) X.R_EhbZ[LoB6p"/z!_6*e U<j+54?ojk5-ĂJ=kh*0e7{lSݓp 34 [/Ш3%itG(Ug 0V ZM59QxVh0nhPXIhUc"w 4Ɇ>m&j#t:}DYBKhdH4NåPh $Pt!a+K'z!H#=@|''' p8P(`HH$Ayff&S`Ӄ`$sl@$ytG[)%HA݄:h_&',7E,MX@&ٮ'N nx!f h7;~7'}h0OO0+**$agmOODDԙ 0 D=ڑ#SrB Ϣ$A7Z7)S W=~S_ThP$AND@İug*C4x())&_'++`bxnooH;Ԁ1DTNh<+&H:&$"'8#)zF;}ǏX>3.I3/IxR PڥvO/r`9=y6O6^ xV`/$DbX bDBp3o`3[0sjT!!@~:Ht:lC_ p]>99Ν;eee]]a=IXr0.e L\#cOK 0r@=-0A hD )MN u9 $K.w_H>h䙙"XD ĊL@rKNOMNLag)lrJ*X}BT& L%gfggɥb9"+;S!mHӌ+> ]"gggeOqZTYkTǧE 3r"S& ^|bBbJO |*b ыŬ{x:t& B%I||wb h-;Fn徵m۾}{<<ȡS_ #쏟wJxg=|Ŵ?<x H,MC& Et'D}p#bF :dnNpdF0 焯/v e?IQd0H&g+@Ѐ$'B&c}gx:_, h!)nP&el6ǹ A@@ . !}?{!H@K :zwi\D,b c L)2}ߎHʀ UtuzΜw#@'@lzs,r c KΗgϜ9Y֮t6 2^څ]flJZ!8:`)zG3nf\w9@2/J0^V[WΟ3yRy}AH3t {U!GZw9="ƍ;wfA/d"pB l>I{ƒ{uk-?-{N\L݅;[q-7ޠwqgF7J1뵎?Ǐn߿NUs)J$o4VđL=vs 7Dg\FbM*iM=ЉM 胣] +T@)%( 9ƛY7O- 5o]yRzg̨SIx&$).^+t#ミ,T$xU]SdtF@ NGذhW3Dr%N p9zەT bף;A/u)B׉6VXؽ&.}ʙodĥZʼnv+8'|ǣiJJ&Xv>l;N*lkkƍ{OƝHL W:fcmn6fyP, 55l| k?9ֈQ_\!Nyl|Rr'˔ڬeX|݈|O_9pn4OЋ Mp:&{cD5ap oT&=/R|&.6lg hܢNہ!gVH,E߳wQSl|ءn%t߱=xN>'%a?0t]^QDz}_~-Y>w%"_*sXN0z؈1{.ؠ+1sCt-f#:×J^xr\v%4]0y~ #|8*"J%Z - yԘOѠHn4QWsV]Ax0wH<~6+~޴`1` 8NO? uu!1+vgp͍?@- ~$hdҎ2CK|HyGb.&4Ƚ⣇iLEܽ#2hF0oo3xȰ!_ۃs&\\0}ˆ f~G DO> b1/ !Ç}A{D??nֲk?Ek]$y؇{Av?L~/R(i?WM5hT C(D /Wo?xѓN1ŴKƾGQ$J>C, A HkGO>|♋,)4^mocðO,ܡG_N " j˞aΞȒ ƭHyjLv%$<%~mI/rXNdXQѱ)tcEy0ձTDp~6Ǭ:q~@P_`*r3K4 !L;b)k=}m+^J=..^~|غ#x J\9pAIO}tsUg/FqXr~TJֹ|(b';q'l%>=1DƎo,B!8h=1xCeeq&/2.5֮)|V|}}TXuag@v ɇa1ᡮG_/2xbz:\<4 MY7'`H{~$Cs֭k1F#["+Q$bO?:,^pyY8< 蕃tuO{04ǝ7Z A S-ɸAgN2m:iSf,zggi8[6t6q]g1ICBw(PKPWٯn9ݻvX)bj! xT?/&2'8" ς??0@4 A'pGgDg}Ѐ3d'^,*x)7'9a2ܮݏP47t̔IE<@*Wdu_REpQ8!prď?H6]f\=tE͖,^O4G )6g># ͖KwyvDv!/|߄T8uE/Yȩ aןkyB-څԈ{֯>~fAP!s)\qw^pg j&/]ۈ!#D%ba/8XN 1yԂ O9gvĦŲ,\PH<,1q?#pxՊɋΙ8nix S'Kf@A@TJxS&^ЉgM>t)x4) OZOy 6bƏ l1|S/ XAI\{GADqHrϳ'.jA\ıG4@b>%A8K/biHcp s- .^IT|XgAxIDM?';Szi {Uψ p\5/fuKx> 2Ҁz#&9v/W8M>5'2]1n ;eiix߫CyU@ ۝u*1#ARWKm=v1ljl8{;R 5Vx5Ǿ_-B">%l]6/֠n2FZ?z뭷lJgR^ԃ?EDDF÷z5%rYp, MDھy4.r8[_ۢRȮgΘ),9zSQ1rW0eLJ'Sh %=%yl}i\.Al7 }-~a9v:.1amW xCk 7As/ hbnaDBgؿ{ǀۀ珌4 蕻'e?7IO>`o" c06~?G[dQ$/Ι}?䋯<{'L}t/>h_~_/y#}iIgLy{Ї;/{0@aĻ^y;b0@ 1闞X ^ۚ3 H3Ť[]̖qi '6}3t?~5fk ˉp~L=haF.DZ{Cd?8j~㰡Ci @: t2`s_3 y *%DR¢ &Ǹ[4rJr6%5x]D699O}a Db:uCe)X|:@alFFDoAC9gpxݬ1i"c"] yC)x"z~|+nEI`2âqI Ixy*ܠ$&>LB!R,0BJMǤg0-sش,U x "`x ):Tl&@_,0@çfQ>10sz?eedM"P, c)Lӯ]7}4PE*!*ң~@PL!&f>LEn6IB#p|\w?3 %_p4k׮ hĦ hs3tԞU.b1M M_Į^p8Q&5Xf/TBT0A/>gBH}vu>}:""66N@<3-,vNXV 虞%FxpMs Ir'$B'`4dgglߚx` *oGS 4?'+ԯuyyy=z \.WVůWohpww<h@j~Kti8KZ] !^9CHnE"TjmSk}#ok`WRjt:F^W׽=uЕRRBwؼu׾]7^_J7>6k0IxlB[EZU a|n_X Quuu0QjR¿ Ob>9uāRp?veMc{mYpu7uJ,Q"7͞~k,}-GYĆ^^S̶ݽt{z-0/0s Q aBꖗ<:D^&?3]܆׃ed2#:M{{KBIL޹c6h9m☨jkvsTttLtŮWUR`_5]߅АJ}45JUuץ[{)5980" 5/o_m0h<h34(4'/ESK'[7J0GåR1\H'Rb /#&:&H/VT訨؄ԜJUoJX(!^޷CLa2OL•UfrãbE٥:5jmQn9 *J)T +3JUS+e5`a!IbBEu,Gx% NEeydXZvuMRU#lv8AT^9n5XhH7u҆DzVq&fլvSꊲ8alYʪ"f:&888*.Y[RcURR9˨@JjBVșQaIx\j*T\1KaQ y1KSC3JJ4@ƫ5EK{WY'UI^i5 sw2R"#Seh9x0L敝'e756VrJ`9U@),!WjnP*+s\EeUI kjctQ8z <"NkPՑV\a4ĀdO< p%M$%- "e4u"-ɓg_tj@u;v-[a?4i܍Iui٬ CAVT)5JbW:AVS;cOzܵ{3͝ysΙs g[dVD%% @s !$D97;vu6EAcdXM]]i l:vׅN hYAQUݠ=awFd0޽h+y_pdE+_ Rvq;#"6-=<+ (u:-sf;G h(L{o]t%v׌w8攻 mGJꆴzcλOF>s-0wD. $xy#<<>k$rփquU v?pe+֞:۞zyG(fe5swZ=ĩj^r-'ZiŁg\Ol.0^g44^oguGO3CT~nnջypQTNtIԇREՑkBT[[2, wTsɫ|V+++'E|WeRmrӡuBpdbTJkv952? Y6lE_0Ti2נ BB@4:ip-_Ө VFglHw]jh4;8~d[Š,f%e6,v [m֛ T d/g\Ҩ-A2:( FFq:925 hˁ\_\r۷mٲcz>M1% y~;ݻTm\ɖoƵ#* hpR%hPua@HGnF[d7 sNr3!+684.՞{ KlYzv8:m N-iGmlv'Er\8-͞Sw%2Lԟjm:SG{+ϯ,L漯^0ab5;p B3K d4H:bEijHE!K~^N ֠8y+}PȇDx>Qh>iզh7[.bR#U3^﮾V~>DrZ6{oV8L-/u*LvJaAC݇{\]]ِ?M@IfȌ# y~X܁/(%RxR4|oץ[%M uM"<]PikS9iْ. L-٬Zbޤ{sw gwjymR2ub+!hd\ JW[W0}>V}մ!T&#"\J咑WwґND.u\wZԵ[ eNV%οs8ovmp[锝{of?'3ݱg) P ʼnK;D8P[+Rk=zJ@ɉ͗B v?%#=,;(RIÊSS4G6:]OHK Y2bʡG'67,_AB뉵K|=&J(ToZb@y{/sa#|uFBt?Ⴕ~I+ӓ#]+i}?tVzPY]so{qvISwn Ms+Xhka{C333U5*$/ǍBbӒ"]hPp-?HrHa.N 8``d+'vh/t=_V3C]қn7:] C}IZ*;ng;$19oߎKCÝǷg6+s}N=_+n-m}ہ!Uj^ޓ&ҡxÇ.)ȑ#l@|ϟoxnO8d?̏|kЀ8/ĜW '2%%5;Oʈ,B9V=W'5N@2לG ҡDž1Q#\+M_< W*T*iエۡark+ |-m]͏b#TJ`SZ\XHHHTlRESR)ͻ]VVtUW>N8wLDL\L\MӶVz"76ScBFAORrZ>Xyw\T$.IfSʶBB!7?nS6f-Q0Y\07<,84,2'GJ sk:ot '(M\W\YXPϗ- ®[s_VmyR T*8b(%l$̗ 9 +:"\~c G09o`, h6xVU5ZX4?uB+tN2xQ''BT(%|5cUyfR4[L[zVfKx:=l S;lVK4[f,R;7}Fon65 r BXLdfcFD.19ؙ!YF;fP5e|Eu8 ijX>{H"66V#))~ R f\n93I.'6̃Td0&VtEFEKj5adNg+ug /x-"VBS{ڨVw8D"k t@F7`rY+ C8AAA3_^ h@X423󄑞/eBkrzV;;۠4~j'e?`"&ű$nͭc@2(;u/G=#PPP pp 78zKhܙJgNDH1̹!$ #Mf ex~(--uVFF:LC %eT-p')**Bﳥ-%%%t0J[*ق>?aKQ8W*J|փ؂ߎ-ۏ~c ]aK>[,-p|(q_<ŃD0`܆Fج% Zy;NJc?u]uhaWxܗD+ΈM푘^nPjH&O]fB67W6ؐu_>?1j*>uJЖ8d14JJ;j ^z5::n@|ŠI_,RNJ+3o&XP#I A 82p|(]2)wj9oLL6KFs//h@4i0sP@'g? ;>,Ow(PN]XT-3胪ao!iCI}켓M4xd nC<|n'&w6(%9;D~BTgtѢ%_d++Q̫ c 9K۟߸P#ί;3OK;9fV Il@ `_~Ԫ?!>nKTzqGjg CmmmTT׮]  cK|||[StT2؂s^Җ"(9g ,ƖD$LAM_kw8p<<<\^*6mG8< xF=x{>okv,K zơ5̭Mv@旿hFvWmJWe~8>!|mڛ  G>.MJ)r:,,?Bjl2T csE'8̦Q ?T%qlR$RN0-7181^'FnDݥ/MSf i&Pi35 5]BP[Utfk_{AYŠh "EMZ4PsƦ؄57q\Wz)|5jQmuT?=‰bT>tL<(=1ڀ(ԛ)q4M*QB0>j4dViz'ƌeyj/-_@IM'Қ4&MSi[@&I5H[ff*`rTq$h6'ItkᆨQJmׅ.|m۩S\]&뫌/ 8@\5y[c}NYxf=)lvLNRm FB駲 -Kxz|%E׿͔z9{)h8fot^9n_Α^30h59[v:+!hXw>W}[14ʡy5 T@UGI8o+6{}5 >u.Iqa/!n֭4[]>_:5Mw/K `TTyݷ~]N⫟u vzڻϸX ]m~ x+mO5O yFh Fyzkw?曦}p0We,xm0dE&/ sԡ_}hｶ O ߞ1ٲRNV8g\^;7Lp ! PO- +y+4]|>vxeA SK6ll0X7NonAIIv5w;A}a96;mIE{PӠ(zkp97Z:JU !sJ6mok .ؗ4El 4EymR6eLnNHJ֡{m#:fETŅU=Z?&&$4Ku=))IZm|q=jUu'#\!OiSj /-7]r 1垵Kqܵ*uWat7_30IwU?+r)a~`YvrBxҝA/õSP@Qhomk^W2XBجO>;R;0_,4LZT5Yhܱ(SU~^ەjq˾Ϳ~E7]+eCm^oj( r<8:'k$i=鿯u';ے)f'm 臁>`CI(=-g]9YO}owi?:%P_`pT;t7W*iU#?ފ.RK#n~}SZ>遶6xA{MgSM=m-p ğr4!,57rRRh}mԲZ  5IhGks=FfR(Mst"Ew_[cAw+yETxZLN=ԒmN#U^1#]JePOn>?v0vu2pN62#G7 nU6@O^:ćrtr[G6Շ@0{|lFInnyT[=@cS?l{jsYVycSA3:8qjٞIZwžMVp{l_Px3!eK?zpuR-R6ՠ èР[?|4 W].Jz)ϻk˛m$BXXUj˯Ժ?Zv͠@?Hu1̰0c4BZkʱd7ߤ Iku}!1qAga3 P!bK%#L[I(94q\)E[:Wie"% =-^OO͝gߕ 3Y!3꓿Ax\η vvPRhs%_|ir-u}Ւ/ !oo ]NrH?}K/O-= Wd67&uQċN]׷W~EF)j36ʡP@ek7~@0֘wCаDȨ'[@CQi{#Xyt}jzUɨ'nlR:),U HtJ@ΨZh>J:~ʘ q`4h8ĕna4h6cX4R˷X2ܪ'Z-p_MX@MvRbQLa DHn2K]3SX仐#GqGp%j#z j mxYW{@ERa,x]aLY[DFDQ3=hp09ދ!ۃÖIُ#zJใKЀh&f2x@mQZ n\];;LNO۷_7^}cҞihOw_}}ƭp[ _y7^tڬjjq_ "po(Ћ[koc+eR4o\X"i52 S.oz[-8\ArkP q暯?ZsYs'ZaSʻW}U?M($*{m~ϴLH9:Z,mqE.M.]2=u/Kmalmw!~F5=J25vd0`]Ng*4r4t>4S;փ=_=}[y+95Y_ rO;XTQ,6 >י*c{臩-DS d)DE^0^NЀD9svOJz,?+Yq 3IKOX]ǤI]8dd{8-甙Vd4t$PH@g!JIhqf۠T*/ĩHڀt!I6$Qԩ䤓I``hRsN$X !q@Ub i0f ?34NN c$=e6`==1j|Z?δdtWԘ~05ӿVgX&u%v"؀{( cmW ̤RJ߹ lcqtgd0N=BOuz;M&$I8 \7D&L}1'كgϗ⠁szAY.\s|0$P҅<#}I<ӣMs F`Y :bzίHfsNؤҗ'8`W!~ >"RD@cth He 8@Ġ࿐b!8t o^tO(^$!@| n?*"5 xW1v! SHƙSD~@~|1t I(- SG4}/ ҹ>}樹? $'\ 'u!Mp%bK,cn@3 QV#,HS>IrV@HBb Rӄ+MIq 7M=Bp(ĺ'a BC;zY`LKW=f 駰=9I6|y!L<6NaɌlhÝU0@"މ `c ~c9uy*IJ6T^`~.`8p I ql3g8XHsl'gVȱEh\AI``g 0iLK<[G;ə"$!4R+H Åp|/eTέMޑ7N'u& v_|y\% lJʏf#>vjo әFXxc`AX92t4 #aw 8 Y G#@z`cC:3<,gHC6-ҋTU̼[pa)HуA|/Nss\bEaKnloӤHXb[($.@B,2I[vpHs#ſȩC"s&1J9#B9v!0׀cIz`\9&$D@CJrNl{V@LRZ3:Ҥ%jۯb;QJ?>1&Cb`N*V79v0O> 9=o2l6ɹӀ`t2{8 3I337`|%"޲a`r17Ԙ vqRR3,Z0˂iBc_y}n{pn].qZ_(DϨcn$&hJGJO|#0A_t2M#:.ur4$] j*M5ԅ}`{8w\4}$R{PZju~ph[:.mb@q-Z0YK^Lkɡi*IA!bWrYM.j(`!!bl@cd589 2I *~`ivmvG@T:p&mh`̫̂f;3\fҷ{`&Z!}|DQ`쩡{Pׂsn 0JSdj̇~YAmDH219h@ Ȕ (99gp '3>})IHbGoR SL!&Ol&#sj ȡ y&_%+6Dp8nfr NNXF%=`ā;"JD`G2$1&dG2-YDOrvS@F@^')Wh`LoGL^(yߴΚahW@[dYOR*'&u׿l^?*P޷;%_>U /O7/+]> mЋ+գHc/:ff#W|f F-ni)o &c4a92OL48 .0F1a"')gR -9`b2üm?󈓍z:nҤS,Y.ݲMzV[VLkiӪ"h2TDsk b̭O+{r'8ŁS'v%_L}fԀɛLX@ڼAK sf !9t7'.'2TOjHI>WiNy"PM 84`,rbıUp4JR  Q,j$D 5sh|l3x2"85i ¢܏/iV'؋WП朔j)RȬ*"''9H_X_ WZf͊_ wMzblZ±irkGd@KW}?ʇ} [Q&P&Uv &Eo^j`mD^(;{[.R,sXwo%? f<O+WӲ=`&Oѳa~ nZRIQc911X`n<{KۅqŒQ%e/6eTK;1{:lr|ʩS+1n;#A U(4oKR 9D*9'D))@lQߌ:ʿU9nx~ h [ uHBNHl@ݑ=,HENK<>8^rf^ 48'0'+0 %tGLiiP?}1ۤ~',$ k- 8Sh93Tp[Gmp=(= 7H+:.siwЀsn1.'@ӿ)II՟74FOqB;/_uJ cAS vlݲdyz@ê3\v 듾w򆘚˯ۀGY.Y.,ҙo~h$yly rҏ9|CE7f -'C}oD %m*ɋ LL?]Z (۩LwH |:3)ȼ䱞I,LJ႕&&|6gGJ4|1'A:"ĩUk{_><2:*n鿼c{~ u{UݼnÛ6K;8wi% KHaA"sчzE~ QӁQݳ] ]@AJ7dǑ W}O8Uөz.p^9\kQmG~Oڠ-hooY*G=v VOfc 0? tוEA_9f^BB@hOGW,rny#x| ,كOƦߊoHZhm]* j)7+okHQ8]RSV>떩XǨ'i.7[Ax8%}tZؗ4 71sy҆y4plȓ1?48-}"OjI9ҘFPS(%U;Ky# zK򲫕'Bswm@ҢAܢA~ I Zꇟe%|AidwDO57XG#:#ȢE *hΒ~V?#wueSzRBP;p55j }7Qir@lQ>qdW-g]XMTCJ*DFj5bd^744܂N*@%V; Q|ǯ˛VvVxl ({QҨdOLY.,O4 ZҪ/\sa˛n>w{nu-c7/?cQyy ,ׄ- &u?z g ;UY~6rh )]2*lsLKr},502IYn΍P*AlT|mqRR˫6eǒiH{ٟ]ygkOz&] kq ۝yxh]Up3:BM^h$,hI* ud"PŚk0ψQ㈤_G=| OP,!R=BhC?Ȉ{M+ٽ#_C5- + tEێo]*[ޡN)YSjaZur_?ے;L&QmާWϑ{"Y@5uSKᇈBĸY->դ;0S4'K\[@6Ebxfd4]+"y|=+J}ɺv9 rXCUvTqmKg\Alj*&ѵL9v!]jdzIu¶橯]C5sUl%+nm(w` ` s0y{qXh&SOߜ(oOBi_8M/ϢEINjN95A<dR 3 8~bNi s0ٙXh݌-b\32:aХ`ޑ] ʃOzy|4>M"|A[L5iJcu膴*IĈeQRM?# {H6Ą:m{vdttRFQu=w T3*ɭ5|PiiNGg   a@z ƻ.3;iaݻ16G;A#sIа̠hnR_"qeseT.azc{yjTr6^5c:@ = !Yk#oaPP5* L"@ϬU(ڋjf.egsTWz LQ2x5l֬OLYK9@/j6ʑQ^83g鈐e̗{'Ƞs i??/h5ǚ]Pd`n!h0{{gR$&Nw3& ̟g@2;;X D&cgR[>*,AuHA[|3#V2Ev|wլ~ʔiW#UdK HNXpBBSAyfwJwIVGQ@3I +@JTXBpb薭HKtyZ TPA$8 U3QFԂMVW6 p Xlvރ؂!Xm#hN͘v( 4Aa!s^5Ѩ]4]Q\Rm1<:ǹԸi֞,Ѱ Q A ԅN C`̇9|/ 7ѳ$8x.!ܕJ& :2+kZb8CTUH``w2Q(8Y'ƵMVU0pBK|s%3 -A6*Ḹ=ZX@Cr lk[|ArوS)Ƙ`ŗz+urKZYkع5Q!A@DGW]omL"PsHA ڂDBjl`SK ,EI`y*90䓜BЀ+!V)dxv`hH)1ՈAV:,0e] Ѐznb_^9ʱb鈴LL. ԁɍG3X̚k>5|/HNtn2߯H Hf‘u: Eπb/ HJxBzaz0*sp,3hN*:KOogzvt% 1ެb0ZgWg4bjCNlP-ϡt? 1n41e` 62I5A|' RSō;;v xL UوG>d&)(4s.gAl* Yl qk6@q@ZFTavFX& ź%3;@OX=Z.`8S’KqVɂzb ٗo$C_vaW2˯o%LXRt:%F!FƤ H$sy )jaoYMz`FYKO;XCAldUguo$d O6-xUbޮ4 w0 ].P 4gZ&]4m_׾OǀN,_1-R=H}|^Ht,c9U g2":%tU1SAt~{P(c}{a[uj= Ux2jO"l{hA҆mt:b4@k BF:/0ޕ-w(TN ѥب~4Ra5ei xPvx SfZA3IjY_$sOT'&׀VNP1 i@ QeS!oj£n%GUXB'Lϔ՟D#mxKvA gЀ}>~+~RȄvPx4k\iHqU`r̈639'J.ݧvXZV\,R\ub\h.GxҚ?WQ+Ό>w:٢пIlעvPjUWBRw.wMK O*l1&nr53L48k?Zy"F9[7T.%nHud{ Z4@pĉW^yf&6R{sO`.z55 >nV*I{[A~Sw:d 3;bxݝޖ]%u]e/xViiwP|"eBDI}~O4]7˕W_RS>=—YE=Ҍq)kqύ*,<H3K"aXF F)j% [:eX3Vc6T'S ֱ oqIm'8bmpQ1PFǏ;q) ŷ)byz;R+ p6mqMbYV!l,u[Aӏ>H́X s?1U 8YDNOmX{a /Jx\}#󘓉KPM:!l4Uf'=Ԙ`4MNd=Q(R, =|DqxQp_ggװZ7ޣ/p9\Pގ.z:øAZrҲ٣APfL,I@ #RdJFDz~o@ay]= Ϥvvv1ͣ 8±< RH.סZZ $F&`^>%|>oP2S~@!VmZؠ` ӢQǤDDH )-(ZʇzRLJG>]ti@ 1 da82ut{Jed2@kk ! rv98aT 2Iþw̠{h`pX%&=`F%|ooS+DYvo,Q韙6xppS~\ttX"zP^:V/.L-&jB)7$j;[r[&YrԤS{F2;}``;gM3͡v/-$۔}=]]=}jy$Q :; M2mV2??3| d rI`dPNdΝd$2QAH5f'PK$#VoX<(Rޠ@(RM'VjG1AXŪ)0@RoPFȤ޳&BE#S fK1XYatr1|T#3YM*Hp dr&N"vgx`D(Ց|QD8Ӄ̑-kʌ(*[Z&n>*AZe" ?`fjD5a.ߓuUc8S)9aZ?BD H:wO0oBFˌPlrulV'{_yD=`c7}o7>4aQi{=;wϞ=cI3DEQĜ1`VD"slhsMGW =zFffXO=>X]UXy3MX'4Ϡ9;N[ovVJf$#wNqOhO=XSiJcS&k}^ &[nJ9TW9R҉{ZeimYк8e4i7YinL8f!qcK#]U r9/奧2?rT?ːm7pP[|=S.򓒪h#35N>鮣r'V4N*k-4h|F#V(ji?/M#nV+XiCB#qRmfkT EFnl6`*G'Y، DꊡWQЩdd>;|]hW-%W^C[Ey9F&3z:~T:ځCV_~i/Ҳ(@ qE#k]Ce7x0:X}Ԉ-{mvHJUͶmۻ^&fzuqpڄDYrI=9mm&F|u7lj/,{ueU51J'-[fK{}d_\odr>ѻYp|+TUu Nvi+>y>V&8kf(MfFPL_[GEe J#pck,S_*@ǎ[/ݾck`n;72ɸzZKMer7r${x.^3>l}х6$gu^i/wuT7*j Ѐ\:W_{mm> ` // YqP6,70Xd`gBjT#B1$ŁX;x^qjrcbr (AQNPcOgI(z{%8xƅU'&R,ϋx/&V0fG*gOr ^DݪE& LM }*7.< Oed<A 'm>B6' [E?X84,pemT?37*C<7TyBsiD:WOjECG[k[8lɵwFIg !vT:l \ۉh[ʁݽx+Ų>7^gEgLuw!3Ց7/*_|rsFa_{lQ[(ӑS㫀n§[VYܘƟ_ٹRD^ru0z4gQlϊn4ǭ[)%}g^ aCt/aTKF&g? CCZ!d5or*uKޡihv/)H eʻ0כ}Y^<~vӑ ^Dz@BcKW]t017;]twۺʏYmEG]/QdUpu'}m-b]DMsi"A]&j[fxH۵M:A( wWb@|}T|C "H^gQ؉€kڸ=/ws$ѶF'Yv]<)2𰺎FjV`^zx_=;hڸήdFtž+7_*xC寏Q /h CGjvNH~y.E~T{*[E'=)QoG tݤ3][k5KІ .v[夢rcL4ږsr:wyz)~W۹3*Ets/AU1ØioǷG:p] rx@W~'?~ߣϾ ,ڷ!>~x02^S,k4; # N E \# 1\'(YSޠWh  5 ժX<,'0}!ĸ `EE>X&R76+g㫻&!Po1^z<7rٳ?mL,!V0\MExZbW Gx2BSurU6?X,ݍ֤gT=!M]|kλZ Gu^9QVjo1?|ŔN59~Sj {ފN;76[\1}Njn4cPOPK~k+mr1 ԗdzdaH勯6My#2y|ŏm4b#'G"~~LV~f[?/ߩ+tO*1u;MJ B/ld[/U 7c6]Q~CGCCbp!Xuoi-ӟ|T?f8bvBdF?,mAhvնQ=xY "沋},,=*ze=p叶]2=-/QƜZGʙS\J%4 b߬6l.?ᛇ ZWdt-N]{l۝ 6`y!׶;W]c5ZYLccﴇֺ5wAEao;.&#)9Klؚ*vC}ڃ0l .sܔg>5dlQhx@:㹷/n2w6RyAO[fQƫ736rB{􁚆/# hph~h TX 3"AHT@P'N@LqCpf7%  ,Es*\`l sE|ބiW y P=j uos'"7߰3bc|Zc//};;f껋~ J~^^Y5GD_Ѷu~rc;~]FCGwWXn9F%˾2kTdUYᡠ[7ϒl3~54ÇtB >oAjVTYy 4$5pU u]gn?(ǚHyvm4tƿְ.9(0-|*NҖ OA4BZ&_i69pA| ʱJVFT-pMRם6s/ssAbW7$Yd4Vi=-٨mV3]wqB5qK;zxGApSsf dFm UQu֣@.(/~+IH+è#LRZ+ՃȂyP|6rsP210ˣqS\LNt|zM)1OG { wF={"4CU.A%ǖ 2,4_$(oV YAlhf}/@n{ 7 iCϭY\ZpӺo<2ƚjLk]jj_>a0veimWkNnL,,045oA6k'扱ګLPQD03p%W!(n-.MuAycV^ct0ǎ(=];"%x}'V"SթL֩()_ySd=?>竘M_]q?#_ݣ>:>Ҕd^601kΑʴ+ 03í:hjir륝=I,!Ү̮?֜aZUuճh K8NÕ!'vڱNC]yY_ 4hJIy-:}W1H*/pǁ_ $Cq#)h]NCCSKcw+d YXgse%C7DsEqݤNA1 ɗ{DX!fj_Yj+)+Zإc3WmfnԽ}R#dӶܷ@$5ω@WigVYIES(Su0xfc, _]Q2ǁ_]rVRRQVQyIяb/š; Tb1VWuNrtWru>^rf0-:9/dh.tn@7:þ=dQ 5.2aZEe5pfvX'slӪkUmY!“&0 aĜ[eew)$[Kueh!IHIIuˎGBMfje~uX #` #w{=1H(qUT׮]7l>EʈTCဪtLH$ M4K@28WX}x IvW\L( 5l+,;ov`8ĝ ȢpI06`c, S@A)(t]@&c4*Вm?  \OB;Wp H)E@; xh9ѧ>`A9囷nݼue"TL?YM~b4V|E7o^v15Z~ֵ7ǭY7ƙhb=AyO;~9#$H<! `_hXy^4G/ - L? `?AĀdEB'h): JϠ'A(0 :!~B/NT- Iߔ9AF\5b c r)Lc 0])A3 n^O-L>1YLKŎT>j́ӞP{y|t})IUg5e1QAǣ"?xm>`84YA?*Xe UZXy9!N5@Pu @ T~(tu $-tU@ߟB 0ND`?MB" F* a`~e|K&*n !Z h!@ Q%G W ؈hLJ$i.JKIi}rYe5=1o4dagl`ƙt >Ѱ{X$$]-KBd̓! 4rwPKA@H`N'>@o3*BDP@@6Š}g!! %xKg1 ̀Ώ }B)B?@Evcc/Au= 7{f UsJҀے>||>>?ௗc5 (G"<r B%"h 0 B/zBkE.^\nu׸ E+ O,+`8ha& ?X" [.+/ | : MA:3`-[%_aQBēk!C>wis#-mBQ!PIN( k_GHwB=AYNA- B@1OrDHɰۑ(DpEp>b /L rbBp&y@؁ +nw AEDc0@ssEu=$p uހdfpDnt m?/oeD,@bHowWgwG9==< ȸ/!xoپ³}-Dcv&JK@ïC JiKL@=ѝ` AǎxB@p  A(% @!KȮpzrЂC0-4ɄR^XbpԂO&8-Lsb -EFjDp_H%!RDZo hkabCy&D;Yu-# ;{lOx޾gF,]sQڳGO\?y)`8y SC_1TNP~GCI>fI loz`k>7"xNPt/JA;L\X r6 gƏ*MpIB ٜ@o 9; 9) I~a!6a:AY/Qd.]8 ٩wN<2' >2}P0u%|9t"94 } pcʀQ{fH-SB/|tXY`nS&'+[ųh#` sdžzn )VmrD7Ｎ2vQ !X"B$-Lvԧ9v@7%/=G8nBS?or[H-pJ4Hgð'|'0Z !co'g /M"M~8hXIpY|?tHO(sE%@oBZ$ #U#d hXDDE A>?@/4BEs<,L h!$7(PB2 %6`+Egx @@f\]^彘=Qz>QZZH4RBX^1A㓋vY_>uvgjIbPQЏ:fŇ\d]av:zc=`.n4 c":yXƘTRGM<;v{VcP{/Qu.rYaѕh+<!rs@/^9΀Ad 桑m AVxRqa Fgjz=s8ctN2^)k1f~bH#66;L)xmcnMTZZT@tDrGrfIE'46;fg=n%?h%2TV?wC EYxV t8Jvu"l )-#WOA;!H#H: Nz@NJ@B- r=VN@=a|ϜAXdǰ.,>!-XusL0l!ϠWWؐ|y]ڷGeȈ.t)=GXjaM彏i,TVO9-u|:`aOnZ+V9\=-DajfTyw831iaYI7V~hvkٲ{}Η@0켆Bw{@éM[:Dsg CۛE#j.WRP>(cۺ?[|IÅGu>b2 ^{3\҇pտ/UtM/>  Lm"ӣ!j&~Ԃk9v?U{9㣽4 0uWYEСmkL\F6aqA2Q}Oj}n(kćt_ZFjDLtiߖGS[o\2`{;dǟ@xFܐ?a$/ ~rw3pdȣ+<r4BߏA.XU.lm %[m0H$ s` uD86aJmºmD]~ٔx8. ^o%6(dކϠ?B4xBP|,møn'CASp AB xvMwqͩ}fTdo,ŊJ~\_^!}SbrAJ$ZD)A(ZwE4i}$U.N>hMa YxDn* Y/K1hKҵE^ n @]utS aNp0v_o%l.! ՞j$Dٳ, 6^ܕ= >99>R[|iK̸-3^V̬%Ҳ 3/9W!N3~;H<2Ao*" iq9; ]~9"$l}+;-i9ɟ?TYQR¸RCw F=?\Hw. e#s{tO4>ۛz<^[ʢQ2:,=Ezhpr-+EI{/,e7ގWguR@ >Y4\UQZ$"el|+{}^ZomD>f/^ԁk:b|oo}\I)A+d_Mypt>"-1shc5n_UUn12gT{&! ʄp_a]!nbKk:|)G@v:C%kD;C 9Ŕ9BM"w]%Jmc̀C#}L B5 >pj`!n 7 뭐4 aɱ`2i)Ui/}d{1G!<9'C`-PbhH9{<(B^yBR-澰9u\IP+`ɫ\j4YFf T][R)#o ʠi~OǦK\aZCa0L])RDI0XC! (uq^c!ug}A^q$KO|k4 ^hH(A_fhV&x.E\!G`O**Z(@T:K9;#$-IahmaDf?LM/d4Z (_ $Ę XcjKwYSAuZf|hOZ1v+ X dB#.St-]]jz83Yh(NwG$#7]lz9~Z-|Ѕڪ7ʫsWPDOhzOT،7@ȫh44׼!r!mh*|v&T Y|Õ[ihxoPа N4ȸYW?Ll1]alHS| mEΣ3!wy W;Cnh^Yf=qz F'DޗE̍<ھ{a7[e#>2Tg1nuk D:a0T_6>2]O5UY8\)N>Ia,L h/٧@,6-NqޜnmE>F"Kq ۔8$D**>#;ztNt j( 7HACES4Ҿ Z*<-zV nY0 QػW]TvRv6/{E3} u^̓l-w4D6yQ}]ϦHpss%ʹ2OR ڛ ިqֵ>,}bPjmٷaB_2NX"Ӣђ*Zd1:2u!@!tnUi!y~0s@@múMYMw A7i[}[e@`|=[^ڊָ,z7hxڱ{G"gTՖkXI|Άmo@Sk%oB= [/ɞ. #v7Osxs`br= _ T]TڮruP0.6*BSwVs塇GAa"$5szQbI=+53osDzcm(he하>֚`=;7ڔ:$xcA޺,G |WW.ƗBBbLk{|4Ԁ(M 훃=XytNƛWPd[ TWn9hβAC<V0q15Pn'@68XW!de7}{ ¤ A9~ h(K,]O@`3hx;liAX> pԴDIڝOͅ'Aӽb((-)`Fږ^/?9.Iid a(JA !Q Aɮyf)I%\ $Su ]zq Hiz%P, '`kTi[= xsQ[uM}cs }s;!y kQsV+7?GiTUU-*҂k7^_a۳`&/9ʁ,U]sK[- 6x๧`ҋ}_kLC+YiIAeimj= c=WS' 3;Wj`ϐD.>bkehqFõѰ41eu-S3k{}| |r k|;Y9o2,TUt%8Yld+: +M6۞ dzn2jFx'44tU+AUB9tI7Y]PI˲}ԔW([L$Z_?}sbk=Ez]t=K l!m7H qi{b>KP)g 9,eȌmvV8B,Uh@f;AC!Ov2ݐ#t!41/›7C/ pAQd(và 9 ^!K7h29T-!S yҺ{=͂I` \.%~i_aw{3)6w[18T12V3:R2048$F+ND2s űrYAo@._㕰 ]yxǠjdjRRx "МDk;ga(]DċԅFS1$/g8} ZOY;[0iD3<4=5>,-⩑ ܋~e~*^@uh6BzO,fv<lJnnaUUG0(dGې@$\Iht-}w?Hh_"deR mt[sG@ 2Z[PTßk{?H# KڻƸӘ(dggQ%m(ezF3 /7'7qjĔpe{ɤBJM@OKZ023YGeUvszod*)'\2*zRNvAaa(=u}x X\Fhxԥ"Rg[D*`t OJo6r Z{G|(ho⃆|Ѷ|'CiSH9ʾ%| ?/;;j||;vu9 }ZzYDcۉNMiZe!?;QK01Ȧ]1UAy伜\RqU|zѶ$ؓm-Ih^Q).Fcsp_cUYi$h@*JkA Mk6/SHp] ۬%>{"aF!> ?pH,Y x`Ag_fۛi#V2"2\>2 Ovk7̚PFG Dv P9!'2U)pE%".G܎"C<! 2b| RS4?=؇<4,Lȳ> W0]}Z^&I3i3=i78ͪ5/sX-M,l| [wƤRL殌:geinla&UJs픟toݚrZݧoweq4xނߚgMOAV_yp6| yx.*Q Ns!` i "hL6?>I' }R]M}ǝV 0 L8NN+m*^,~+o2[?}u g i}WO$IH!pdCjO(R(pҖ3).?пss82 1'wqX4M ȴ1}ۉx@ yW pe+㢝Yɥ89]͑r?4TtѣǓO?Q42?ԂS|~>?_}( d44rR =W̢ s2CKM?>d$'U 2b~t!b>cg?B6{=YL,݄36C @gx&.b3%L񯟮w,_eјTx]D->ʐ`% |6318Y_ AKP2A2ڳ7%^@Nu̥{h /~?K~׳<%?,f˞x}ݹTᧇSn ^ 4(棦,b Zȡ7M5OXN,ƆŬsBrƙtAka܎w}}2Bo- 1:;IX>K>O`dp :ob\;D> `(\v<fP(E%E6E:[䏃WЗ}c48Q;䠁x3sױ>0(3Qw;h%b&r@;F"͘(zgzP"d}Zy=Md϶?gJnb*ʹEld KR *~bimlEbJK_<9zBx!R mP҅sSAHOWm@Y]~½[m?-UPj[ZPK,dYNՍZ,Cb$fCZTg~wYk/W 92o m!)[A׎%$]?XZ4Lk2Y^Kha>gno/G%~yBh=Ș,NxDzkib>ѱzf@?4% 9U^z_UG#%!d2DB=UVAk;`ʻ=૏7 |W0% 98cO'&K'4y~joE( iI**(bL ŢacE)Zx|n^<>N{3@P@ï/G_;Ja3s/T< E $uz mΪ`ୈhIF`ܨvNx')).bMD-{F@E[dV~dY4D/-h+bǂ,:4dKjM`HX>[xN wLJJ,xƎsNK} `|+w$=9D2|9XRn,QXHuIO:]PR(.)]%}4/m(m (IgYE|m,3=Na˯G'hLv_Li+z%C'+IckCgtftC*m/mQZ-0܀R[_%rr('vlzҝQ$g䏤zv=;铃D޺)40O^в$5?Ly8y| 2Fs3['=%rtLrE%L{\Rj O~]^, %;ADhq/),6P qߏg2eE4@SƊO;3xpz&Zw5`,]ci9M[2K%OF8~C&-m*Чן-*Z]aF{sbK*Lzؘ'>`^-FԹҜ"!+/} HkG$Q5,.&&D!BlMStl`_ݹY%E0 םK40,+zh(>חiy^[hDޑk-aaV_0H}ql-x](SSv?ZUx|Z(d2 ^ ύ#ԴK->,x\ېo. #_/@ 9Zۃ5Fb7p<'7\8s$oڷ3PX/9 dh ,i+_w8hf`.YΆ_:\eJiWQR?Io]69+olqMChqVO˲ɇw8aNgh{h2R4Rfn_i4z@f .!vX;).w0/?&?o|)dktvni(ȭ{hos999Z03-MNRrֻ 5v/ʥw6h{I);#[ ܜiHE\rNo57)/)(jvonXݞ>*YOY7QQq:]$9iiI=hA1ll j~W~b(y$uI䜾 y0777h_]g- dfU1'v85+DƔJSGB'̞>{IU>;u&:<}rxkވ.nl?{ExY3S_Fb2['fՓFo\j %zJZvsc[`t|$,Un+.tϱq㡧PJ;nDDC!$ xd8GOi; QK"IGI ($(OPwGAV8\qnW`iX*qt3xu/1OY&?%I@&"YG*ɸaDb ȻR4c$ޫιEXǐPŸ_6fLpNN8]-ѡj 1ԝ3&>)̷9z0t"q U2]| 4xߺܧ/i(ˮysJ˔L w JO/V^/EE9s-Od~+wtq2^KقJ聟J[w i҂g/*@M*2|C 44LD|ŞshSu}JIQɲjօ?w;'QAQA3 QPb1+QEArȱEQiڡb K$SJ]ӧu=Ū]{·s~iQ׳fL5?q.+:X~?G] @\t.t}PQ,P0t]5HM]eGVְ B2̛wv/rj%My[*$cނ5 Or3T\k~ [Y,Q/$keH56,%?htԴݙcϡt둗pLP##92Iu %u7%V?]-ɗ!r6&](+fz -(-ekJܚxO.hvcLfXSC܆⢭Ұ-oquqiohUu6 <聄jAC("8ܖZk2 4Y(YZ M- BL]W !wKMH#-!hc8j'#vؔzk -/.X4٤'Oۙӝ0\'ɢ-'ad^["47$o- v{cG ʗ, VL,*=X Mg*b7+|gL371<98%$Ջqz-HS}0ڻ]]J߁R!I#{VV;44.S^3.#xJUztJ^?iVu9! BSAb^yQv.S4ħ8:ftsb~ 4o=1B$k>n4xn˩@zɮ%jRw, ~ᖍ̹H}? PT|ݞA-аw L1GH,yhаAHAVbȯ&RUӯ 0˂фUצ;i gD6=?fV.:. 1ߏ( [2 ][{+tQ$&Dzifm;Yq$fS.^z-DŽJb+;$_)q;9z+򴏵ڇgIqֳ;ѳ7&KjړkeD.}Ow՝y5h0`l0-f~';o z.^p.>WO-t{'vͤJ#{fSO4>ZO]}?~)iʢ!7?i(`zL%A*~TVfEu.FvxLjUOt{ƺQgRkY &%8ea׆]U3ڌת?j'7+d<ԁuN+P52:3QܺN?$]GÚ7Q2PmJaQWа^SAv}:y#-h_uyJ⫠lV ҼMo4l֝|AРP(d23nhD_tz"\.Ac[HW1 Q\NY$ Ӱ-JGy.)m)9i8vżgq"qMy6-\G.1V6JP%5׺D_=-~6τaxx/W<.c~6OjRR'ENJ-h2i kα'-JpqyeGgkq"ѪI瓂:ӟu/}kμLXq n\뚽 Q}Gz<9Nsz=bm3maV`l8Oiؙ, q"%VH~.~r )(yA[[Θai5$+ $Kt{ FG 3KlL# c%2,gZ}ك֒137wZorfN 5a`YKI+Z-jq{}sxD`q뚻evH2Ly P۳O_ :1!~|)EQiOɳx^ca7'8,x{3g -{3 !wM/:zKD>4>~XkO^7pEbEYllj%S 7N@yА%b-u -h&)PQP{ՇWʓ|qwK yi]$Y-8e@ͻ+6v!@FnMvPa/e)GQĕ R4Z\,*@" bHW%pAo9rbI)G(R$h<8?[HP`f,*8hC9Xxb\Ʌ/!aۘ Cy K|Cv Q?U0}Ba;z)cfh&"-O DR P\Sa;q=%~SE!D!;ZAW o*A `*PbxD65.F,NPT%$pH%0Q[BPzO2#Ǵ/E~"bdh^P^b>)F5Ѱ"% $r!B5,9m gʩ7#r9 N1XYYwwL BxZZwhTy;)8e4XA~Y0Aw)ʏVM4iΜ9f×}̎|pluALY_֑[KfAϮ,<}Я-BVmR"ʪ.fif(+Dz65 /ntؠY59Y5wU䖢<"$mH}CnEWz7&4{4( R uWd8,~4$d,dv "_0b@XE) >7;2p"0PT ^ˏEKoQ>TE0vQ~0xyaE~yMtH=_N1'~0 \ MkD@Q"QiE[{74 },ӝWV~,}QDEvP[/^2Gi)q-\]\#^7#N"T 1J(xc%FxfEb>#AxR3n /:6H!'ZH(^dDnaΫaCc^. % [@QXbNZE"hͪcQBȭޮVs OxoRrrU}kH7f]iFݍ&e?|e} %gk|nqz0IFB{|Ё%s?%pݹ3;p$oY%.ViAA PWz w{J󿄠ua``o˖-bXXu< Ҡ[ӿ˥BŅ e67b <̬=hdCI)Oۘtv''ݟ彲LcY.!RfFཇt\!X"퍏hyrWreB"]KM|a5`%EWG`]\6 WDz-'~4pMiw@z@-sFy"'c0Ͼ8G0V3ExpDC Rze6q4eK.R 2F)*Ԕ^6wv^@kqOgDl$yńЇfj8h=,эDbC@$lR`i׊`*$_rٗ=h4;T Pc,~BK&~|DxDtXc9wvR#9tp  %,—U;Q#B!܌ 1j1B|$dR讈1 b/TRp'!ҹQ_ dC0o8DЇ#Т"ك5lx.z!'Y14KB]~# FZ3% p͉ߒ9`\/Zn657w>zsa>Jג7fŷ@ȧ5&8l1Liw#%m"X.Adǔ؍I8al-zκP6b] )kWƼ':xumt+y^[NL̫*i瞫g;v%ou\qSUyMն *hE=ϳiF/.LTK@ނJȢ+cA'euuuu54ѝ[bNW;oޙbr-8a 켱sGSr:?sDXb.%^0df8qT†˷wO>dJ4!ۻo]g3YZawǠꢈ5fn{ 0*[wyK.}*_U+[h٦  G(M߳R_⥚P''۹;}kf|[HXA#iUOZk|5Sd] $^]k`84]!u]q4m|9|b.c u!y yf& sps\S|`L4B|N305>R#.v}򦫾_̓ꁵ֓gr% &li+`f^^waPѹfN2w_ I3K&Lr)&f>&8Ep~>0IhР.N3=2cA R:L51w厳npcgn&:]ke1iֺ!e 2zilOjǧi sO.uiSaEvwHZ)wm1waZ+"}@Ț,?ꀱtF2;qf˝O嶂t䞹b^Lye6n9ujlrci4"Klfj0ǟ&.5n;p2&xϝƒcqj+[f̚gds1;LSV3&N;\(Qqu9z=Cۗ+(~Pnr<~Mpb[[sbr;JZmP,wC]RTϥ>akq-xo,rڱ_l|F'\WW7,[ O _4k3OJyi$g%q\;B$*],v2UR(ѴW~p&܍|iQrs%'E"`v1'鷅%%c0))zחz<~pdż-lٕ4O>Oh&I JCS$Y$Yr<}*Lތ%ʳn\[o>^n370aW =ϊ?~OP)]ӷ,^4q[s65QbMCfY.M "/Tb$)q{QfNp'Hee5eǡ={.zxʹ+("'\D^uN?BEUHdzV@^QoR7$W]VpvڏZ}x0ń!,$t啼eyfe?N=siݢwee]q>M`0{Ӧ}7!K(3>r7Snㄿ{+Ɍi<\~ jn' 2KftzE#a^YBp⥐9x'm AMA w +jޭksjZf,YF ޏ=.kë;i~Il$|:Yr s+yCw^jmןD"V^aDe'ta|>CH)ɰML_":eѺ`咓ꚞwI:%))[lN 腒w2 9IcysoEyVx;Ӵ˛ĵ qe lvrD` (*<۽!:M,LtBVJnt˓gw8V{H>ęGNm?|͐,8|zHr$]>wo\98 XHЛjajq*#R`d.^aϦ͘P ߯P&9_'-2hl0B[vVd{{7oFC)Ʌ&;P:1yAl/ؑ={w-}7c4%ӥ@ֆIt!}q/Ǡm>ƦRfyٖ;Rim4N9aLI.]d=\H/'^3HXpkdq !C_n"LUyr@4Cd K]*EV" ǺML&M㫊Oݽ,c6 nS @]z) +C:7ں?`!k 4yx- (`ڣ'måI'vܤ);OU)pkn[Fp7AVHxbV  s"Y80tb@v=}3ޛ{Vb e+y<@5w]~W"\Qxw\tfhrATǪ=np}) 6wkBP'J}8&c ~hV=3'$c +N*EgfN+d,Z0=:Vi;[o)TÃp4& 8od(JH (8iCP]hD6龾mtx):pnK}|)㤻lͧ#/5+TL>ΓḔz-7opU%nv첫˽tND`|8 }Dݐ(hȂo主NfkRR-unŎ*"𗜇$ ePD뽛>*UغաU57b~.=qRs41Ow.Ev!ɓuNNmw'j7h%L8坃 c… @hР1q,#ק\~ h X.Xg)1$wZڞձ g_vNCkf[X  Q)9)j5W(d'ݫ.xgrFz')PJeSJ̔c'Rm\bp,583Y 3Ǜ5UQj XLn1 e q_+J!dhp59}Cx4&Ymoj4`8gաe\E`~Ff~hg; 5Xi\Pjd2-г }4O3< BC 2YJtsRZ4kU).X44TnO !7gˌ , -c+ޭb}EPݵ)ziAq\j:NSc(굠wE1`fݚ[-Zz-edW" dy5H .8=bLUg#JU'`sDU~?|+\,m8myHKy @egpjk"L^xZ8RTvO$52VIMŸR-[#¤cgW5@1Yz⌥v2hC;.n۲(G.:0' i智GЀ&2| t"X|㴾녣9Et:P.қ8guZa V s ֛x$O]RןB8C"=ڞl*l5 G8ENͰ񹛉8ٚDM =)Fhlc)IvY2nGz6 ; S{+bĹdi1 ӪCW{i/nqwݾ >JAYv3[t"Sg\47KGV_h|0hgb<aZߒם:|gJ)j3 4L6ƢyۿL_]Ōo8uފk! ]Jh1q뭱4 ?"@źzf_ 6`s4Ltjɲ,\  e EڞE4KYI٬N(}f7x,oÔ^i\b%*xjc/ʰUfyn_ y~LVauܙ}ˈ"ed04.:m^-3}ś,9N9%f6Bh7BSc $Kp}ﯰ p - !:PvP%7Y}3LlfwjY䧠'Gc ړpn~;wVtΖ:/ FbH}^]<YXdWelT(,E`5ΊsLKrHIph`{͗wMÖ,Rž2S'0Va&!acz=)(*Q/2(Kqc҄cށn'0Ufm]7‚ss"Zk*\*(7 +zd!"3jsM{A ):Ӝe!'1-M'N'/%o|q?TDE/tNۚdD! !ŬoX5yAn(fUe),ݔ7!m 10M&Ψ:p W!RJ6W4iu9|占,4x*Ea3̞9zegs1gN1TPQ󮭚?=^5w Cez?\>$\]ol2 g4u+$upSOq㕛l1Ksݏ ?>̍fo,5o?`/eXwE >D4 &L1mBMid^z g^huc,dƳl +%z3ஐe'͜o4\B' [.j{-+,n]_jh5uœ'X/a/̵h)}L(8ae9u)F?z\ȗg;6ћ?cdjX؛p[z]hj ӿ5?SS]F/ȡzf۩à83'0A1G]ιЀx!fv7.rYz3Κ iv3Ol4iz@_68ȓc]GZА;^4C0%'wDϔTMGer4tڭSc&#@æxbz{dKB;P*h2xdaW|$&śkvu78 7$]0̈́Vi,7g9W{>>kCa}Dc;0ݡojJyO]Kh 97Q;ױV:y)O Ӛ!pB9l.,}{n%nhQţu7 Xoh;DsX>5c -`)DrѮy ~iOs=1bW:m E =)eվ퉳qMd)<noavsZjc&Nd9P։씧)i9.S\::4ɆFļܖ6֛bbg?˦tpG7oaWA-Nip9*2*YU4z+FV$''%f20gnl1YuRr7P $Qj7; 8!(^@ZǓRD",呫𸄒4J K X/9񂄤,z' 7P@1) Lև-sr&ӫ a'Qjhb6 FJA+-.l緲HΩIħ>vXY팴Ĥlj2$siV>"XNX$]!-'qz,FO HN$<<K/' HVQuxDQb*a&rjri4֜8[p$$eeY=[x<.^D<_}+(5IZEu} A|Z! ) d$'ڥWSٽ:K%85k$fQ8J'?%HV6"_3y1 ?yDNjK,MisF^'ɹ8@`S ;aVtMt9~R|qniG 3`IV̇:hi͙-LV& #GYϩIEqU=.H{@+zy~J9BRyvA'4*/VO#nnF*J!( 61t݉Y^zjv2:iuYiou14 g:*%)?,<,q1kDb!+$eΔ&lCd3HEeBl[1ֈi~#a<хj: :Sk1jݍ*%n:]Q"*c4"Bj4 t #:gMN0%@MFhEBwC9Pڽ2ax ISyc7StY ㊙EnXsERi{_?y>:޻ՙ-=2LYdF?s~;2}><$|=oKR.XFt?J¨ ?䬸",B0<ϯ:tQtCЛѦ<$JG}5J61] 4 _NȨuМ5e#[u  OAtY~4%(KceFZ5Q?2hU fĕBy)07Pq#ymY?rKxvZvFĕ6KsnzK "\ɗ\9'q+Xz).[eQ刡R3r壓wYrْ\78/bpQ0SRMHcO4ԩVUaR\i2MZ[zZ|TEC_V}7;^6>}P I]$2$ںou/j 믩 #auʆ/d2Hf|4맯z}^Bh~ K@f:H]f :AU`kC| gH_}fy}DFGAh/K^# 4 (^ n M)CmӯQk?0yO.d+Hs_v˾\GzRx7D%͍MZZ*r JX&/c %|qF3ǟ0ZmC /Z;OcK{=nwdꭱQ%C{^IS/ڭu9r}n'hnzhP3Jk6Sʇh汷&%8~N~"*#I!EyNׂBz4jW⪗Os^lkAjyQ+=n*Ҧ4HZ--^4/q Aб`7.S&x܃}| Q f29xZ;+Y',E#]M}*U|4R*_*/=!U~")!.=֩|g!1y Jig-Ig6rsreKZ*RS?n22ъ65j}U9W- +[l 𼸸.>I%6ѳ}U%5}{_RIZ0~RۂhP1^P3@.Ygg})->!-+u%n7*,HVJ [V EGGS{ }b5ɑϋ ~T^{diJ}Ss|d-ZV8ح"~.kUV4ҥ_=jΈ|h'5hE2)"+ˡg:_=~}9XHT*z'.HRï  4v}E_AG'_,hO4YoC/%lt:;Sy8/L\,R])͕y*$q9Dtosꡨƞ/׳/y=9[8tb%{TjuH3=ΝvRh01j jeE&7]WAE%ym.rfm\I!:~pߖUsfE2|5VW)0&hk\:scD7[rŒ NgTɖ;ykݵݷ޽wfΜ9OVZCI8p2!7{#{Ay)*+yUPBrݢ3bAVfFdĎر#8yA;PG8ٸlU wm0E +=k?SWځg%u[o/{!E%=Irg325:Ħݭh݋BpDSX 5?1<2ݰN{7Zr歘9\{cZ/#lF\0e^$9r5أˁNWiD&``<Ωux~$o`,π$`'&0~RB'`-dA%c (TPq` {dLԛj= ]_W T50F|<ܵl3 &pyX0Gr+qhXC}/7вl-+S3` iHD ή<y G.15CsdmAz l*Z|$>;h'Z{K@=j,A0?SKj bJe{8=+9< n!wfvag_?Q sLzڛ ۳cs; 8@!xARh0+T KAsnMlp_ 5;d-RHeSΖ`{EdNr3M;'x0I7pO ڡft?Yv[e s"Zk {9oȢy<jΜT*Gxܚ9tfOÊec}篏ǡsnhy۔!8]P5i>E7%hRjx! _ȡ"Bc$f. xdVY_ƨt$Z r kpyS m|0 TCٛqxD-i;.L`:d[~sՁ^6Cm4b._ M6|!*/.Z]ASn,9|P N`w;6T7DTrNOxvY6 M=G@!h/jh`eb3+`+-Ma<X"6>V v+O͝]oxO}~W_'bnCeum`ݺD ~)з&fVϽM]@Kå$_l4DMmh!r/it4%cR@uM ~:@m-QE"'lؔ<\MDy+>h.lB,A 3@)w|*n~]*v0h6li+/phBr? 4[Jjs ;h=-h/q+`Nƃ2 &Bv9gwώl̫ ܃F5'fW\M:f+RW$'|b6NDZ386'i8>!S/FJϘY~\NuagYA TG;ߨ/r$OxzFaƩҳ> Y'О+lj"j 'N<07>pbl_F> }wu l~W˂'i~?ܰzo{Ci ?, POӺ 4;}!hnQ+ }#(` LߓgΜ:u믾pƧAU :>@I`ܭu$Δ;ߜgQЅ:@F%+0F\Hzϡ-o@Y7e_As/Zc"4}DQ '-CmQ݊x48Z@UG-,%bt% UpS`lyCs&dZAK𹎸!\zD#(?ۀ#Qd i5}h3'I :*k.oXLEiuyCÇ^$PKI[ qJK /UzQ?AC{on^N>ПۗnZ\h\ճ|ahX|$g9uG^ޏps;36 [}"|7<~nv߀uP1qA4@&B_s.-Y̷v?*9 iR^<E-vŐ{$l{M*Hj!9ЅE4Q[@Ֆ އBР+? 1ַ=W-+")æ438rʹ'S? lsMj0Tlt=jdL 4۬ ˷\[ޙW;U\kcm@ȭ TR)gUQĴ8pEG3:Q?[-`94@fY߽|mYj3⤜+u lwytUY ƺZnʶԉUEEeH%T\l Hl/K| z|Up͒DXE 9"}&I)]}CC;&my"#w.OO9b5-Q|s>n[&#H{go ,WАk$Nl<5U={KHh"*84Cr߲7;94HRSJGOlošf n -,V\GI}Tr e8A 4fkTN?TًjihX*Ŭg*DŸ>՜z 2ms"jMf/ϫETl=SJfޏB>4P{O=`陌  \/ųXC}V kD 6#2@ĪoXTHoMYxicFT7p{WoeQlk~PW, )`ՁZ0G_Ӹ &zʽ@Exi8P[G;{ )4H_p[.F6M Ν=]] xW(|%85; BZipsYi="mZ +w]1oq{Ff=5^.un Xo/Mz ڞ %.@lQmΔDxK2O lz]tIX(\mu=x{mi/uD x=rjafImtjb',y5;4<Bl|HAL6d ehbG (y׺pkpӵL컗Lw}e-31;&͠`&bs-?`7G0b3W**qeUi50eNHb wxo-N;^1zEHVUQ 2;@[?ﾷ` TtJ[GXlsLҼ9UQ a7`|OE} <- kIY؏3TTT+녦twƽwմkwϒ?11m Ha=N?$ J*Ed`r7,=!@z^e}fn}hXaIxEh[ܻb`n[4p$KkK4BX,,y FX `#bދ[Mb)~մ`^5yjWAX|m%򇄛`Vxf@>'uK&&N急Ŧ 0OlKU` з } }O#[G{BZtۣOWۃ&4 EWtet7]9tUL48eDq;n>Ng>G6KwV=X}_%DWGSwpp]nu*Wp^38/W۳kZ؇ d vԊ$dE"U=A:6Q[.DHH f :5*S`.@7gⱹh?wOߨf-d}[ߝkakd }=L;)yi A<o"_S EyQQ9p& Swe7Xگ~.V,)p(!]O/ch-ƖKٮ˃}yKin|n Ex"E;,&@m&Fױx6tg;V+1db} X=I m D!%dq~mvd[ d2D<DG(BxLiBێo@'~;v]BrVWWfdnX>kBrqFcX~C2Bk B ds8ɠ?j& /̀fBqsY_Xtf?9<& w&, EeȎUc{Re+eCCF<4XkFbkѯ)_Ah@J b}r) 6@ ]xp8uls?:âѨ i4ҘC 2e2HQDl.@%I m-}8 ?5҃S>4e94G bwEz`ppLlu婭M@bO=ջSF,&>miҿFLc2#fg"g>4&g3;$ej-;dGz<" ǀJ, onnhAc!oM5>%m53~~:caҷZB2\.N*icD `#vVe{zUvt&VeN[-H ]`B݉[]Dosvӓ#h櫡Gg҉n޾h)@2O7gAqC+$_+2 Li !l7]lW@d?)h&#C97P\7I0 h8 G HA }o<0NY$ mʈ9%BId2E2K@ML ʘGO{z6e7yX֒訌R 9FqKv[(c2iW/_*'w  :ƪG fC {@!òO͒([Rd2 b$L$'IԒzA []J*!9}F<\1?i(^ῤgKkbW$(oI!(5ۙ;HbNS,zuD`ETxDXH%¿H㲒ހx EEݫ5Ï{չ9PYϞW ^*C}u0䲖B _Gl֦Z**G xڒ_p[E!}ӻRHRd7_2^jqh!鱡ѾR_ dylzQMg{Uس24 GyhLz_GMK {oVJcHCMcƦ*|mpl&z3^;$WI>2Ro㜉"I T:n-4tfnjrrbl|#S 6oc1!+gÔu?|K,.gI2:>ٛdاS/|G!ʢK.8\ie7ܻPvOɡk!Jg_?I VRgy{0eco <Oi 4p4X`a"mi&S͜mN `S3BQȢ &/4-`GW %OCrHIȵUz-D%{Aa6L)I= (+SM#l&Bk9\f{^ Ih|agp[5c\jݓ;=ln޸g=|Bwm;jZ 4@[;75#JtH[ҩk鵃^o+}KqsSGee%U D= Bͬ˫ L(\^=O&`\lcӂQR5\&1Ș8m۷n+8ΠIL1Xbol^Rm .rݻwԵ- t*@Mw=Db(<|TIBϥExj;uӹ v8! KځNO&D6T纘4.ј}u'X1oa:+[Dg_Tp8h]_ ˙sи7ytq/&X? lY@f:K*BՑ0fsƼgEaDS k9VQ9M8*T 2SXSfkjo?a0HI~Vv Dq166cі2kJ? Ojqyh'K[+i"tt?WP׽9^A]Rt8zgP#<2:EDg m]Sܨ4暴ŁU 5sc}]]]}cpl#mɥ8[;}dlokQ>г4TT3J*j&։:$R UOH)brWܴT5(ޢ ?)iXXZ>Q7=401׼tN1|L_ 6PWdyU85}햒i*0ږ|F>4)侲n|aG:JqһuӇ?^8[M].뱱k<[ иx- #3s[U q&+M,Lt߸cKm-j]|F mR#k7 y=X->RUpǼc)2]\{1ʂ]#Qq?<`aQz**Yx)TdÇ%kl`-9V0,:W5 q* ZB&TdH;i*e7|MjB1a6~Eఉ1w ZhL5 )4xSJ) D-#:r߈d[4@d+_@:!4N^&W/*;x2v+ԕiZWX_;7Z9Y&OViIOSpuDh07 g6M"s/[z=18,GÝ)6k##XYI ML+O JhYZYhN(&{12>4zh#Iv/ Cuw67 N@f64s d.dEV56y{SA$E[着l3&ר,lZ\Pi"C*3*F' $orx4dqa;\Kƚ>@S6,֘TKn˙1M3 Ԯ+lBPY,rKڝK*URd1R1af{ <,tu:$דj? i Qp4TT\RO㰎=oi-N6蜶Tn"  v W4,8B_y⃪$:i!g؃ZH1Լy[ӢvdUR.B'{_|E* ##ch J}q+/^n\Ђ!Q 46˻np19)ߌ1DBlm:#Q}&d{$u.$D,ߐl!lp2&uh.'TX4.3zMaSsueE]cC9,+JJor7aKwxA^Nm7ݓu}r{ v7?wǤQ2ACqe Y Yʧ.?/`2=t x<1ok1)rg¹P %yMcE{ና-_*o7y,p?"# 7)T=̤;jR1h]LVW<7XYY.ck0)1"yd wCcn.tZ`Ѧ ^/f'=OiΟ 4ȋv Hc!P\ x7=R[VvdЀ錌o}4:n=>9)*NSx>Ԝ[\OraΠC%yy7MBV몫*ꚪ=TtϬ- ل#x,8rZMˏW^ccƾ(m ,j#8k `UDmJ>,*(vgQgfK >9i2f/ ܼ6*z겗 oiܷ-JGp4,z:3u C6&H rցЀŅ䀆 :}?"k."1=@d*+sOˋ(Q?':]HaԕU5SkF'LJ'f%GF_~7Kp#l i*GG{xFEg1i8dž#lSrbu5{ƱY9Y=ӫ/nt1qx /޸sƵc(!Kt6e@a iYYYiD%ꆪn| _ ]ѐӲ' ȣP/BtN_kG u W'ן4$v\b(8؅ʢĨWn/阠 Eƺj6:.BClPcACSL&dMuq,>joBQ,^F]2\a ^UAFڒdЀJ:FA8mʪ꺆nfa JGs?{rhd SWKJ4)(ŤedA5B )..D4(p-vrQV{mr>? *qYY 8Lu;<6Cc鮒q׮)LΆ_m+$QhHUZv}A{1dgp_Y8de PC^ދg4&{ѹLb]k=RUSқW$ڶ6q0h,\lsDsFa06KrKؼBZDd4' 6a{$ˬ~ arX]yK U>8xMh**iqD+U74OCWW,bG<.e ~m7% B$&De%08#շxhOm>ur} n6rv /=38gpfC46^^TRMa=o ҬDwO94H_ -[ 4^yXʙjwϸu<{#c^,A+&P mbW*˫ʂ󛧖wh)3x/0o+=<{kR'il模aYL :r=w鎍H dg;,tIǥGlc.MMGGaFf "kz(Xg֭&ȓ.7²^f/Hxӽn*>57WB*겼n\u+"v] 3}t㪢o⋌XY,da!hWI]Jhp]۶wρW:h,:,+:>&zlZi4n/Eءo;נ w?(f ROs{K$n)׫aH eнΦX<bgi˟n2v/fݥ/[<3gjW/J1+L`> q=2s. 5cLy`bDi@!P/ASvCCZP{B/xٴ͐G IYBhF? Ch 8ہ&bd]س"szF!)l^i!;b:e L4 K&RY.Ls^f렢q!˚4V ,bxpK&XSWܬ_נ8ȧ;bSkrC^ِ%iu{Vp8 _YlNô7tm!g.q /ҹtduQ^e d<=o ģM^-zlXyLQ|2ג_>WXAM¬ vbL:eSSkOɡiG$xZ<1sJoY~.d2a}O) 37LvQ-zwVRXbrgn?]> O! BFWh޽sGQQYE+"Eƹ*Z S=S ^s5SWPRSUc>=;eH󖂢 KxGOY4Zi~7J^ uUTVUUQg9dmچ K{&C y);[)K{; ,w#uL>4ĥM44T^̮kdncĀſo"%D,R :ji-l"TA?C4xx>53]A34ꈗ󔄴)4`C6Fi9 YayO|HؖQаfqWb+Q1zw6]I9lrnEihJ'-Ν{ZNc ɞ!:𡚊Nn҃9fgekn?.)FW(T7I#':;!E,2XL`sSGG'U*m9SgG ip b%;<:|4 !iHkxy"9k hXHv֦ѓh8AOV=6 Y%H Bh 172 63ͨlKCB[FFKuYc$aKa.6Nޮ&.ԃF.^֦es}4'vz)r_ME 8S--]:bG {0@ocCl `gskWS2-c6#s@ eؘzX-ao:2T4b #he\:Bh HCÇ!t 5$O:d=$L""(A)i C"Dg7ˏFc7H: 4j8;~,@푣PX4b>mwoM!o wX hI0]H48oA#1bx V@;\JbaPH4#e߾BzШu4 .D,BjEGdPȯ4C!H4VPzG].d/fb /)A^Cn&6"O 5:zO6HTٖ~$,IϡP)6A'Qt@؀ZqUF# uI ߘtդn@ ` vG8(ܺi]Na~oPm($\'_{;k]EaG|@ɖBqOHÒCЉHJ=er8 2ha^ܻHsRZ0 28\vswJYyi$vzh@i!PmezG#!+-`m u|xZDX ; AɎ] h!CI@Ш ҨÉn9؝Vr醆#=!)CkM#]ZOl*g˱lubQ&J 4S<fǺ Rۇlᦡsh86?\pXp ::Y[>4__W(5 A--.vMi BòD Hɾ%hjl03?4=vd#4TʌhX-w4wL-AcE4Ah*l>Pȕ,;I^[]Fohmk"uo자i:#.߈40L[?0oJ˱|ubِ61[ M>fy-:n8X(o;bߎ4H]~5{d_[u/oxCvXXXג1B}KFҘtE 4H ?WX )}*D\W9pGf]| vv(|L$q7w@l>ݷt2?[{M Bm!+q u-bIl|"lΎ ~K8b G6t}fB<6r,1dxv}9-wAUB58;&bPvD?ǜЖJB0ۇ~!= |?:zܺ&:0GG[[+Q` xt"<1FPC&/O5W5,Ůlr7wGnMscG#ܭ 3^k.@dWS߈&>:ܰHz8ЁORa;j:Q[;rO3S^A,oIt[B6h2yw/ :r"#c|}FVX)+![.eo pp+xX5 9ydphVϞi!LM+[o.Ow֛|u 5K=ߒn1l e<'#620ū7 QǠm72IL BVsng`C"fp[{RP͔xt-sp+5zMdaN^^162$HЁfxj0-[QK{l<MI}ddW:s\r]Nkn&$^dû(ZdGf4DtHSvz ]\C;'L+UIaIpk6Vߝ03wyS 5f0/ >e:o֪XcVUBؘa|˱C;'|Fo~[.4n(04`y&X'yX8Zm}rCH VNW4 LķWm6ƿz3!)LT,  0Rn&u72g?Ʉ`/9U+]h|4Pfcb,^i>RflQsoS4SD{ep䙟w~=Dμ95?ŲMݵ?W R?{TDvxL-"P2YS9TCnTTIym ytQdbtU\?vK*@r.5 F=Pe^=Ww Awq/2<".CQ+&Y8ח2/N޸#o8KoH׷u}ld7e_=LNUg7FݽhhOTӹ|1)_}zxyKE*BNY8*h-:c Maw;W!-)N{|_O*r\Yh>4}me[FA._|wu}OEKODM!lf.%&X )X8=  8&CwZ\OSI%3@5EQeޤQh+_$n wAipK(!n ϷY|5 dBC_myz-޴W^|4H8]/5!?!@X;| 1e;oY_jY`%w2@(}sec[P YI2pV| hஏ}݂VWϗn?n]xT: `m#1h`#j/S4?w,j㵓mHDkYQecZď]gI nh[+4ֻb@MƆ WyFln2W̔04OS:|\>!`ohUנkd!c֞JaWVd6S%q&f4㫯o]@J=0:mPķ~w'?gݰc0%ޡ1 2,.?lBCsF$<&h)!.hŀHȟP;BEj6eP_7CCOEPˈhrVch8c9i#> {_EBCٵQp$ޕ;}yRӺi ԙS?[d2 )|LKi}pxM6;vϏߞInGǁDz/(E {>#]w2VhZ NZb{>ZdoWE*S A}gy+h fބRH#rC{FSAhѹzz8n \ ޜ_ ͱ NtH0οx1cgӳʅkA,h{ErY%:SCQݿo $n {׺$hZ'CaΉs}o&*^&{j.`3oPLo^ú?q*g"X<區bޟgQg3/c1E rXw44{޷OE$r pX ӟDF,|+n4~4,EۺG>άÔ7T@RzR:$Y&Jp,r,==CWYϬՖr,}c}=-kOxS-6c{L/'ukZ?|or/@Ì~_ʝBV٥/$nHg#O"06)"oEw;^O9I-9nQhX:#W6dot)/w}xU5>6֥/ۦR7AbSt3Q@d}w&k^ UOlJч^qѡم岔[i`$=P9dYU2q\䙘KiߝKԝ[f2oﻣ}}ܷ^Xw wBisnSmAۜZQAEA2AD "sPLowÝaߜju g;sOi&6\u؃93Qv3Cglo_=sbeֿr-5;z?Ƿ6vSzU[mܵsl]enyn8feq}?{˧7|<}~6:&3gߙ[o߸tut5ǿ{d|6υPL?|5~ֽ,lNY  k'[Gx缂*$ 5Iאߐo% }}}840){ꦕGtW vwm\=d\쬭m\Ju ;O^f5+4C#=Ou zQ^]~EzddrHT.Kn>OۧzlceeXX syWԍ<$ATX3c"2OWg:ߵ&'#m%/qOJׄX97( INv6wF666~a-Oq%%UHɫF1,$ 5I]4p( j/gJjʣ3M[fxզ7~﹯ 毚9~sIjRHð8uYuGD6[BVWQ]UQUgPBV]Q^U]]r;IMjixOߩD'j w>_OG6~a&K9&5ZG46ƀ_4#=H V,~ؔ 2 DKR#>fwP*` @GwB'qodtpŤ: 6a xq>A⇎a}pVA-LxH # jbIp)O54ŀ`X̀JMjRaC.l1*1i841Qt9F\W`M`>7}'Vxõx( \~M$lX?Ag,å]@:<>1NslL|+0#1(J'nQW`ZÄ2hg<`P@a >UN`ISJx+ImtWFO'‚$ V`?%z`Eƞ5R\%.N #?DX@e7 c%nb† X+^bp:~sq$u V Ҁ @W76lctH V`m<&؞܁ H!iF3i`xPo7]" 0 wX>#Av$D\@YM|3).S, |GAl6&.@zkhj1 U8X5 p0ge'^?P=#HXD(c,|] 306D&a ž8V6ǀF 0 $I4١8/HwriF9i`#i`O" ^K*#F}X}MCؐ:8qb4aج~ IlGTX،*A86sCYy!k 5A$Iy c@!zU O8?⤓3 (8 X qIn<8qD&OHc U{gZo]Y~VzzW]׭oTt= gWDM"8`:1qkR^'pB${ ($M嵵Hb`]DDC8[3Q .ӂb)(Ebt(b" (: YL,\p(V+O)!*aŁ$q`L ҠR75if{gUV[SvMN_}lQ{4} 5յuvT.eKmK]ƹMݯP{t`wimd!q^w! 6OiՏKO[ϕu,]Wjwod7=h-ī'nYQz7ꅶ_3BsZ@C@>kjm4a"/& %Nm8;(H\׆ y 1 Y /a K ް")b i-;Pڊ$":|2n,#O/O\ g !MUy_{v$TxvpWI~h~"q/ Kr\rU [] WꢫY޶^҇*`Y֢uII5c/Wm^UBiqjoWf> t7]{j~ckqy=U$,#N D_$ wǻ^]6$ U&~z'mA G^AOtmwGkMUݗ/jWF6tl)J?hK7u_ >] 7I΃w}z{qeT\4I|R%)Cq Pc=IpzAyNj5si`EZ$^SzOV,:|#PM~AI7,Z{J4gnK~= SsEt նL,08nҝw۵ݟ6}c/>h)es7}r"V~jцm~әԪS#X] 0 `k$a44-.n&Go<27+ g?{uڮ%K_Ьt;\fњwL|ѥEؔͥivlbrNM7ӶdJa jCd>G֧|xQxdzw_U5޿vڽ~U~~;m0aՖ=?}ꚇO>jn]d8}V=g]]{yum@7/gs+CiSxrb\s뎛{`TKNy -],"[LʷQ14E;~1{W㧝-< 8-8N/w6m0 :@"Wa۝ Ǽӛm_u<{0ƻ6׵;mqynb1s<<,*MH c͇|eyfgQ.yU#;Rx^ֱj3Snn3n_^jq)uJZf깻DfuLjB:%Z친ݶeL8vvWf'Z~J]VҵUyP熅Gqe43TcM<:9gRՇ^?鉃9UJzLś;mXeS* gTTkn&()H+fӏ|?a\9! [>g7D({+g?pܘ3s!>Ο8^( 6+6'/\پS0{Һ]ڷ-EOo˿9u_֟,iص̳ Lx\4u|N~d6s }J)7jms~G6iYM/;:daޤU7]<군od=<3qdc+w_ ,W+-1<?"X'j5=ى.6Ɠ>^qg@۵Ϭ:gMwc2rGkl<\:nG-Ң`lKvM N rtDz K&.vMr&)kv˵ڠ#>C[wO[8\|4cƬ>?Ίm,{ol4K&" E[}-LR3fMrlKICeLYՑ].g?){oo.}:tDŽx%)JU{N_vn@Ow{늯 h5 5S%7w \ƈ!A7 fݬujtg03NeώlY|>^r' 4Y+f,"eghROuboz|s>4^. E] d"E;+}?gE;X"&,/'O l/ 72x+KN)n=(ʸmMAˠ#BwWj\omf%2s@͓.QKeض ;CjQ"18~Zi WIOut޼v-PFľ4:&}'T w;fƾSF^v_=m%? yq?{t+*8ݒύJ\g6^eY){x/ykuG7 {0N4e7]bpa)lQ?cdsAw"$ ڱaCI [&޼3QupM6?- sn؉g?ȨF- ݽ\nK[mge]ս3}_ZQӤw{ /E9:Pq1_ֳNۖ}o_2:Î.32l44Tf?;է$ՔlXt4(&{;a^'h}̾'p\[[J>dja JCwlҤbW4|q}6H{H@qH#-/w ř]ؘTfSrEg{fMݑ ͞~MGν n/<MgOxQΔ{.8y4zw'& !Wp}uYwF uyĹsfϜٜWƾa(K7}w;rjw.dUxu씝PC84v 6m]`}*-z Xms:-/ ^eY! Dc3 ^9 l­~6쾯Vvw{Dmޒ%v12E0(6.5.ſ,m>yM{ ]:+_ =}WwVɔoo:=^6u@ K74" UʞKX _wp(R* `{KK{w[ak!m܃rE/;ήΥ^d15'V 6ejYߒ+Trej`LJhfęV(N❿!(: -RӉdzec}Ck Gi*e\)]W(: T̥ zIT# dZTW':I!#_Kg;Il7YJLpgΞ&cVdsM`=/-V ׽2 fO;qWkc!+HCY1w>msOuԦ=:0!{8g4tUxXt|o|3Op/S̛=ksW,?XV<3zmw,Lܦ# O_R:x>s+}k?$xAogs} NzЊ>^zS՛"9u`d߭˜sg]rj@2 럕 7< X^2砒Zٔ??1mǫ?~)hhؒjGI}ϥ_0y{jNF+%~9>GneשfO͏G3ySDO}F`6>{s7rukjYnݹ(Vv_ҙK<ٷ{])gouþ 6Zהn>i^K# PWtAz4M#0~q{.GZd;nN/&M2(6އ&.D i !l`/ { J6uI4qOUtFϊue"_+뛮{9ix╣wI;wXY`*;[ۛyq_bCcz@K|xFwܵ@6np |"(o?Hw{Ejעlnlv>/7 ?'3g&+oVRǙ^oKk++XPlg$(OMwkr;}@U͆U+M+;_s3>sSOjuFiu<FI 7]su޵"́%Iؽ+V;썫ϳC2MuS|7^?O xʧ鍰pg\ƛtv_q&+= O{Z_zA I 0_WuX^YYc,J0iX1@x ,!9GGsHCočOpYbW0+l֪j|v/Jb+btV=i0| Vk5otk7o/۝Uw<:)3,tY ;OX6 ZOϭpYλ.ۤ# McICMϹ-ivtQU&̝!,`,ٟ\}y8eL*TwuN=" ^3G֧A` HLx'i(O=ucԥVi6LuH,o+Oݵ|ˍv)[x_/\xqv<)n|竱}sHgʟ{~U7ٳg l\ ̓9@_yUl .qM2{N|jRn fv{Ωޱk`8`W3vov|s5v A5@Xg0~|5n[ԛzu\ls>6֓SX|սڶҸ[pr^UL~?]l mQsS'LdKm]fآ9S V229{)Xmp>IS/8Ŋ*oߔ?74Xl4j?N_ahXm]Ze}S.32Z'|"4$D0Q#M얩aQ=F}Geg{]vN"[TA^侚UU%%nnՑbb}zL9?#&mgWɆP>v̀<Ф)"ddWP^aP@@`p|JZmu+2^i}Z"{+*ҁAQIIA|NչrAL1✅^I -tqmoEM'clsQ`Ǽ9L8Kewo^kfATr}pZ#0A:HCC42:}g |,SͿ'ٲV6w! أ)27Q^uu:;G!JcykH2*:I|g0f:٣֍w9DOZ -MUƂO_Rmc>MjṞ 1/&yi:;, Jt0Rև-0\!p H:E3,? Du̘-:!ԨsEsMn v4$=Jˬ¨n-w?ߠb=ʼN.곳?OVWۚ008yjvI@' =:/(4"BLxF&OWdhxdKe7 5e> ,B%j+? K-(*n' 2,'Q@`LBLͣ'2"%%gT7~^I0hxU5o9U^UΞ\vW2ÂF$4;h_Gó7oJj[tT4mai֍S7Ka4 j c¼E4dݿ}½}kfwrَ_$>‰?=2'A3{ǠyBGBt6VJ% x֎Ά:` tw0jC Qgzgҿ\FWTuSpE~cpV ~ϮWT&ޱ 9GQe>x&``daHM/G<~Ey_x䝫ݢsmdA]ɾ|~rUuNdaьՁ kMX'q . ZL簽Sx,^f̋^`W0t.]8(څ/gE;;= w1fik61Fr3=pz'?Ijh*\|U\rWg}7vҤE }7q*?t}W܈M/^2i=RrKR3fM֌xiYERx|oVWf/xCrvvto^(B]!5?!vxYj`n+04r|Hj7ގF7j'6r;Ig :".bʁ^ {qp)+4pC>)SNr  8k&BW栵R5 kQZ4tʉ _(3{d\Mo8qhG`e{WGC޵g9kdjŠMCW!BFK e;Jۨv} &+ (YNy;x6)꼏YW-ښZ&(48ixJ.mf't·%B>űp)wlZw~l)Ȑ20(C#&*O}bND.qPfq!ЄVJ߱Q)I4_IFQq'R(oy٩I !j4`${DzJDjRXJBh\oL_BÄq11AQ> ~^==(;'?; *kB_<3Us/X1Ss -HB %Ur3d0Fƾ? _I#}FG d8qcp"CFJz p'P O2lep-\  3,f"ѩ1YGVӀ+ydZrgEE;!3C>FRa 7>F"F"">qL0\8]80  /QDUplB lgǿH0vMѡ:cmZX:AoJ'# ՜E^aa*氅ij).Ŏ3`Q@vyx =Sb > 2Ld!a%CL =2$exPa+CX m2ePa1C` 1)O2f#`WQ/#R%'&%<~pu:瞿{w=]xغ;[|ƽw-\5c6X_bsT%|o~,MF\b mRvJD_?Ċ 8ts ~G@km悬V𦸠"`#By Xvp)xpQLY _' O/NR6g&l!PŠL10 #!B\xp}1U g1d8!#G +b2d0!)S [2eh0!/_ "3\f0!5kXC9! dTŪWÕɤ>$V 2 OXzf"5:$ IJb9dEhp/3JWx.P&QA9 Xĉ_; H7N {0Ŗusb`(v;1P׉ʇ0)%(r9Ts>2l痤WG'TAf,3ΊQ9g̸B:. ToطB$d%{ [z 7R|7%`l +=GH{pG)%P,@UيJ#uIZqX߈\e=`Sk5UqW7W  U,y ɋx+WKA0`DWH( 2_6f'?a;#0OBv286<>^,"F(<>aQsda5J^"_7 YĄA΂} :`IVDO v`F fxpo%w_!l$ a{ERzL `|@\dĎpaWrLL70ʐ`Ѿ: X۰S'ŝkR%Eq%?& | @g8q% |p8<QhEU+|0o!V+1&~asǛYp X+e:(,`5<I&l(-$g+`W],#y'"&[SC$-Tl'Ώb/Np$#@/ o ҉!yOD:9+ N)?;%0›1 a&X'jc_Nj˰ +/8Y۠9(u-``zO4vB\|p8_^b>LԜ%EoX2! g1իGH! H Dxa(1&R&c.8kx/XQ Mp&;5X (cqc9 A/q a\FH b4y=qoL(89lXeqr {2 '%R݋`?"Mlj4X-X=D iگl؇ءlD-`}aﲓa>rl݇%5l>c-^vfz3@ÊP a6$u1/FPGcG4 0̋ !=0Ώ`kz ("vG b/k0 x7سP9*`I&RF4Hz 4G9"`" A;abZ*ZNb{BR9a b@1i/"+s`Hč8 7`B&SQY<bOtDc?eٷح;%"I&q~-8X"%w&i*,O؟Īiƿ K?a{co&YAHDJaؘIJ#1H_$QE[1A{ RLݰC 7aՆjN2qa{ŶO`@[hXq""t (X[q+Vw:HԤ&7Zn Ze/Jr+ Ncca&Qc38(İioq e1\ )jb ʓEXB$'gtB" p~kq-'6 1Kmm-00vaٞxL(vSMIԤ&54Hג"$(A?L9j;!'HxL>H) `8L"$6xaBxp ` p*A0_ ,$/-,)}N,A8Wv"!a#3} ] zXH < vbŞY8u7o*IM" Rͤx&PVchNt Dj} Muh8Nc7H#w1& ZٱK?"$uX\/2tú Kr<0CIn(BTD0Ŀ( $h,gOMBÓ481!i$ L&r7lIMjiԤ&5IMjiԤ&5IMj(/=WIENDB`flycheck-35.0/doc/images/flycheck-error-list.png000066400000000000000000001410321500215546300216430ustar00rootroot00000000000000PNG  IHDReIs*iCCPICC ProfileXy 8U>Yf2$s?^{{ϺVRHH063/n@$-KKS?, !Hy!e g;%$݁[x"natkDw|.x]АRq:g]H!Zo[BpCc[ ֟sA 0$]#sbeI>77v#[ 07m'gGWHE:DEڛ#6&E![oq@YzGf ,Na>;}aGPG?< 2@O igyп[=A"+yJֈh5)D,Z/͟QzX]!V+;:d w[\=L=f3y䶕Z}b 8bMwn?:h!ZG@-x@|S@0/mO~˩Ũ~p2:mE?4& ߅;GSp\ wH܎?YosGё^~3 o7<!tCȾ>aZȉk.WVZF}a}nC=H, AY0rTf#a}7TcNؑ@4`܀ >E408Ȭ@u$8 $΂lpbPn;4G1xz xX ! !qHRBz)d 9A7CG( :]@mz=W;h`ŅBIQZ(-j?uJDA墊P7PըGgA8j0% 2[ΰLcT8.+zd_Ƣмh $> vhw!t," ]nC@CϣaN8Fcqxc"1IL)>;S%,ˌ*!{ ==-Va} "cÉq8. kp?x,^s~4~BB‚ƒ""bb@G&l ~\B%r /ee.-'(WĨt\©P]jzEH$ 50b98FI@-ImDA}:  h4=4sB:$X<:aE::: @St=['`~wv)F,0cMny&z&y&{LyLƙaf!f#t;C̫,\,Z,,),,,ˬUllzlll5lhv1v+HKsjw8F8Qb֜G898 B.prq3skrqgq7r0iī;gwom.]v[x TR* \r:)T#4#*l$-\!F(!rHHd@+,/Z +SG+VhDD;IfISx/RRRRRK_|u͓#&/.)II E%Eb⬒RҰ2)'*mc* *+awTI]W#sOɞ ]$+{yw\OQ^_CTsZKTOmim}eUf]X@7U[^Nޘ.}o y#͆C a#.#wryc%6*&MLɦf(3cL7A5"bR+Uk6 6m,jۦ۾ kw/_vu80(̉שl\꼸Oo_)$z@iuŸ:^w]'YHnFnn:?yhzdyz{R:5=3{_߲5@|k`]}P[0w񐤐C͓MȥP0FU+\$Dy?##;t+J,*%j:Z?#-G?.F+J,rXⱩ8ǟKǟ_HpHOJK8ap":4|Rda2:7;E.BʯT4鴜S:O˜=yLwbسAg242ѝ>7iYś}0i|Ny㹦.~`v^U>g~JrGA%K\i}/bpH([QľRҴҍkAˬʕ˯s^O@UWp{SfmD*檴[V]o1rWn={VCQ5>5N}uu-jH>אaz#1q)i9y-[[ڬںMڟ<ڡDISէuʝ5Uw)t~bwuROmJo}ߞ~G/t_<0x6h>7d7rex˙WD{y:J;39VVmոwۼ=>i2tr}*C4tLìl}>|ZKL9ȗ{_5v;O}#~ۏk -cKKk˩?~(t:NEs7D7zB"_`~  HGɿ~J;$O68m <uJs*Y:9: zOb f1(&v<{x X z&DļXT@)(WNUV}U#EYZ1cD4m==9sbVjvc٧9U_ܿ}?o9,H_Z$-y!q4ھ!-, ϠocⰎ8u0Ar4QڊƝ6aYĚv}K{O])xDD]Ţ3wߖ蒜FsSHS,QS~^uaVcfV-^x.CY#=c;w  'mRmO٥':D98:p| `-R[{}|#>ҾTs~yA!C.dPеInpea==xgO&R]=ؙ/g3Ȝ= UK /M^Uq_ɓ :>_#*[淓kdGM^m=|'K]o98IKgw~%k|7Q K4w|ywjcd{AdDyX8-Dcx )B'e!U$њZf]3}9C&c 75:(: G?g#W%w1Oo_֮t$A0O.BPq|(Ya'2es]T=Jʎ*l*T <ȪcVkkhj zC s<MrM-pf F3m|lvc7:;19u.+;w#u[{ݧ7O7 B yaa {""s~=rhBcHұָ b'(@ɉ)UHONz?Ǚ2粢r'__L͛,`$[rYBTH URk2r$ou40: BQH׏Za38.x*:]~ǘ Y+jb-8 wχQ(((V f+eJs2*4U+QBBmK݀d:$]>CejFUV&k p,Kk-9 {2 g!8OǼ| E$+""(=/\\Ҧg1~=m{;45Gft9x# c*FS>3yss ,)[Ce6iu-!u:!`%=>!L>*R=Gzcq g%X:;3G7sy/^:x9r57+o_wax O.aW}o.=g7%͕ڵſB6h;z,fXJ@S`b c JG{%2EQQ0'lI4;n@u:V}9js}d))!0jBLMI}zƉVn/]}' (231?c9Zf=Q©9ɕmC3{._~mVO {h ыwc$Rt2xaNG:_|W#nW#Lc'l``x(I9?reٜͶ˲Ya_\{ݽ<={u{O1F] nHf 1r6,:ؘcǽh;’)'Чpfg:fWVR(z]$r z,ޗ9ZQR6ۡNLw~h#3oBSӆ9sJ_S.t%n,Z^7{1 ]#DCfʅ(f.* U`#8n7jht=zI cEDZ"<P( ~AJ]T*T4|4ʹ.Ktg%31˘0Gptascd\9gKU+"M 1jqݚqRҵ2/dȳ+)+PR!揄Z3u* L/[Yڌ9w9:@+D qP9G/4 !50(#_bK⢎ů'NhO% ٝ=|V2UfrZη  .?,(n[YfY>Pa{RȝckS>oRlmoxx4xd^~/7Gny>>~F$|D:6רop}|rO=+:+Ր5ܵoFEk7؄66oQi!kEH思vZnN_bӳ` pHYs  IDATxSyﻅfw{?{29ku5IҘ9tsAahr-9rhRhSZ`88Hy⑃f8l,lFf`>{?ҫW[? {w{??{|țHGM\?H.mɗ/#xH8Yq"|.!l~83q/0l_+bZqX$T&a9:8 )#|D#N^Ļ`yS'y2#)qSDRPʗ _ȏ]Q_Y.q_&Y.~ !,Um:$S*ߖ ْB>xsDjxL72#? Ώ(&r)sW:\vrq4/?¹j]~{e5Z|QW _~g,>o[#uKJv*(?r}*ˤ['+'Qtz>TgT~l,8PCem@\xPcYg%}T"tիW1<ɖ{wAdG &G~o !rfϧRond& ?*r%x-gT8gɭ!~넼a1Ѕ҈{-lˊjb@oe?Y L.nȡ+fy6ZVGZXQx&,UmĵĔ Yers,rŵE`WIpo o ^X._z#9'PΆP^dXIQȟ \5\-[ҿلGe{hQfK7jo8yM #= ze/7TLrO f_]LC/cLQKI~,ebyg8\|E'^HH\Ydq/xDZOB6e?0sAVd^|d]>"Kyl^f|n[@6rhq!{¼"!YK6L~Z9![QN.iT;5r퐿$KC46\4DztSKeb-'|:ҲHj9>J}ڗ) Ň*?hiץ\>9n싓?U*pTFpПH;t_<^?ӟH.pGo/^xܹ&Afi!uro?𳯞I?>'6K/{y 1K jC޶+G aCEmz<=8&F$umBQopnXua& ,3v>vl+,ʩ?m<.w;22rwyǐKowyܮ[._`ѐ'n1ٲEƖ/3<,_B`w; W6 KRMv.?lS_3vQ9/iSŢR%n"z46?_VG5m3idGx޾cγ/OhXfn?Y -f^`w;We`M`ScyU9{N0O~7< pnEpp9}饗|իW5_+WWK ȟgփZricV\wC^HZ~i_}}_?ِ{ٳgvkwO4^~Px웅˗ߍZ~3I|oRort6)KA#7Ϟ?{+t N?:,ய)mY}}K?l{6E;OާMpp=W_(\ԊK9?A߯?0>3փO||L?x5 yφG/29{{\#HN%O?<Ү>@u;l/^.Ֆ3^*|? Ou_?+wAR`'81KgUG'NɓBSN&㯼A؍쯴Wmo'?FN>~1fX$6{ߏX{#ȶyzyo=o<݊${k]n7eXy?hX: c׵]bp%@ +h.؆2ayfj3U(/p2ϧ ]_J}|`JJ*W ck3ff6¡]oo#^? t[-Øٹ-ڛZp)BrBD.re&QUu姜b pEz*Z%c{]_q MG؅XXmf~Dn~:ˋӕ&šxfh4R說-TA)h2= GˏTTiޗUH_ma-p &n1gx nlO;k!u!TىMW>#pSchf^L/P\W)I*)v`Yj{۟g5+ڬg(pVkdM\>s+&mqaOW>ߨyOzFhQϴץ:U#$#)5?Z& uGuFsUQ&n1EWq93F*9yɓ%B^οI-ӑ9ǧ:܉o]&,6ԜL*aPF7 ݧʌ<]r)9f!,7Iy'Ǣj I t*?N]3h~2nj=X2Ǔ { Kŗ( g'H[p-rp8eȫ*KVMF|6w:judt57dlo͕bc3u`!eq,hEKڬ6FU3P4W57Io\&UCZ-~?̧gHqeʝ`/ed~G"YS sdB2fs>\a/[)ɴuSAR>^ONgc>fj3.gf@5Y8BhSumx(.=e:fRqYKG6 )l8lݦgaC(e.uSmK:fn|'-DQԪ)9fʴҋr&{J7JRJaF3w%p b 0Ui03OKv7ߢ7L͜aR?5f7/qݯڜ#wmْ&3ldȩxbՋsEɷWw-Eg t$NztH™ǝ)LTo{]/.Bhuj71TZLO'zc`UYg]Wy$-i|hhuܨ٩bY]/SQ5}2x_o6[c21*zܻɜV.2Qoz[ktH);Tߡ\.Ohogm5٧;-,6ՙEsn&hCFO.Rf9 W^HrgiX `-:atuͦ?U,ZEr>dOkhg~9\㇒ztnv2tfsrj~bﭝEJI؆k0lTŤ5bjZfuN1[vucǂ56g9j7;>y 2Y꺒7.BiX̂6ֈHJl=cccf,f&a|3wcs!z*6~kͤiswH7r՞_u( (phq%f7PO(~il[kO*>C'y 8ݿ|b띥$WnmWhLڬg(pVk!ћڻdFݗS>c>e&̸^\v`Ȟa3>cOoxGdz幟6TE ep=Jdsne`(](k] GŷCvGTE={{H?>]YS'NS IrHCs҇At$mo|=y||MڛVNaY΄SFy%=9t!})3dGB){ÇL?K;3[̤YBMC n6pwJ~&fpz|睁 eltas+SLb^@Đ?ޅHM6z"[8:kr8 'DO]_wptH?ejs&=DBLAffFE}4$E-l6nf  j56_TnM#Soidxsrl9_͵p~aEgsޙ |m@x٧ݤ͕JzlQڻ&}Lhpٰj}'N\tU*OUJG {M:W=f/,eB" kDlMYݩ6g)KD?CzofH,"[,Dr6ۤ͝wJ8މ6W>ȑ+oViJB&0Y|i}:l_*fenmfY jXC(^H#Hm145VLNoM!a+4 JM{,{/ww fľ_w2yxTkx~uk5mgm}fnXB8(Ni)աҁ6WƌvO=wvlJ~浣?v C`{T*_K7y<|m^wE;7ڼD9_=&dN oDpܽ;qf^+ K oۧc74c+dgMi'?F9m$$ccc"aN{;('*[Φ9ܢM;=áSܕCּ$UmT W;WG?O{m6D]ٞwNvsa3-r'9*S=/z }Q{FOw]L?ۦCvÇ jbua eme7 <ܙ6WƐY_w8;u[(ܣn;m"P3a TZ*8~.qtYD׊%3^,\<&a&=Q<6ֈnSPSbw`|FC_06H@Yb է- mb>mިϧ-",YxXm?my\'RMlW:}\dGUT &sO9_,7T-R\,0 bXm mQa~^ڡ6OW⍖fX8]N438duU)h2= G3IGu<@逺ğr~աx7YDŽf0Yh3;tc+R;fձ-31ӝE8Vg:vߒݬ=ѫ8ͧBΎJƄ3"^96ˍͺfaYwzv[XYvr6y4B{=`ϊ9Idًl5"-;_ dkT@}@UP,Wªyӕk!!$t608kReT ʦcdeTco'ǢRƵR#,(d"3 ŒD<,Nا3 _(Iqf Ʋ9Vo Ϥ^UoXBIf٤)6f̀!..-2 ǞFaBʙŸ0N᮪6J1Nc=+6EĜum#8F㛵ufIՖ~Q3Z,g#%~ӓm؝dI|Xfe^ձ3ץeP2ӊ?m,obWg5]> VM|fy)|7$X;I zTLKl_h{M JG64!f))+#2 G>Vc*жtmF~RBE~()2ZD{s9=(r6(J> :id|GnUpnWkm>6)Oۺ~3>(|czIE62z5)36fg6 VOW}#m?gmnNgؒI2I=u9c=մT#R6c=Oq'aWδqdf|_*J/|0Om &ŜZL S>HnT^cUYg^\/Wy$-i|hPu1 M^nڗbY]/SQ-I=c2|H%Fn2GW[DN!nӕ"P}rEB&8>lS՗^fr.g|kZ>`w> ZY->mLl6zfZ;d_轊K|&^Hr_fZ`^T]j/dDnK͆2ft缊EH"\z=Aɣ\pZJmӡrp2W˶iۗs}Í+z.O&++sfuf-l}jlP Kl7ʴ%!v+aR[?M+]ZiiY3a`/ҟ MLW>z9ҥ7;n~5/UY3[ZnT8ɀśC[3[k_0`(ݡ6WRF6Lmg ip\$AhkR>GQ(3,6tl! `5"啛'&&Zy.ȶUu!P7 lB,F Zaf1vcWYLG"FYV0mf5OuݤO[tVX#Xmsq':T{y{V63SumVh$m@nkbTC_0da\Cnk37%6$hoMEc3;o,:AűYz?mm.nh3mmgdm-k3b/16g7Xmfyy,֌Sa|3h66Vf@[h>m`bONN֭[`;af`fV^߆yĔ#66esvkcKv3v3[/Ӗ[-kD U幦S5#Z*J6kQSU{{]t^HߨY^x"1ϡzfrS.RZ~hse>D8=\QM!+L]|6f}݄{Yn dB)lҁ6'x"q "mؖG=Z,$/;v9Z߰^If٤!pT,,CfRqVhF~ss{E~`*YLW-GqSggӮhlUn\&UCZDmsv Pթx_kzͶ4]͜a7R4&}-E)SE*8_:] {>\UXYooi >tY4+i$,PbbLgQhD=ZhsC^|lGwN^O{oRz|mʤ)aHfWRAn/^;6 Y\fSẗ́V*ݞ`%߶xgf1[6oۛy@hlf鞕6`v<ٺF1[e(6d`acЮ &W~b|fh3j79}X_.D>mh3A(^̢n7ONNPnk~%uygZj_lB`qY^̂ƌO0eE(57 eH7)n&ğj-Sb$rVctܫ*yD<83juJ*>xS≸wb9sV7 -߰6IZ~ߣ1cV- Cȵ \qf@hrh۶|ʪY*rW%5Ipx:ث<++*ӵŗ(ڦS[,˵m~f $_0]i&S;rnfvW<>>^f^J|'nb̐ j&8ʅs=pm:]f ) e:'m);+%26|1,|dGU{X:6ku፪6&b>OIw)`-@PU)LʴO ߫9*F~A6g(K{s)CEӹں[ר"O(Hh3,6smn{D qH,9;~/ B3r/~[yZIByyo?4+wi$o+ϯSg_p\6EfQl;wN+^<@Ŀܩӧ&ÿށo|7ѫow@yoBnhX,Z5"ú;V_~d +YXb,6N/omssvhSYWҎIi ,6kfod||ٲ6f٠|766y:Pm.dөˉ/ӺX V@7Y,1sC?m1/;SY~W {? -CDoi3/?% s5\YRs"ogm~Wy05-E)I).i0BkŜO[,ϷbTE 報|I|4׽-yi,U 3D:mn*noTr'SnN;"xŅkJ7ZvclNu]'{X̪`7~bbN9fym`ħ8CY)@y'ǢkZ]P iL:U1?kF8XoXr$ltZ:¶NE%5:};f!JU_\oM~*ͧm*ŸXMk3O-plI"Ϸmhl,sLث:ڎy.Wa/YVCTxnR:(n2湶Xs*P`4W-~?"ۯӱO"j $,~ڢoCf G"kenӓpUra YšnBґMvL#eg6enyi0a|3OwkDQV+yc[j]ۭlIT0UTtӯ`44hf͍7sݼJ]٩&ͧ}CRUz.i31t6htHWi71f}bY]/SQ.^+'z;+RRL<4pl\sFGْV'=QY0mm>įiwK,zzS.tn;vBOqZ_'Vֶ{#s5zBI60𽊫YSB#y$XGmNm?|7Iq2xK,śؘhfkO~+0~纭z]Ӵrn\?5<,T>[įT7f6 ,H4}hwv{5Q2@YtVg2̫C[DnXw6kIi}h3pk3IyV1TUvn*h3%mG67bGK[ tOfV_YGATSSS, kDrs4G76kpgz{3O6[l=D ,6`#U!ZXf,ۛŲnݚD_0`bnho "BͼʹAmAbsۛpTRlml1$f{[66fa$W]r3͢չ>g'[nG"hlf$D_0`LbMӮ_[fvs$XX4mf{X^j7 a ,6fnXVggZpżԩW9I t굼k9ot8^l}܉RNWͦ6NNNNMMFÜmhס6OW⍖Ro_(I^ U]<[%q~9P<x`#ͤd7>mŢ=~B}VKcSJ\{Wy0lm6ew#gN$uY2Y49ݑ65#LLyuo'6TM|& F=/]^>e&̸^\v`Ȟa3>cOoxGdz幟6TE ekwv;wGDdL+Z[W#)=:zbc?G[bs5bY+gB)l< >F{2d=upypC9ƏRL*Vg93s{lPӮ۟ asg9yg`ħ8CY\N<}aEqB{'G]G˙7SN6Xg mmfpk׵f-}Z:l9<jhm0B٘+G>L&9S?r)Ik^63leKc$Whէb5x:G3rNEM:ؘiͲܹO[iS!6j̐XEYfm6EI;=ܙ蔴Y+kivqTwlfe>,&fykƍCkiiM3*ɉi:D7l囆!\I5CzeS^oP;mIvZ u]Yy^0IpmRάQKitvUd9;#lI+vܘI6NWO*w(Wr! @PZ>WRO*~r0+mGQ(39j3-cYyl׈J4Za0m a|s6$bׯۛ-CF$LKL N MlSB>-QUu§swB¯m0Om sv2bYo7)*l,H ( g[M%ԇzJ ѰKN2O%[H,I:Ywrw%_u( T<yhLW>#pܥwܶndL)Gt捱6a,#mֳkGCROubK7ʋZ"p'SQ4t(ZsO'gԢ^:]9K"^Y39?m7,T{[<BUpO_h8_ڵ'zw0s@f̪@Mmr9+J;e'n@,.m.+Jrhw+l"6Y,ϷWXs9wRraWstpFbipuϿ߆X"SQ5dFZkFKe*TreV;O?˟5Ÿܶ6ۗ}q:ʔ7[JpFJBHGܜO>10gmfۘė$S5fwwGD*&kW9\]PR/⭷cWH3k!Ʋ,tU\^UKG/$=";g^u5yT?v~Oqnw,r.WLCOxOn_n¬/%knx&ʷf;M9w#p w-gK;d>Ì4 Go(0gmf{#b@]ɏi^s:%>eHbkg2|@ ,a 7m2 8gm0+0g_v<(jeKI|EK3o}ڢ/ksm6RUT>xp8 O!T17N27OV,AfC%&k3ͼ7BS >myR0$q_0n&nh̊͡t)4XmBv3>mumb 7c7u*1y'X4mz?mff1 t[Yuik_01yVs`n,0ߨQq2Ŕ h3)ķn}ܴ\ӮӖns?mEf,pC%\޼ml+sGl^آ><6͢{R>k܌`"h3/3S =9*k3A5Mi[o_n6fdP SXMNNBnk3;\{]nf㚏y M(b[ֈdant+XP6.l=[7o#߲ch7\jߎWoA 2kCwb>[+WkgwTpnDnq)6s2,7hhuw6Zod񣏭)5>nȥ7C}[GZcxpkWI}ᵟV(K}};m[~cޱqժU_ekD)h+Aju_Yѷ?T֯wshþƍ^Gŗ&C}cwmAjs䮍r916>eeDLt'Y~L*>6F\PNtoǪ-yi0E66YͩĂ}-+/wn? 4&یwBm6iDDޱv&nMeO |+E9FvE:fYͰ-[_q߂~l_R]mWbd-}=Z,V%.+݆o)_]CR=844hN|s>.7+wVapP=::=owH ӳn(j>$(cC?رԡ 6sombl1 9t;sjpݲe˖X˾KvO/]m& ?udKM?Ҟeӳv;,5y ~{Q+9eJg._ϽK`_7vRgUQ]XisYs=GJhvV,]ӳl]9e|LFl_.YGne:wdh\-_p׭eׇͪyGVsO X݃#V/ʪ]*J~]O_ھ̣1>xľf\:eMk&aoz#lxAdm&lݑZڳep+zw3wUq(A򐲴j?+mmi0*=زQGgwh -;G;:exgue.\IkKt2oO/[aV%7]ͩA{65Wvw*%6ز~/ƿq6SʿϫV^y&grj7SJ'h~m۷oj5/m쟷?Mm!̱WUV9Dm%;+UrǮ-|Kׅ [(|hxmj{Զ:ѡ莯~k7wis97(izfpx}Gt_jNʠqgkt4zuj]m}OgPYptVʧ(63={}&:6s"ұÆ |+<]UFk$Zo[,JfT,.gA_8NZ|ңn)vՌZ;eEK;.Q56ߚZu.],LX6=d/ wx 'F^<ƷkA}e#goƍ~ Vvj[_߶h d6vMUe=]mֺ͝\I2jZv +̶ϬxVKp<^!6*弣эSԕ W1t+k+M9j67}6nhjMkWƷ7MՐ0V/ξ>lu6Nvڬ(ۆCk܎,k! ͩ^Zj3qvs2]R[v FwwmTnNJwMm}}}k V0̫Vכ0[ۆOUYypesAmZlv>pB|z{fh,K?6/S:W;jꞥhM{V[zoHҳbYϲuwTtN =77L~ˊMm9t\Gw 'C;Vw05 c t;G_ٷkGZ$6>rرo&Yyb|Kwf yzAN306!W=SvL΍œVظV.;ἣWHϧoǑڇ;u>_0[MHW>z͋+f\GM5#zM m_'IYS[W+MZ ׊2UU}&xӇ}_gîWqye/JzRuUb/OF⫺"TQ^<'9ڈ񚂟uV1[CImV,:0m#(M :A2 -B!d!%ߠ1 Ad) l4zzzzӿ_nة .k`UX7W=N\r*_?^ŭ|>E"~FIw(#%tOPe Rλ4Jjr}%׫/A9TE%O[-QK.{ȾFVaE^i5W*؂ͬm\f@PUsK{k]ݾZpo uܒfMoF2%T0#Es{0{vPS_+wO_=ZS_w?Eߪ?/EڰIR؜a h3ƃBP(jӦvF۰M&BP(jĮ"/HݳLPa١P( zl0ӑ充u `Pﺨ~^Bx27BPfqNxDMǟUcsnOҵSd2(cf"?^j 7[lQJ uP.WGtdbwCVn[ ]f:;b '}X̕TGIw-t[-֎PrYI &I<- b_LǢ.2v&D"c>K4i$!#IR0I.kؼTSG?#z'GDŽKp6:{BǢR>U8хIcnҫp-^o%vV~Rܻ+.ؤPe3XsssE{/<3@zl.tni=".z`Y;[:λ61gq3:Riv\(**esXɡftvEe"m69" n2񗑟 m0Bw8IAX{1CL2a)bsL v8`o;{O(8#0 >4O[ͤ1HKL ElNdSʇĐM'_ܕûDaJ$Bv!+IUp8Vl2\qbz!&-sO5"~8=f16?ob1;r+ϩXvpz!0l-LSTct[9\f7mֱɝqw(On [xpoIDPKe3*Ͱa\E6+^.G96;I PE 6~8?,DyfS e,/E,Xw fh4(~,!P̏bQ 9 CQˆyhv`szEbC;*;UzV3ޜ 7)ݯr72zwAGo-2J!P*`$սGfA6 UM6NV ;+ͨh1죃i*mewM&Ay<9pGx]Z- j )RS0ɴRD:ū@;\_W_R~%!FCmVKGcIvϏE}n9w lH-tjD%S4"3X/\;]H<.$ cG] j9Yf\[<#7+ccR-yAٜ vԭoU(TfmTm'?i*[ڼ-HK7_ 8i2uUnvjn %{Gf_J~v[. q.]^ > y3v7E/Xj-iwйQoŮxt ^gyӋn 3\ΤP.0~:"$GPհa;0ӆ=@=v*h/+dR:_,%(~5sIIT:FOVK萼:QkFf1Pȧ /yguBb񱏢aX߿PHZl,0l&GE{hi#Q(٠Y[yVa}R>wN_@0Pg3}E^Y$m|G$ BPa3L iiБBP(0 6T]`ٌBP(T ̾B]CEgv?mdV 3S XP( U6۸t"6Xs=oMЁ?7۝&#O8Gl? ̜\9<[+?j(;4 NJ8(&[Ij(b$*at<)n<0@4k__\>e;m'3|7'1?r(Ie*d%6Jrsgsr8~{ʈ*L\c=q\Cxd55Fb{# N3FfV'^LW6vڧ f仉l6$)0h?m 3@znnflL'v>=᳓ 8&/B>P|y9CIa=^0h|^Mˌ|E(lAm7 7<_F|f2S#fHLn%y4^59i\^_ p֙B(dx3"9ӗ7Zy˥ :>SIi\|bijkZ:/@x`SCEG~?C=S8t]FZ̖v߮zSj:w=Mfmܴ:s֙K]!uXGDR4r3`|f=NH#: _ӗ Ok7쇌oL=%::N['>gԩ~s#s⏚ċ9ŧg8qKy%[;ūgl;XwQfC6 ){n H׌5-:|b_kBtH2_YX6璖Bbdo2|uo}԰ONןltB'ox1wknEqqs2ATSh,4sk{ I?72d͈#HYp 0'Uk\`l|tX0ٞS|kO֙h1x]KO$@7gC:^L=2hEx@lX#>U`6#⥄uDqnT |G$}?(d9)$2pu3 ٬OR:NV<77wujP{>C;ٳ2o:} 辡>iyJeu/B'.ވe/H珝Te ;9φ QQz f ?^zU yK=(6E_`$[%\pkKh!Aa'*ɏ6hجyT[nK ^ˤq\K`|gbd`ab7:wSc%.(~.sM̋WcRxVaU #2!eaOr GB6ӦDZV V95Y}\oXn$jn)da[f b7V2g4TfnoSl~n*NqvMՉcvJFl]̲Xw19F-[h77\eTr,Fhx 1|X$l,A|nڏ ;6k5Glo2XFkp{(dtwNէ $wk}> 7_HL0kOު"ۓ9zޢof:lf'uLݼS8!~úd;2>::znb.r%uĮRͺ锰 )Ջ1R'l!!OOexn:`"SHnJvswlr*Y6wC)|$Sl̈Ol6im >mtM3w6 ofp4ӓg'G 6:>_f/]צ'] ñkI :oW4ԘqƆra5aͤ Mzs|&;31B *1+ g2| dh{ƀ O1Ԟ|_1t.4mO^|cq׈̈́Mb]xuB|>,:ssl|Y FWVbT#y!!XDXZu\gOG-ϣ4})) ӝ=X7|ž?#@mh}QiWe3ӖGzKfy?K+'86< ,*ę4ͺh#Y9ל K맟:7ф&ψ2y\C?N|c )&s*&MRW7s7f4sBϧ-7 y݅  B6 ϶j7ws۷k^qcv }I>gnwƍ`޺:CWߠ\V>Kl NFZj,O"cSb49't#F9kF!c3}$Z6B"蚲B"j#lgD2P >>mHٌB}Ѭڡ2 QIJl&}6[ٌBP(T٬7â)XIE74N<<ofתL+|piٌxKb3] T6l cP!W88â7?ox oFj#Eww9\B_ <Է蠷/NH{p{$~a=2l \ ]R>`L3YxTW$m wo#ǭyuoo;|rk~ڇUu hu}3` wrvE n !~Z ~eGنfH/׳g'G?<@}{?3N]9̭<Ա?体c=!*Ҟ\=~Ϳ׸F=+WnWIz$ªf/g^f: Tc6Qx߮ǻsd/W5nUx=~ʁo.i^+Nym<ߞ=_%c?%ȓ NCߒ}kyzb^| sf?"-7|';L/>9A l}(mkZ|NlчzJ۫/w\xϿ ௟iymZU_ϴ^?6>@*Wo7?lx'Yzp_vjCkw9B}e.l}lܰ{rfZͷL:71'j}p3g۵g>D˷nnzDP~WÞ'<#lL|\}sނO츴gؚq?c Q ]36Kܳ[rOHwάe_9spKbo@~[e[G o_.Do }]8VB̛QjN~+rv}p[ozS7mBԧ_ght>m]ڊF;ϓ&\Ϟ;1>;n8{$i˦swW\lo]{SN Gg%\{&-ͺٿ޽qTP^I$Zp!nK}Wm&~ꝏ7NӄĝWݧ}[͐B:{ޛ%\=Ҙx§;Y] 4X`CWjӖƞʹ}ǞP`` vξ#g!3vX5 CX3(wʉ_i\ͳg@Mɦ>;r]n~`{<{'vy ٩o?ލg۪pkǴѸogoZ?:Co?o{3rZpfNߙn?, - k D; l>p }crqk(NؼAOL0w|X)O/a[Hm ?6re3oK Wky8ƜoxiQ[R‘w/>`ZkY6*3r6ėV[K={7|hg+g[0'=`϶=5+M?rtz%Elؔ~B6jc:>* V_<:D`7͎ 0ȿ~|cgV !Ln"yK(vFo۳#g:"g% &YЧ}g7Cipnl ] qaP0Yb~B{Aѽ_'JB'!;^$gѐF['6Qu@ <&Yk7#X{_ i|GЕS#/F^:ww f [ڰ虳7P_ <w Ck+GWH\o"pk%qz #67\K{ā\~s'.\04܎gOS6̞6NjTo$͍7:$9ܸ@}ڛ^6O[H6-87NV4OzTkwؔq_ne3x+yUu}?kwa'۽3&>ܡ+fj< TrO^6faq[%] i}# 'z\ӧW*NWNjȽ =`b3 ;ik/n㞝Q߹o]4xfk;^M=gh s٣س$[֨_{qOb힝t&Zgd}^7O^=+Ǯa *y99W|W쑞I3#_mhv>/ff<< sU`C{vҗGs{ѽGD BPhQ6sM7ڮX( BU@a:KiSovicYP( r6+\06} Ƣ󴱬Q(72(dfNSD*mrk;B-FRcfr&jIt_KBfyOߪ-Of.o-Nd~/s`(/L\c_ֳ52sNGx3qN_ź֪FVkzB6W.OnJR`Ut,g<3X5?wGWKo8}yyNVv;pmFOdamݵiP~Ս|i6ku,i\ĆU8sq͋&6We3 +k'K08ěJc"㆓+9>SIi\/N8+98 8\!?Kͧn|F=Ƌ"b< 6*yx RB:s87*>#i>~NR`CgO | QI,Xӵ 0;ѷΞy~K *LKx_,{${ri\=.BycO9qpN)"qwbPI37JHKyv.Vq-b^nřX'!x1ްxiq/ n2VE_1)8sIəeS?ѹc57.wAwl_|^ų o .K K~d9@jfiðr;"gjͬb>7,+-2⼐<7 W2`7 n^5S l0Lf5IN80EH/,b$;еc΍hvaij\Q͜zegtȎ7F;`|7h xSa3VsDf&C=JljDa3q8 B6bjlP: w];6̜x8uPN4}xK|y=-Vnnĉ q<&}`cO,N>3;2>::znb^ė$tF2䗤>K]BwSa^VnNֲRU K`n:`"SHnJvswDjNN{^e9ov dy1sik4s`CUMN'6='!Ku<% p#{N_v50ǦM\Sx<|'!go,d3gɹc6(r].6pbK:lքD 4ǭuA@Eܨح}G™-|>79Y}]=9>!*l^j> /}109uO=̪CշH(T&ߙY,>JG=uEr~`r۰a:73L+*PTHMNuN|='}Uy$ՒnH{9c(d!Ḭs'v3]{vP_0ME:+ԨG81%<m Bjf3* FW=Ñ( Bnw]=;; na`@#Q( AHVƞf BjfP{ CP(l5Th_0v6D6P( U&{lu}3liܳBPڰ0 X_@p~ڬlFP(6v3}ss ladY]|B WФ(¦y |w7ۭ6jGn#^~V+JnIԪįsos:L+h*uG*Z=%vUI.)mvtj湹9:&65f]6_ nw%m X9;iB|? 3;-ErOf}w($ۆWx5JDWHjlRBB"hHjY|X+~Kyܖdjbj8.N*LM&Vapk2' l Py 9HCN+ZV9T(U>m@:O󑚱eidg:̀?v\ys_.D&sB4 hR/|H|=̆tً K ) W}Xz镥b?fsi/0q89$h^2Cz%D"c;K PR$M0ۻJc-^xH(as:l}?,D=a';-Ԣ_z9TXoXV&lK*g}AXi *!rקR]ζ!GS %.u2锤)z+R.M]V=Jg*z3;Snou$luh/Tg:λ6C`ܪJ?fRPWf'I:uҏz۬V?鏧 3Bi8;EI~8r@|`4mT>tlv"p*]JvT*wl,l#j"FTm]>p+Pu.nɇdlv3K ;vZH".z΢zdұn]/Eg͵W?=UP[sd-jYu]Ľ`u*ϿHn0Eu٭R$ИfrINo LT>STnk3nϋnۇt"Ye'K3t@5T6k6,zE>g Wfwқx@+ -v>1eK3Ue` \nGhr]QGs6(o+.\r:Vmb7ruBx&qxC8CHm[ǐaa/vb;|x:\:Gt29{V)&[?o鱶GmC$S)n)xk[+ve c$R8>=Ny1hc|?ɠ3ʏ~1"ͤnd-e*J'~ȭNn)\T;~!;JOQ 6:氯TVL,'ƞTXզXڤ ! /c,̘a\gtԜ"<-VK~^ʆ/}ٚcp?4KcgpLsyڕ*iYBk niBS|퇾^xo&|;\z6'4Y]] LU< $9:&\G#'Ӊ![MIxW !\ /NaoLߥ)APܲN(-_"}p&)D>;[m~iZtQ6>{VXdesKqD#-b/-jUԩWim&X՟Ug4mE&OGԛ[C6'\ G;Tj$yt}+-mJ6 (5j 埋!LY/\a}ԗ _z@lz7;GDis,f)|UBAic6KBvƩ`%]`WP4lyi($*lU{uG4>m͵L6]E>v0[`2],7K>3f\_prtm^>eQS6”"-<*C)_,!k&Nͦ4%TʦJ)nYaPf0:m[/qi,;%l+LU x|LTI{.4c[{|)}Lo+SE8?+aqM]Ui:vK%e󒟗riB>J.^f֡M[*X\UO[hVG~f۱˩ <P0 V-o/8hEs1 l\>#Ɠ U6P4G#Ca: F HjQ6Ij?Qmi]D2:C٬Sҁ1/'y6 ؼ\ڇT"T}j'F>ma:v{X6]@3er-{M#1NH Jc6GWD/d6WE;m!!6XPv]ozAX[NRb+n^3ǵ9::.t3qީy!*N~E*ٱazpZ/~:/ݭLsSKc3Dcvh/yI 0X<5V? -͙t\c"6KO2l6+mT[m׭?E, lU&SSkP%^6t,ʀkש*\2@j9nGE[(j  - uU>#$41n_bM#ض9隰6̆`$letð fir^EX~tԾ^@DP~Qj%zA*`'}mvv3ςZ"YR}2#N&i~]]Z͛,o6r*꥿$YQ?]nu6ƟJF6'@ڽ8]O85D#$y2zdZ̓Xj4C^fRĎ=]Ex膧ǺoI8wgA4Y-mzU>􄶫 ނ% ̆ObŊ7;lIm]̄r`w%U*hxYMZ\YzRgˆUME?t ٬W.[1emiX2YZ5T(,׫ӑ|t ;OK}^t—>L|tV;(j%cǛ*o^A?eIÙWe [J%%CAfjc.UxM|,5%Cܕd.49*n)Ud\r9Jo9I*OISY[#Cji"8s.Zv1e!ug %zjרK}n菦@P(EڤyjxG9TO4[V!湹9f3!gd ?PTP(LT:K۶H qELU1fX[}G$1K04Q( BIL]\0z\sD BPȘ0 *b36BP=B_֬ F7elFP(l Xi`SLcs~j<"dpneɢP(~OJe͂CEl -&{)vzƫp'gj`%CP(T|Ybu¯pu#L~i6CBPU.#Vu:ҕ8bv՛' uGt64J`"Ñq#/5yID쵖FNV 5:}٬h&_4*9s>gI Mu3-54z)D_=- зhll̐C=6{܋'修#BP!lx{4C΋836pCvW%~3y]{[! 6qΑQaog2G<u-=hdy#kfnM} o_ͨL-_9# f lOy|kO֙h:׍BPͰn\tq¢)fG=_q ߗ8[;ie#u)䳞5\pF5[a0ou~m:$?}=hvMkc`ַLƈ9o.F%0A>ʋ3Nb|P(>d3nfu6)c[{&\kd37X:_lȃ:yK>KFٳ=.ߢqh_pl։&kH8px|:X$ϑn P(>de aՙn޹HC=7k1/ 9Ffo䝖u憆sN!Ol '1.=pOx\lFvĮ*T@Ŧ#{:#{Rh+B )(  ʰ6Z}] 1~z)x _!79(τWJ 󹉈L<3`49>$arYl#fH:&sB\h{ƀQ( u.cV sҀnG=uEr~ۆ'{i(x4/(ɷ4xWR6{?}PMI3\6~ɹ 4&H(Q( u߲:f$ji>'ٮ5-*ټȉx';N:{Wv [ՊBP/$5˘ѽݳsIlv.LLN\Nbs07 BPZ TynnEq2kjP| DP(T >mB2{v^/=T( BՆtT#0L=.P( B(_EkA P( Zm{a7 ~saN@:tnv7]E-t!5l{BbN2 ΂+W@Rpjn/?}& mf]3ᇥh<9|[@gˁd Df4,ݾ}6$KD='4?BfHPZ -ư+|&ـk|ҙ D!C;Kk-6[ H+ Dz9lkƾ\% 8?B4by!f43}$L.CVuz/&7dY۲|!l~?Fgb {-pݡ͗ &-I n"/`Mה\}~ArK/F3I3 h{@@Be3Ɠ(Pd`+.;Tz-MJO>W BqN r!4>-(z>M5WAWlN()IRfM4م}ְTn@]zػI 7-=xA/fe-m7&OӔJN;g%e6claI٥XҔ< Yl!4M)hvlO/JQE,[4e/ZPl3M8 <E>2E],:kcr}}4)/P}4ucZ6@o*- 'ػȞv"艠h`[UvҸizl: [-4`{|43JY '8Ӱ!$j"@ϋ&ЁM9-tx!{lf v# ktm!Դzٞr495mhv5pfS6ղ/@/S~ E8lMsF0y5Qa"*;l[A 6#b$76 znhbiLRMJc~v[iK w5hH!me3dS`=TlFk`M5)l4"Z4Uj=VVMtԜ+Thn9Xxj\7lѱ`v [/⚺BP+iOM"5 ?v6)jS'+٦DaS+v#X5gY*uh,}¬YvY?2@-iqqEOMwGWͷl}i>km!5TM/6=2C<,qYYΡQK/_.M ifF4hfLvJA4D+:rve4k-h,i e5f BPZn,IENDB`flycheck-35.0/doc/images/flycheck-error-reports.png000066400000000000000000001110241500215546300223640ustar00rootroot00000000000000PNG  IHDR2fYr*iCCPICC ProfileXy 8U>Yf2$s?^{{ϺVRHH063/n@$-KKS?, !Hy!e g;%$݁[x"natkDw|.x]АRq:g]H!Zo[BpCc[ ֟sA 0$]#sbeI>77v#[ 07m'gGWHE:DEڛ#6&E![oq@YzGf ,Na>;}aGPG?< 2@O igyп[=A"+yJֈh5)D,Z/͟QzX]!V+;:d w[\=L=f3y䶕Z}b 8bMwn?:h!ZG@-x@|S@0/mO~˩Ũ~p2:mE?4& ߅;GSp\ wH܎?YosGё^~3 o7<!tCȾ>aZȉk.WVZF}a}nC=H, AY0rTf#a}7TcNؑ@4`܀ >E408Ȭ@u$8 $΂lpbPn;4G1xz xX ! !qHRBz)d 9A7CG( :]@mz=W;h`ŅBIQZ(-j?uJDA墊P7PըGgA8j0% 2[ΰLcT8.+zd_Ƣмh $> vhw!t," ]nC@CϣaN8Fcqxc"1IL)>;S%,ˌ*!{ ==-Va} "cÉq8. kp?x,^s~4~BB‚ƒ""bb@G&l ~\B%r /ee.-'(WĨt\©P]jzEH$ 50b98FI@-ImDA}:  h4=4sB:$X<:aE::: @St=['`~wv)F,0cMny&z&y&{LyLƙaf!f#t;C̫,\,Z,,),,,ˬUllzlll5lhv1v+HKsjw8F8Qb֜G898 B.prq3skrqgq7r0iī;gwom.]v[x TR* \r:)T#4#*l$-\!F(!rHHd@+,/Z +SG+VhDD;IfISx/RRRRRK_|u͓#&/.)II E%Eb⬒RҰ2)'*mc* *+awTI]W#sOɞ ]$+{yw\OQ^_CTsZKTOmim}eUf]X@7U[^Nޘ.}o y#͆C a#.#wryc%6*&MLɦf(3cL7A5"bR+Uk6 6m,jۦ۾ kw/_vu80(̉שl\꼸Oo_)$z@iuŸ:^w]'YHnFnn:?yhzdyz{R:5=3{_߲5@|k`]}P[0w񐤐C͓MȥP0FU+\$Dy?##;t+J,*%j:Z?#-G?.F+J,rXⱩ8ǟKǟ_HpHOJK8ap":4|Rda2:7;E.BʯT4鴜S:O˜=yLwbسAg242ѝ>7iYś}0i|Ny㹦.~`v^U>g~JrGA%K\i}/bpH([QľRҴҍkAˬʕ˯s^O@UWp{SfmD*檴[V]o1rWn={VCQ5>5N}uu-jH>אaz#1q)i9y-[[ڬںMڟ<ڡDISէuʝ5Uw)t~bwuROmJo}ߞ~G/t_<0x6h>7d7rex˙WD{y:J;39VVmոwۼ=>i2tr}*C4tLìl}>|ZKL9ȗ{_5v;O}#~ۏk -cKKk˩?~(t:NEs7D7zB"_`~  HGɿ~J;$O68m <uJs*Y:9: zOb f1(&v<{x X z&DļXT@)(WNUV}U#EYZ1cD4m==9sbVjvc٧9U_ܿ}?o9,H_Z$-y!q4ھ!-, ϠocⰎ8u0Ar4QڊƝ6aYĚv}K{O])xDD]Ţ3wߖ蒜FsSHS,QS~^uaVcfV-^x.CY#=c;w  'mRmO٥':D98:p| `-R[{}|#>ҾTs~yA!C.dPеInpea==xgO&R]=ؙ/g3Ȝ= UK /M^Uq_ɓ :>_#*[淓kdGM^m=|'K]o98IKgw~%k|7Q K4w|ywjcd{AdDyX8-Dcx )B'e!U$њZf]3}9C&c 75:(: G?g#W%w1Oo_֮t$A0O.BPq|(Ya'2es]T=Jʎ*l*T <ȪcVkkhj zC s<MrM-pf F3m|lvc7:;19u.+;w#u[{ݧ7O7 B yaa {""s~=rhBcHұָ b'(@ɉ)UHONz?Ǚ2粢r'__L͛,`$[rYBTH URk2r$ou40: BQH׏Za38.x*:]~ǘ Y+jb-8 wχQ(((V f+eJs2*4U+QBBmK݀d:$]>CejFUV&k p,Kk-9 {2 g!8OǼ| E$+""(=/\\Ҧg1~=m{;45Gft9x# c*FS>3yss ,)[Ce6iu-!u:!`%=>!L>*R=Gzcq g%X:;3G7sy/^:x9r57+o_wax O.aW}o.=g7%͕ڵſB6h;z,fXJ@S`b c JG{%2EQQ0'lI4;n@u:V}9js}d))!0jBLMI}zƉVn/]}' (231?c9Zf=Q©9ɕmC3{._~mVO {h ыwc$Rt2xaNG:_|W#nW#Lc'l``x(I9?reٜͶ˲Ya_\{ݽ<={u{O1F] nHf 1r6,:ؘcǽh;’)'Чpfg:fWVR(z]$r z,ޗ9ZQR6ۡNLw~h#3oBSӆ9sJ_S.t%n,Z^7{1 ]#DCfʅ(f.* U`#8n7jht=zI cEDZ"<P( ~AJ]T*T4|4ʹ.Ktg%31˘0Gptascd\9gKU+"M 1jqݚqRҵ2/dȳ+)+PR!揄Z3u* L/[Yڌ9w9:@+D qP9G/4 !50(#_bK⢎ů'NhO% ٝ=|V2UfrZη  .?,(n[YfY>Pa{RȝckS>oRlmoxx4xd^~/7Gny>>~F$|D:6רop}|rO=+:+Ր5ܵoFEk7؄66oQi!kEH思vZnN_bӳ` pHYs  yIDATxuYc+dv6'g )3ٜ3'в#ƙd͙AgsVJIlhƶP,-aSmݐ%BbQMTIn쭺Wzh_ӂ ^*o{WyaaV io 3OZ?ܸqʬld cx"̇1y! }?x~O<' `&t: L{nX sssbo٪N?3 ڱx CU)XKbO, fE؀['j^wO::#,X?KgBe|ˡBưH|#̖N$%>O'b"\f Xlz (Nc{_?=xb&p :)#+{'6/[=cT0*k"( PŇVQY/AR1^ٞ./Q=^r D]e/kkCcHis:!2zh(7葥;$>|Pcuۆ; 'Q c&&&T<^pZ$TY|\lMn~bkn0͙ؔ !>߶;/8<[ao񱱵AE%.6t A Jg}hT`իW1=ɶ{w 끊 Ӆ G|EYcew4)>0/Z z2bGgǶfYlo8эZIc[-z&w!>~W%LeTTJjQ:&l?Uw2Mh~ke,Q,J$)OL{%V˶sKEbzCSsC/63!P|e2@ΐZ%STl Hrx ~&l) *DT `\҉H©aE+SC"DlUm`7׉4KJ t;lf5t<-jl"Zy!ndm?lφc# =b(V4=j{_ ͌ޮĊjV2\\([KmJ;hrsN6 ~ S=:?x'P,hF:G_ gZQ)5ًͲ-&b,b+EW-^gcj| bEs]8n+-/+ KiHo~M]&=h$/:2C:zEævbMRC|I^*}_Dlأ >fB 6T|w=ubO5QY42DC9-h6V[/5&T[OBt/2L'/믟[NDgt:}1Μ9s7@vڵcǎxAFGGއ7K f'3|7G7ƏG{ c<~q__z7ze8|]RZ'XG?yl>oM>&|xӟ>}ˑOor%w"??2r< AG1[$8m[-ۧ%#K#K#K=N< /'^+[8}zT|ŋ/Y7̛~* h}Ooz*=j'OwIɧEf⪴8tRnN<8@ ?֝xp컿֝xpIi1|񅽯f퟽ʶ07 5j-K˳ Z<w]wЗ[<i7|>_xW^<[ȿ],L\tR6;{;ɉW{O<{/ۚzC0['nN-= es}G07 ,yg%qe<8hL©|X wOM_чe }wx/Avc 'NOso?:uflSޝoC?{‹ɓ{_x(//ޭ{ /}{맞xI}??R8>?Љo{ｱ9}#Fn}륣|w[`tZ[|F [rB;޺鴐NڎnN wwч?i!v`A)N^OyϪhG͑N?߻ ˗  y$%n:νz /_>7m;/wIcE"K F[2K`;3uۿ?؀BhKsi6 '$ 3{?680022%?ya߮tr굗/_󑯾s{?O|^B0܋29z f3RGƱ4e 6 ~y7s'C;#2Ckkޟȵ/\;ij\c uu(x9DPlY,/c|)/?wG3O7su1L/yK8NNNxOo0 0LϘh-AeqqaG+9X?pVdnn{afɈE'Ѽ%H1 0L WdNOcYbaz y3d Nb`PafA{LMMQ%4:2e PKea,!ݴhXa^H v2Y-Q&,˓(.jJd1_-R/L$JVѮsuW@rRYz{a)-jC!Vn7*.T(>WT dVTN\ϴ z-K6ťE*oDJxvjkyk]r+CxdRǼX[MVJDxԫ(dNolȽ?Ӌꁻ~%tӫqVOgX[Ψ3>WBۥ׹dVHGUUL7ǖpKˆޫv{edKwh>S<=?ZT֖l.%I3WoYFW4Sp[Of%]yA]yY+h^Uϼp Ρ\}j{L ;]vՃlXd~_8|4$ =|wV~x_hƆr܉bO1ش5ZZ|*@Q I55A˗*iQ +P<>ϣ9,x?POx>w3/Mǒm\R&`@8ST ;)uyc=lT[6Nͷc亪'P]zZȌے3ԛ׍\c\2;'~'޸C=WH1'7EdvQ;F/dܪ}9s3ŹgBcW ٣ϻÃO|I*}w98iDed+V]P<&@6lW%N qHwKc;p? ;Tj4"Y| oWbXRE 47Z *b>ԮW`6N%Slv]P\6p+t]qKGJh&ۖ,V>L%""NRd<Ӫʒuơn Q^z,^Z≈=F%"z7X$6WR,6*O/|^coUr^k2KJЂuYqJ#YRa.KO r.KPO&wv Y -7fٽ1sauݵTʴJatt# \4vѓz#Yo4Ov;-h`tXaWRMj̀.UJ6 tzy?JymVևC Z> B85N<{=t*Kcp-B(pOz //KM+-Wmˆ=3DN<8׿.22t+~2+ Kb`tSZgDrβttQ%CxŘɥbL~?v u+m'zwYN>TVŇYJ  S8J@+Δ ӃEAo4! +rYjQ~ %~oZK-e~u]+-tģ"_v;|,bq'"$F# JrW3¸WJ?DԹn0\vGN%K}XKBOcsڍkw h6]Qq&ˏ,XaZ*Ŵ>x ~(״j1Hl0.j)y.(c wttܕctD+Be .wp _)咑ݔ%-p{鼪jk%}*)ih.i.&۾ NjtuUsP`Z\ fXK܀D~ K1^MF+ͼI%\󑆛4}ps;|m ܬD6Kupl()Hc%Î:e ,ګWYZapmcV䃝xN:GU9KSyocRY8A4:ߤ0 'w ²D+hx.K|d Bc=ՐҬm84I>i?g$ /RٕW龴ʿ9>Sk1vQd@4M=]ASkiݫˉmO Y(ZsِtA(^U|ۀ1jΌNk.6di]shWHu(K4:+*^롳|Z+q;YnsgģMiuvw\[n|d$HS_$O} L-w (+WfUX"'B3V,tazO}!OUͯjzpz9ìY"+!9Z1]1*%3YILN<GV,8E8ì2kz,CNYba֙,Dߡ+80 ar0w5I8Zԃme6Pv]-ޜ!:梞Dp|jqizYCoȬ!Y5 ,>Ňc@#_*bB_]TX9̝,]ww*KPv]&{CCt" LYeσ$>WlYYCoȬ)k⦣9dv⡧9;T K2 `? #U8;wzTZ1,Z/ {(ēẲ>Cw Cp %YCoȬ)YWÅxK1z\e@eIE8;8wϱ zש@M)ypi9;/hzh-KNa 9!vd ;Dg< bq_a[RGNkQ~ e]%{7,9?-tģσss%[׃rxCfM')YVw3Yj!fm_EgYeɖ"Mz^hfypy9;|dݒ ԃrxCfmuQG= vC Vժ|"ܵgFOV~ QyYz{_xC7y%מ (fZYjx`L451 tUp,YD8w l!FZZ0BXc,ĄN<غqICTa%@}hVsޒ@{,K 0LdVr8D}|,K 0LOe !Δ%T-j눳,1 0%Kmqy@5XaZKHftcK 02--D+ .3331Ya^[#,+SMeYbaz'KbO%vy`az*Kc⦛KRd@ؘ)N,K 0Ld $ñ$|y0 DcFd3Y\h<}%a}wjgwya^3&0 SYb-!d00 SYB["q.%awwgGAhi-E,1 0%L ȴTB,fYbaz'Kw nhЉ&0,1 0% NtZZ$Z˲0 No  5ƝXaZKu=PPXaɒihكXQhڎeI\DW;W}aBNZg3GZj9zA'f&+KCWWPYtL4d僡tszPf['2dY.ZFv uJ̿aV\lf'8A` -UK ]<'phZ| BEv)%C'tW#S3Ʊg^kg㋵KC^>;9.-e)V`(~Pb;<;v({U4Q:ٱHY=+Z͟8гGO5c'"{S W <{MtGܑؕfw1?aVZp}MfggQ,x8-6ī"*>j·Ɏ5!1z$]Gܼߘ;uҿ%_x>ed}jggBch$]JMKg9Zy`8x"y!a._8#`zH`p!suՉ./wP4; YeV *'ߡx2K ì,4xAq"-[jslI͆_s< Z@f©fٽ1s*[#Ys^IsO <¦6dV=4lMhs, EKWvvl]%Va%1[ hR&iN55v){!K } ݧNNi7! +x9~rˣթs`쎜Z,λ8rY1aHeZxOx?XW{j&>g/1 Dnb7_[T~E5{Yau9o(2?^Rv.Zwy~ Ewm(KwQRevľFY\0P9;4|8uTL{˔%e@Rfʏ4?XZ惥.CS5CJW_$ǿaV\0 M[B5(M-SabmhCve R247R;.3UXH]  ԝնR32w8|!JJ ìY Zs9|uoJ&(`7:/1Sr0 VE -;UbQbfUȒgGnwf@Nsi; V*]i*ɽW͘VJegU[M-WXY-$XFEe1daa:%Dj-Ȍ 0LeI[WU]YaiTe (w1 0=%츣:,ҭ(KYj' V@B;k TSm|۫t?w+nNOsCDa)hH0X&B"8 0]%'$Y^;[܋6e0Z)Q<oG.Š?_u⋧Éh,]Zl>K.|.w(#J5'0̒eɌ;#Yr  oWbX2-/(8|mKjsKYj>#K82BSߢ9ɩ9R5WT5R[y>hupBxGS$3٪)(KrZ 2 YBC.:fB< (6dDNk!DGNT<Ӑ%c(}V4 f1m%[%|RA݂H!OԯK+=v[ ڐ33e&T C[YE+sk'e !gظE0zLkIVNQ9 0K%qʐeVJB]O<0FSdhiM]R7yU- gJy bZ< ^#J7yM3qyUik&L1`h}']->O%,K2rp \22xu>ؒ1~ђZ{fdIZ՜>n<=1 ty<d x$NŇ4q<ݖ,9Οw*^ Q:k4z)Fҭ[OSh= Lpgoο7N$G{6ؚchcyzatrSEsKogmIk-z6idVNhڴVW!uS tCʯqIFjwdFA9N/|kŠemt|ts=kIY,QG97.ԯ+@6ef hR ƖPXaIG2d.ՊAhq%a)-AT% qy"1%awDsLeƳ <%awDV ,bW0 SY"+gvvvL%aDNJVÛjAaYR<`? ⎞,K 0LeILAD$*S߯yձ1ʒx>w2!˽pvRD8 pVL(f0M[ ;&{,s /WFy%+m\їTSG @\U !xa%LRUuOFLMoVz ܪZSTDDzkqKGJh&ۖ,&I>L%"~hUt*J&噅ka8x"b+.8+ADݡL ?eaS+j1OD.I埯Pil>Iyը TtO{\T~5A+ͼIӕ3 ì,њC`# w;.>dSz o`X#K~--4 Bk95;ī|ɩ@ӕrܮ"j ?[\^jc 8^V~I>9S//B/=oru NkJ6Ń֘eذ3 ìFꎃ,a*LXKjcYQhN~ TcligIzϕ:\o1j'e>M B^!ʫm} 'Ӑ%=O xa%ahM$bl ە;vid\.=o 3zm3 ì,Ѩ[BqmRW2ax\a]|GG6 ì,9DF{*#:] Ѫ 0++K$sq(/#YbaNe,$EXaBbZ 2v1 0LGZC3Z"Mbka,-4\B_Z0ݢg9l 0kFDa!dQUFv8l 0kAЏN? +nog]\\cؽ NPK{OT).Ⰱ ì YqQ_=:-fӚ[#(r+>Xfw.{(hq`<6[7 C8[K2 6dQ"2ǖpV N<񚐆6$1aX.odbDbQaYmDFU NnԛNkI@7wjK$:Iؽ N0;\-8l 0kZ¾: ŇBYM~ɋ=8|.n[t]{K?Hm0 pqQ{vnuUp<0L7deM<)0pZN'ŅjO^;}ה>e6^?W}ʍokG0 =k m&TiqaNdHh9l^n_Jo{ݿ'Qs_L*]_V?ta94w =5`[0 0%\(dg[U`Yba.K} ~ZYaYḴ%wBSI40 ZhV'3 Nsi׮,0KJ~.aM]2%%5;fvJ{Zw:,og>x8$<64ڠ6\%p4Sp] ZZ1eI4h­4ITUXPvOyGaX<ǒdIt~I 0ݐ%q;ZAI%GeZv@i=IxN9ἷ*D6KEqZ|V8_9!-,MNN8y[VyhoYVoVa[si=Iz5xQVKp|+O?a.j K˃L]kZjFo0}V: 'KWa!6Q623tk؃ 0ģJ>Nqsڨ|&WK/Op|ynWWb4"K%\#Ɲ ~=G>K(TEa,im:8ٺ~d)-F\aMbeޒﰮ:a'K^)n<ø8ea,vYj%)N<0 TЛA7eO,K 0LOe =&LMMY剸a,Q/CtZ1 <0 0%BKZWgYbaz*KI eYbaz'K[YV0 NЭ umAYaBSSSLZQ%vy`az-K8}Qz.Xa.@>w贤Tb<@%awuDf%C; ǝa, j6;;kʒ8Yaɒ@li)qcaz*KSSS4f'<:,K 0LO%IyKh-a?[baGPfwK<Z}df`-nUUU̵Bs',]'޵6m=R"M퇦jZͅ4s\/~5 ө$[uNd Zwf rЎ ͮ8"u5i9Bdmɲ3sXPOnk0bT&~Nҩwm{ز<||$׵0%.K|!VbM#YGN}K%lm4k!9}Cig;*? ]8JO-07,LMMQ/)K Oػǵ%KZ~Ă V/m&Ј7iP7KOFvgcϼpkb;0Vm}7wEw{s$_]y[Rĭjl՝C;>8ó#9{\fO Jٱǿ4d ^ńü4607,Q%ǫY"qk'j.r[/|xQ|GҥJ~t]©C}\x.3)#S;7l?hυ?C#RhXB?bϻAɋFRp" 1صt);r=0yzz\OO{ UNCdXYe l!gDEMmzp+tN]QK.3T 3Zޘ9̭pB}Q'ӍdNhgvd.l.%J^AJ ^&;0=^OxN\!(t[anRY0@[~d)''ZM~4e?]usQ:UH?.6˒7MyY KjM7ن,g:T9r Vm ]He &UU-aaƽ>6]Z] ܨQ:HfV0»Ҵnl?UiUW~{y&K  kzY6 ,{+iǝx ܴI.`NQ%$k'ӚqWڐڄ>tS''rG}ǐqcJu<{[J?DԹnrvGN-Fd,fJ?= eoWg0W:0:ZZveEp5zϳ% Lq%wh?hz¯(h/fQ}(LL{ .Kڹh}.q6ɒg,uzʒCC|pS=;.k-Tkm/㧖aVێB[Mo>',Y98Z h7ޮLZ\XƐT8FWjbnFVVoWglv%Pq%anbYBoz wkG]ɄE:@Bc} -;UbQbei.KQPZteI *ރ+Fijš0 @+Q@Pdaa:%9Ň([jM_r%kSV,ykj*=H|󸍃 ?+\cTVuO<0H:L^LD,[W㆖3lQ-<@zī'\*`UxŊ9=[4_y&<#;/3Іw*X:_̧= -DE+T"M'RT*LB֏aYe M#ZB/=Zb)a:异,U1Xc\ޙFzyo?HEZG$+ާW8rȒ,y1c)Vd *مDEK:j֏a3Y>֪I/h.W1 ,Z5"E버sP+=Y0 VUU9\ZW9yg=t'CB7,qX?aNe @ẕ%+oE80"d|Δ% XK:][a$֏asYHPy1 0̢e '-iogri}bUSS|HУ/rƷI6:Whԃ׍nWnRh;0uC>wY"^T}bP1tJb9#,YldN=tU:%aHp> lAf#β0 N"Z-K\afrCY\ЌbYbYfg>Į+V 2Cɗ"K>vOaEs/e_=GZǿ\ϿlnYr%rBiPr(?\"dI <3 E>%a WJ[>^W˾M_{2%rBig7[(~h֒L6q%a1??//_/g_▩_V܅@P~ 'ґ,zyK@0Lً+{?ppupQpp-pEn;_?BN z&9DŰf+-1  :+_zV@w"lZ9>x쀚N,K 0E Y8'{fӯboނ.Xaïק?XǗ9O> vh x䆇ylaru?W(}c ZK4vjjirrZb馩y?XK3g bgΞ+=4Zh䈦e 80 ӂ_K+_ $ׂp z.n%q-ea+>p~y麵 W=-<@&&&P` >0L>ɻG͢ssp'~vyq4 tg;hJUU%a0Y\{o.}pW_xvAY"op"-QoM}aY'_=xMupppH$2k~4qֲ&6[,^caܛO|?-d Dd >qzEHPhpg3 HdXS}s^5͢E7<3%DLN!|Kzr|ۤ`0x+ÿ5ρ^_2w}]\C ~{Ųw>B]ےO~Ofg>]ھEίdi eqxӮ+Y-]f\!8_$~FQ_zj|RWگ}3_/'ͥlP~Oۇi?zJwwl܂?k6W7O|~}ϾoŇ?Aw3_?]F[Ŀ?+JoܸRK`!@k$i$ۊbҿM0Fʹ0"+C ,0B+t 5^k=տ?:9AMCG'#;pw ơ7yoj.+&B9} z1 ž[Q 7Ǵ㭖V93"RU~J; VU䖾U)4)=ߕ+y`cD$G' 0{n~cT>.*yS_Zb,K`߉nz?7RD,K qϔjo^Sop#|4Ś!,-![;K,t5Jf힆;A )iF)7:>-yTkϏח`hFxWcgTrpǦnڦ ^RNo:٨h Ʃ͡)~WamZOJCIIѫyLmѵk8IcXţ%Ps3 )a ~;r~mX\]g5Q8f0jp,ƆQ12`xG4[ f,yXΨQ݃ѳ罾I[z+pb컗B`&=+CԼ1 [ k 5v8,،&IF cFFnVkz~XuZ ,Z!W4mznqXe^_ԆDxB1I" ddfTπ֣ 3r~4B'P&X5]<a(Y +?V$}׷IRaRܝyL @Z=sc a%K >dRp|{$L䀄Q'MŒ*&F?ie`)J(E Z@)@W A%p`F3.w~+hvK9FߍR\))n3HWtL~a285@\(dX:4,9y;-`ɷOo}XB(0Z[O'Ezճl۶̞;EA+WԼIK`!<=4TPf%T9R#!>L2RV+/)=Yjj?] iX/z޳QQՖFtj'7M9 Wj> 1[H`[6# Xk:kWɁ̈́i7t%jCyVڦ{*P}oM7UϨ$7H9%_9m ;fo~w(-xi qn~@VQ r]R1g-DZCg<9aI ꝋ~"hHxC׵&ebg` :U5t=~yG(WKAZ}K!Q9?OV$I+>?H4][dKwTs7yn?̈́%aI$Ic76y;Sw^ 8X&0T«X<.aI$IH|䁟)ַ C- ,%^'aI$I=ܛwf;Y8];x Apl}? $+%,I$IV9r~KBtX !$,I$I҂W_Ol}8I) pda4]’$I$-d?huG2x\)WNE~+m2`V’$I$->-~qYDi&1G=h!aI$IN766~V_|bW7^LKpxApqZ"L’$I$-8x K[__ľ\/!5F:"hcci*@(%I$I/_ʡw^sʽw^➫_=O=[ߩG`0Z= %$ﰸ!r&VSO&$I$fK`˟W-Fxyј. KTѤK$I$Ѝ߼⏯߻8a0fF,axDG< ` EdJ’$I$I"E$N.aI$I$m+,B"I< Gd-I$IKNj4`W=HX$I$I K> ?rT+?*$I$IׯSa$$I$ID"%C Tf~/cS=zkQqƍ Fg%ir^_v =lďQut-qDxqfqtuދNA$Ew=ৗ SK|[ ^"M#KX30~Z|S/=MUw$ѽg ORҌ +-R 2/|ED+BX|s%I!w9BiuH_wdr~H@% O!}4U&@I(gQdS' /Kax %NHdh蕽+ɠtpk˕!ԚQD8SHVp'" KM0wVi NHnl|+0B˒~w쐛0hTT1E_^LC"?ȉgtׁDE"w g  qThO*A]q)H'PdQE͏P>.wM3"܅n z~*O@F~s-_.#W3SR2V\3I.#n Vo2@LNyaĻr{7 314!d8D E_Mβ\G$Y.2C#GQp@SX4$Rw_^#gLXeҳ1%N)C }R3~>*-op `&L+O{Qh߁Iȉ,a*i#qcCNi!q H Da'|dQ˟. /-Ur%SʚȽ+~S$! Ɋ!<9D rCv 1:B/)r.4!!E.xcC4apm$줋{h/B@YAx|P|^'C ,'W>"3=7hCi9 2t$so p8|p߂0HăK6A!EqbK$I$I-BzIENDB`flycheck-35.0/doc/images/flycheck-menu.png000066400000000000000000004210431500215546300205100ustar00rootroot00000000000000PNG  IHDROiCCPICC ProfileX YgT.9g$,"9De\ """AE$ A$ HRAQ I^ {7Lϳ5OULGDFGSL = 83`<H};;+?!:lOb}| ' E#ix bv*$ c(㭇:"hxb) PڤP_FAQMXh ![R ^a܊C",ipo!n ƽ1f| a,'})FDŽ8*DAPoBpm hM 3E;B9C HtrDc\l f#*đƁfg0!А&_ס88A?Մ#¢ ZCY7F:A932&02ڀf!O1PS|eQލ:0n`mBΘvVaOoAPL P? [gzO8lA¡Nq~ WJ뽱#B;x0,/v Vk[=x*c5Z 37&x?Y“ A侮 ?pp7'13&֭tGP +*~0b`VV`u ˉrXU>VGc??z4QQ7 ?^OOZI\ta`c0u@ӂ`no& {7@(V)N+W h]pÈxjP@`>܅}7 ++*@i:|sX߫ξdP47G|O##|baiL@HA:zX[v@YǁD,p䃓 (2@<x >Y0! d AqDQF4-1b8 #1H"B!'sH%ri@ F"K(%**>j:t'GB֢wt aÉa41[C$a21L5#fcٰX9>ͰXNl$[>¾b8~,n prM\'|vx<'^Mw|0~7ߊAC%Pф4 %B a@"*Mpb xL$N6eӕ5ѽ[gסwG_H_MI-{ dB+ ^3,XI2$C')ttJzFF&%zdr4N%`dcg4geXX8IIi;SSu>f:f fCf sss0 -K!,YX Ƭl6Q6C6lelloY{g9X9T9\8vqqpJpsrfs^\Z~½#c“S+k{wOχ/?/N@PT R@ ``` <¡…³""f"1"DzE7HnpސfKQzQMQ<6Y1!1kD*q:qM@] %$$%%$$_HtvJH=KkJHAededdQYu Sq6o,8,Gӗ{-)o%"_'IALC!GK᧢bbs%V% F2>EʏU*&*{UUʪV}ƦfvPMmU]C^>!Q1ɮiyHN@kV&Mћm-}Q{jfeu6Ptm1]]n=Q=_rI}i`K  7  71l5e;45``Re2kf۴ gfic6l.`c^i>kaǢÒdhy򍕌ժε~a#nnSg lmsm_Ie/㼓Ssg)6&OJW#ccn n{{<\<=oS3sh]o׽p^^V(ʜwqzy~:~&uOL l|&x!6BZkhM1+!5<$#B0bW@ldZM;wR-QHԶhv#s uآq.qw /?`p~7vD}9$y'ݛmir>}!(Kuc@jrUiiԴϤcӃ{3T2NdR*Z9skGfg>?~t(G7˱cֹyyyw/P-8sxBb'X9xIAQM1qF)SNW8ufl٧LՖHKcKߕu<_Y[Uz!XCEGFeEUhUL%K.WUɺ\y5km5WQ|ff-R_;[X7V^?`֨x M"ME9ng776$̵F 3޶y[N{wMwwӹtnj{zn>T{xWO_q`@GF>6͓!硧ÞcO}N= }e$vdy ܋̗/ FGK^ISu7}?LDMM}G~W0)4Y9<4m2~"?,Ϥ}dXIӍz{ff~~YzϷ U͍·//dQص4BX)\^miZZ$JYo _9׺DF.<:^"7 )|iEՏ}S+ϕLfT,b%Hi핒TJ43j7L⥛wU!Hi٨b)fejlm{GN'g[0n<^o\ضxSx|}vP6 !c-agGFԤ G>G4VJMpmG#I}V>~,Kњٓ5t#˙?6;T=QIŅOyp񹑒 2=.]V=P*57nkzV5͕-e'vw:UZ7v;zk  Ƀ=6xLo?חڋɗ9ڣi}x}8ffybm޻Z&&'L+LO>23g7gf}Isy&:W_c1SثdA(G'I/ɰHhÜrmSswA@EpP9 E$$դ̥des7^둟R*(oVPVR/h|fx-JzW >M͍̔--}­w$;`t9%5-h6q;Pڼ}:}op T "4VgGDRwzR\Me [ gG^7SO;-QU%s_Cw=wt!gطټ38|R(T3gߞ{Ut /TmT|Y pZ)_[WT?؈ڴ;ێLu^G8>]dpgG<ahëcn߼o8v;I>~ 9r6 kqsA L xq:>D~<&+%ӄ@:En382#<3VJ\=\:<<+S|ՂBE"yEb)ƒ’?zDɚmC)6*]T.TIVRRǫikih=tJw^gtKn^!0fR~|ɧaǧ #"_*b|75=mh:0t9 ir=vdz 9, œi 3M+3] f@3uF`~`'2"ja7.aD1֘LfKn†aKp8K>F,G O"PbΕnޚ C K&ONM0a;'XYXMXoiղobopspKpL)!tW8_w(^ulPIK)Yi[O%{*h)+*=Tf.QktӠvN-]z#SF9ќ΂dn%bjccng։{Ǥ'6.;(?|4.] iBmVu5a={RRؘyG/ Oj[q6lʳǮi[lPɽRag/N:fGϗZ kKˏWn\X?+֠ '-$P@"bÊ@ A$jRѓh;Ï$bj0Rvn7nߏO`&wttt3&pWnLJzL"ed`8lʲՐ͑%L89e8pyG+bz)|]Ȇ Q1n%JKH˰7 ,JDE)an;w45k}fܬc%H7ZhfhjejijjKB H >Ӣ;EZ#[$-c S+'4:DQ#cb}wJ*K7 1TIx|hHQg_ +On/?u%ʻ+*W9]6i*u =+oNwvݺ@gt 'OF.}9*flMm$:=ޙOL>Ϟrk7o /=_]opj4\e|deyiOO֐5絋WJx $X~][&9kk%kk0x@kshʴ_P̓d^IHiTXtXML:com.adobe.xmp 678 513 7IDATx} XTGIf{ɛ?y3'dd 1ƘLF➨(DEDAe}}WvdEhYheS֦X޺1_SNսU:u(䊯9pj3K,K/qfglWYb%Xzx#| F;K,GU"*+ŋ+.w@]GG(] ? ʹp,UjffH{{P|o~gbQWOP{ihkE` ݵ"z-[̒$5%5&&V3 iNNNxXK-{^1 YU\*әK'(5Q}jQVjȈHp˴_W};׿޻ﵵ-Aχ>|wQ|Æ P/U.`wy饗PTTQ7=o*S_8XzOm=0*ZYYA_WBڐe D??]P/RKzt @w i_RSSmll`?`ݻwCxoݩ#|[Jfͳ }b ڰm6_3NO-,f,:`#?Ed(..Xo1KKKhhh7a]]͛7~_]]]܊_ }}}}&*|~8:: ͘w^ """"`hS#ȿzjvvv@@믿`o*gg _86O?T  Lӯ-_?-?Sޣ+Caڵ B9aП9 ϰ3A i_XOj" vy 62 0J/ӌ?{^{{;e@uu5' wՕ@P|_rnݺ[KLoOBYDXX8N %BšP̙3rrrQE.clhll|g)Dnkkk jxx~!* ek7pv]σKOFׯ0)oټYgQ@o à OBF1Ԯ^;pRSRx[RRk"F~Uj"~Ag[E49|$ 8Iorch 62jL&\<'֭[淿-8j$hok^A]~G?ѦMPo\U]ݺYܱcGhH3~[o3]o}k׮]j׿[qժU~ӟe IK/='ޮK7 pu >>>/&&$RIQ?5z.1<8tJKKMLLbc O;803wO= @gvVRL7I )fKȑ#慻W7K,-}GС_TUU @B8_!#"8_LI}U?x;^__%C >`ƍQxnn.̀zT<$''CL| FGG tB @^z*(QoIaIvh|c*wXA ƞPֵn"Ckk+&0<=o '̢y!!!0azW׬Y!0]xtt40-,,^y啛7ofeeeff Y֦K` =ť{ TN 3t݊`@ݻx(Tj+?S0=={,ܫu9ux.^oCB3D.CCБ%B|_F0HA)P0;A%h`ii ߿駟NJJ kuA| wo06a }}}j/~ ԃ ˗uv&3^ʻtx*Sul8ɿ!48eW-B_ A8 |Hj7@L2Tz| 5a}kaOA엏`>|&Rt87KkqscCJM"#M ?A<)1 nDn;Ĉn:jա fo-~0g2U`.mOS{{;]WPCq൫ѢtiI[0mP)ee2]Su ~;b 3B5y.1@ pX춀\H9uO?L~=.跿;wR@ -[tdBijA~Wwlp> )f̴^{x(8(:p_w+!&ȀAm/[g1g#A~]?y{ C09sO}Q !LOA#1Gym[ރaݠ4cBqȏ&09VJ ps&%H-䒅iV D!_ 628hH]M!R … s[ 1gwJ @|oJ1gJMV.mfff0 Sm~{߃EJqBq}/9CXVwvvf5kP]F"m^޺Q<:*!-C6!Jt]btnذ/E4} [H^nΗU 9ud6)iissr )T*Wbݫ%K0, DOX~mp̌L O>A2!\GaI0̡VVV0% pem'ʅSO=|wA iķY-cpȏ8/̝'%)!Z|YQ 8_*R/`#ʫjL6y//mڴ SS ⥥O>s<-w2k{& Pd1D^ 1Vip(yoCl~[S\ttŁ`r]Fಃm%A]VB7?B`@ ˵^btB.hFs0Hzz:J%;0UʒIrpp@7mVf`}КhmX˼Xbi_Zm[> ϟG?=$W$/3PܬV^kxQa!z l:ď^D_{Տ>o سK_///|mzr+"aK v>^4 0~#׬1H#9֒F9) A!PxMpIiin_y5Z/CDH{?FO${WZ㩩8r0wH94ouAFJիM4xw}%H*_="cǨttQ'O]L0{~֚ ѥO~.1"=] ~}=? A3d )ciiIŒj蹑F7ѣmlhlLU\`,(hoۻ‚+˃ @*Ȁ$W/28[{t@~[oˋ8|pV~_dgg_xIK(˫xCCڲ666/x{{X]]χVUUeccc R0^%ő{* q;;~z嗁 e8d6N`` 0Ϝ9 WaϞ=аnVm0?{'Pq>>>'NhZF7 oDߊk׮ lJC@ܮKW^}ǠAy}}}LL̦MP*@sP<4x_ZZ lQg۶mp j]] xO?s=OKK+((|kmLMMoݺJ׿_ L ANHHUʒw:/-,,555PS`l`b@ }6o~C t5k  d@Ҡ6˗l7xñ`( ]]!^a=@Y`N)a륗^B+!`hos$#~oYYY7ߙ6HA8G1nI&Y($C /(w3e%TtT Qk7xll,$eeeA͛&&&A??'|"H%x jU@Z#,*^xp}h e5 A`fSRRB aYܮKpQ]?o|,߹s'J 8 S\\r ?9X~ OS!f:„ *u)PH2yoA ɇR9 g}>Ty0]z 6,-TAz7x#_~z~[RbƄŠ+~H>zCEf@0^/AJ>) $*#`RYY btV6Fjz鮙@j&X蟺b Pdd#S6F B7\p ">-4##dD///G˴J6WZI`XHټ"^Su+BFےt!PuuPp藕__`!BU_3~ I]G|\YAS5KYrh#Tq}_q K0?D RWegu * L/Yk[~v '[^gU o1‰wL- <7|󞗂Fޓx+ zX-־7ذM@<0C0/W7N(sWe]߷ ]V^:c;xקW8}5G,7K,y6QUeժUMMM+0;v&d%+. LM6PU ȿ/gVLA+T`ѯ@SI lrCP6 }mǦGk vO??rJEǎ2x2Iv9C R06B -'tb =zI''SN9;;ƃ "'Nr%u9}Ǯ;m]6=Gm^k_^Vg>p7G,Ö<|~գ^$8/%DZ݇}žgw:)pɂ%;{5):>*ǃ$ Rj$TKզG&'$'јr)Y,M>N5H+S*)~Z'Z8|r?wr%Fxt'Ο? >Co}paI=f"3+aPOxk{=Xw`;kmv8 ']e[xb{cǡ]/Nxei.lۻ %y\244[룵VZI ra7[rzڒcIIїr3Qq8_hۼamy{_4)|wCtagm/uqe>=k<2ABAxP|p#'UJR *(Tqnڣ^J|:ۇGuC2 t8@t2G}h%@<'$$$! $EFF>`kc|9{ˏ$[}fߨV6;A||.T8M|/œO?X?%A/_NRsh呠(ur+߸ϏG;nڌo]i+IC.yS^Gm:H PMd9n; x|m7~nT~ץg#gӾw 1D=ͬZ89QW\8G`uښs˧:j'"4'= Q? `>u1#?v'4}_q;w4؅ExoSn_?q+\ t3l}- =~8$EFHiC6) ߔd2(&\*rBT25;GO:idF('+ES/KFfEe]̾vN9;X.OKKzk2222񐍇<@8`MM}jӻ z52W$kׅ4p1?:K\d|-T2r_Fg^5滜}c"<ض) 3~^יo%ʯNg/^HJmfOom{{j8<~ķ8~&<_޺miשKYLaCzbH rP;`;nh֨Wz0%7p !|kj~x9I[8[,0fk;J.tڍȵ為GT'k$ C-}:53ZWv>uٖ/ ڲmuP8”ѧ۶/<;0{vO$0(e 7Q>xtFRw9\3{s\,] Fۮ-ne9[fAa~=[.CR&m{t8}hd2AlyN 74ӛ]͎;naJ38gW=8gNEd\gBL7]CiI*~x"Wq̪W/q/^F!LRئk0 CB )NH) pN*F ѰZK%, EJPA5{&zK<ܢ&.td  JYYZ|E5nizeY:t%PY@x/2aݸCeee,#.[YYYUUv)p z31vyM:'SYa2#7?*=&O]rBD s~x]|}gX|bAms/.KqxT!!xcpMTi^T.{A둞]6X!+cs)Wuh WeףÆn0ۡ$lM yέ΅h_IU 簊"Įk\$d[U/_ṕxc]Ac=!`NbiIIsu88u(7&<ח{*p*VR847;;7ǤY4ꁌ c6YgL]Ť*5#=б6`cV=A<H?+U dB= 7qF8qC+EZ D:ۇP2X5e%օicӧEĭR_W[_ǯ] :NdG+el罗=rxuuu|>}ڑJ)4*p Z㓤Z'o!o/B/Ͼ]Ō\6_M׮E,QRKy7C^Mӣ~Jhm{I0V)5J,'fyx1pUǂYIIUǝ=lh#NEW's&vj>ils2Z_j2/ms0,G*u 8-ea$?ħwq%˕v*3, b6pK_r}% rwpx]*%h(k' A@[7(h k8x z8o#LIA`gX%M{Z#CIֆmpɑf TҲf'^'xܴjܨzOMWP&ꅇYpi@PZ0BKꖜ 3FKC1t%Pm2 ѭ2׌H wn mmm胄x@_E_q|4Z%SugA⑽v7Q؀8Kx>߽5莲{9s^qBkt ֦ҙ7~5z:?7& 7o[pu}qu^'n^+Hkoj!m7#>RߠS<>o!h{"(`.؞'5 ?-cn=`&D\& ~:E_@wqmf1,ܢ^iN*+~j^_'-)n$4f SdTy@ ܸ?"e]Q^k ~_[[EBW3z:,z8rԖ2XrvG5Poͳ~otqZ+`Z/((f m^HHOIfёÇ|Mggw],2ڡ+AUz۫P_3sjU@O#m<@8򠭭N;nq6D't@Q1{eB^_{'rg%rQ樠ߒL[_H >%|L Z8@9j>9"d*( J0O@dWpat_jYdgJUP/>C8 ͞x!bGDjn+^u =UDSUsR='J>9_%4P/>AUuԪ{kDUtD۽|cԍeБzvPo`O@w-P_vsCU,@9L Ȃ WegLM&[?UaF> #UtSiܹD Hf󹬉9 5G޺kGMLMykwTsU7bj&ՍH)fIۇTh$}#G0ȇvxRal^zA:t%PgAm=QWa```we0'x *e{]edSs7DAuf0Z a|n-QQuGku_S ^!mN&rKׂq0X_]S/ЭNcс;C0Buni.d"  Fʋ?3c~X?7Sk ds'c͎Ur@y2\~G"$hj}>Br@l 8f|20''2Cqsؒi&_RdS0kq*t Q؜cLktڇ(lݺgNrȟ.t"JСCC} :ݗ5G$QH?>>>111  Hi nwx-~QadXa=4`B~JRSC܌Z#h_43.kñU|&5 t |":1q8O4J[;'&k8jc|T@KѦ#a~iܩsrdaUf!&@辅.t"J8c= t4n}ɝ}xyAȭP0VpKs%|H&[19 Fܮ训%!ao;!7m2sv Acyyع\ y/mi=b0J%t NB>ssJc2]:tDЕC!yt7>vuAOMM!'6E|FKH NYb3;ݽI9F"4q9: %!Yf%W/t~|Z)1a"F;U/QA*/sXc #y睨+ 1t(#ݗ'VۋVhJK NR ])K,q楽+fzHApPo}me Fbj|) $GӉ).^(| ħ-mzWMuE _Z-h +y7wP  0EgÉrawOGSzD֗8qbhhp)ȯŸ#CwCK쓣+pG=㉗U+|8e! 򛑗?]˫ȚWV㐿/ƜFROW[J$;Pbm%4+lVS|` <q'@-&g ɥ֗|||2qH/yйB#cX8\I.33Cp SԳeC"I:)LKfw%*R26>>&*ԲK%XvΜ*$dB>tY>t%P,?ϋ8dDWW^X1Zi,:];VJS3kEWH:e LJnUʲ/$2 fAWXZ]:ZۇDA>t1B#e8D컻Lm#]9Y<58 :s` hPA`Ojn O &&&,< WXZ]:t8A>}G 򧋼#8y=-j.rvG2]Cb=Ԃ6!}b\Xen3]݁; pyq]b?1='ʀ_]^v+w^q%ZdIۣd9dI½qb}y1?3H/H eL^+j*`*c`W=[o{U=Ӫx Le5m̊V,S{Ѓ|VE ,A>t8q>} ˺\"6tOj,){ De>Ar77@=Y;PM1+-/,J$+*VL0_W -MS*nN)BAGDwe鼞^ "" t+N0H4WDD"R }|!no'JZգ˞RLkz._\a'.7˄2]wF4Ybxȇ.CA>t%MȟjwrvRY 抚 *{GlY781w "xTpg7+LqL0.uH9@TrK#0ttb.!hڃC&wIrMՏ]SLG!;Rue)̪; nSuPh66&ܬ+7tA," ~G鱐.MEx > xY ѓB I .bք(. ˝GK}ꨬnΧ#h,kwZ#|B-A>6nh*" ģήSiga!%}XԽNuzǏCXP8!TJv7 BP]r;BEuK|= cZ\  㤉Ƅ|v!ߵH}Q 퓣ZbIf$'6ktEB>;=ʲTYbxȇ.t",?Z&9EpjH_V˓ :x)BT=3v6+:Z/ߤxس*'C҇:<]+ FPC=եQ?/@}ۇ;$=X<]*w?sŞN EX}E{]֋QpK^NWT^~{iU>Na, ,_,qdn_TrQ/mhX1'n q'܊G#TRQԠ˙tӵ;\ Hm-_kn|^/&T+=vj/dO%xڧTh7is^/^w'FW , ,/NG?wKư=X_oƶ1LuL chԞnpa)WszM{~$ OK1Fm7:%L=TGK,䳐h!Sw$m)ceؿw%XG}Yg!_}Xay|t9[Y/%X/|Xb!N'fco YgGɯY/(S^ ԕ4 1ک>? ,ң $-:X kQ Ns+HGkm>Gs;Yg!pƿ>T0yg3rh?+*eW譣1"DS}€FK)|-kd $6Z%vF_ _9סEHW@*D5x~1`dB+Mh 賐B>K,{&sb3?wOܙ TӸ,#cWq4N|v9+miķ 8εS57Oo\F9:Pi^0NϜr Wx#Kzh `/I>]JOU:Bb44aQËʪ&4 ,䳐 4O~}Ư&SnNGNٰE$-?DA\) ,YcDg#W%GOM:jgRn?+ ;7!>I}Xy.e- 4֛Fg5ȏUӳL`9)qpD?};wFF2<o4PjD-;|TIJ?ϭ? }7/EOңjB6;ͫ욦9=?xΰxRF@pk֔y֭ZddSq8`V=17 Lrᘔ(āLy #u1a'yJ?*B8+0e4ԗ1{ 7^{T_c!|XȿǐOO^/ 򕳳r!4Qgr },b(•bԮrXT13%ۏp8L90ثUֹY&Mb=3,tR4'A?gjbUK+I/n*oT%-yVh}0|:k /Ex6Oهen35=t vzD>Ȓ8SS;QyF$N0u\@nW^Dh^asYg!%*n!uެ& ,{V{OE'6MTuhpasg}ԍLc3VULNaf1`mwVZ¡" 'kz{[G7e y*L3ޔp${0(z2pgC`j>agdgjQiFOpHl%9aǴC>iγn2Z'))d [ >DlD b=yr7O] g }Yƒ>g!|X_k>g@~½_ؗ9eҬ&Ki03}%mTNOjcKQ\?8$eəzb; 1oDg4G`NA5oSU>XfDXX_@O  @y<1V/_5 SG ^/(ۭ0uqNbx)Yݤj??Z'L㖛h!h Si 1"F 13~,c'RJJ7tB> ,ľp;ZC,(}qf5S4;z^̍uA5fvq'G=\zmenff&81=R$e6aNs8;8? #cf0֎1OEhbUX[˭,_C~$V|+ixnnFFv<[Ju 4QYc?C;nm.ɷ%x0}afM3JWhSFS|/_{'X ؅}Yggg%`ON;maޝff`!=9t0{_Qe IUeͪ%̃p|ۋ7O,lia% #<~,NBJ`xϢh̋4'2Q_*K`0'T0yƛ|>! C j*cJ ,TAzV}|Yb!$BQG`˼_QPa 5=؃-0 L8}qm 3u$b:q-QFz fDLSQ %aMGQ&ggTzMp 1(lgd$5י(p^<]/(뢜Jg(%XT%9mgk#y=YgاvءP"fUqiJ!4D)="F4I%k[Us;>ROx5z&T(K>gS≯vS%u֛fli y %2h&acm-GGdV m3ф|2BJ^A&Ϫ_`PŸ:|s8U_jHb|Yb|ڗ{ág*I-آwM-."ώ/Ln~cDɎQI鐟170R\ތD\;lfxԞF2->R{l6ls|*+`JaB9<-61'Hb|Yb| xk4+gƇ hI(iLdl|I(/AB2>&L*6F/ީ3\䴂I10J=k/?WNtli}Á2JFGy9,䳐K,/Ǟ{hڞv /Nj}E"/ѫ_dyzYg!%Xl5]M2 r5D}}ش _sB_%S?.^-U_-yۿa|5Ǣ{OwiLxi>)~tkHGHXiHS@1T鸏veGR>*o4K~${"j; aEeO3ІZ!:[Er'>s:IPВljI6j,{NA+ZVκh:_ӣ_[}S G`g}9|)NZ޲B"#ʢRa8 ncB~SQvj^QK@) lwtqnIʫ3q `TMzVjEю.|PbPhM_3ӝ@W^>IYmh4qܺO3|SW(ZO5}]vzf0vP /s|sh ,/Z*m-j>$UGv7w/18i b}w.TWi}%I:\|/_b4OтAt~,r<`fhSnx\F /Y)F7\_i\`?g}~bO\1W%Gqk&z>[3WJNtF|-7+h6k~r.g@>)GIہV)2ouP^=Z5:,䳐o MyXTdt('=aK0 qR1vGϴ*bUS3]#҇T.r;Pp%e!MHjؐ\# L\BC(7O$vJEY6xem\۝.E9--FAOiaf걅vg@(ٗmU4vgD$Fmi~_74<lA*:Z=wS1wWga곞%NΒf 6Qʯqap[\#ޙVWOF|ЅrK~%O὜$Γ޵B͕W0i&vS k֗:KB,1ҰS}Xg!|^okQ5 $‹=RZt5%3;E.y-u o|U*BN"OXd b^[XZU-M%Ѫ$v*xEPebnUaiyȔu:Dl4m7⚞+{8SEW;co:vAFz9gDmAbp*9‘\.4oK{ϖw?ȄP[IΡ >oU;SJg sw$R9UUG,P@'E+2|SRg *z;^.Xn ^ifPёi^_^tȗʆizRkOtK,?"?ů=X?M ɕmHw4>]炰b[T5I\Qc5[\*nWBW8p=RQ*3; L CG c|vJ`oTCӔKN2=mw#0功c]^- zO=#霙Tn KvA~dW0n MhU _OSAo} UXdnm>-OMM; 'lv dCys*ԧTߘaxk t9GkMu-!hjU%c_ua<_xbA,B@ r [\Ɵ "Nt %Ʒg"!mO/% ۇX--cQȕ/!vfQ; ȟЀXm?߄-s+UI/dB~/O0s8# :{N>M;Ֆ W[-P ,{ls(~Ğ' J,aSШ$AP4jQMws =JЉ^TEw˔}EWB> ,k-jԡ%Oz5f|}=;'10r0`α2@p|bfx7 *Cv*ovӄ|v. ˏ|pz1^Zt[tM$*A[Kp.^Kgd5uX`FDTS=9̉Y1^3:sNdv1GŴ^3i_6=%xsILF6WgDE_eLhl&m2+d^m{: \gw7_ױ8VkܳB14*t / o&z=ggniuqPKǕ)W)2YZgZ-O"vR]hr͐e%?J޽*l !$}hcHnzlo0T"$kB,z _"ߤxO\s׊szh_?p |?O@/:%5zǾW[qk@>+c(-/7sVݬOlǶx`{XϒXNuZYH25A>@yc|Zxcc@{{:"%C li|XUΙ\|osA\U>:K`E+ws]>|}0z~#y[ u{99dAN:Nbib=pǭd b:\hR}f[-=hAw[۬׋ L<œh/g6쓵8^1<&MXNhڬל Xb!?g S"rQ?gV=;`^ha{-9⏩m\geA@=j>"8It=>ȯ9b|X~!$~7.eXb!>pw֢⺨XCcsN9m*yIg>8#KՁ|mߚ#k⋴SYЖ4 `/ X ˃ tt44A>c\U5#' JًcWe$^S kҕQ/ Խ` ?9J!6aBj_^$u_Q ]@_!j0e%iϾ6=*ŤrOB> ,BeJ' wϚSϗ_ %C>\ Ҏxk8T:Cq%qT@W1n:٣Aha_sZ ś%JCXg!%X!3h%1CP3_|x:sp2@xp68D {O/kg-rWMuE*ܪ1|TIDE*!YZ-h٬WMgRJºdޅ% ,䳐K, SbnxMU3[¿WLn~ ;;x&p9&fw/؄/hj`h[XU(~\&o3ͣ@в3[5\S= !a6)|MɎ4g/&";Ye!|Xb!A>Z+Q@D29.YN͂cXVJ@~L"U,^z狍~ R: A`1b- ,Xx|@PM+\p\8Kg7KW*> +s/o6[KXe!KCf!3^|[] ƿCX[+Md2B ҠcRrXb!De8DTYWp>P:{J|Xb!GEt=YN!Ypot?y-v->)̵wu,MNBgā(JuHpgQO. ŧ8ٿZlVn>zEaξ\}>rB<-]Q6P4%rmK,䳐BĘ.W ݓ#]IFeEE}3<β@S=ԗ\s-䅉v|Yz4jgeKCPH珞 /ɯ KK(Ce~1#IƤ"BOG/W'Yv]vc`3v˹};mݩ>osɾ"67.Cfy1&XA zw|vCr~:Uig+nkK|k#`nNbOO;`?'(&MNlX[-Ow>䄶ՃvVȧR3#o;-_'̅b{6*O C?>}ϲAKTɜJ(.UQGE~@(’iCgQ&a?g- ݙ5;]ѤRU| oO\oO~lo::tNb`"*KPjPRw+I2eP!+䯯 !l:'Cߪ7MG֮ߟYbo*y+h3lN.0JXϱg"4[NySN *ʴ[ Qw8|;uX?6s_%0%OZMP p]#c%'S~hN'ɤG mܗyZqI[0ʭ峖h x_n,'e8F۟hf1gMSyȏPqqKL˻XG "=65; hFf"M:h$A!_^333D֣xh p0b_::ZZ4ɮBZ GX$wtdq,@~RՐ.Xԫ2$?C= HPXcuPn q =vhW4.DxT6A>A"J?44DO =}Ɣ50Co3?&0'|GD:RbF6,r xϟDሁ{E㍅1;^w! m ,$;3GGW?`xz!_`z4| S.ﭕ7`F>xCOFqʑ?YYeE>ɰ_3}#_uM,o; !XcBU 9 fӤFU\܅ݷҸ:BCiդk.%~^AxfM#'GX%O|o 얧TxeGxN<2q#Keu'S(^)\kf-%vOpnV7v_X*mkoGZո2=A>A>tqj_iO&ƕoy/k ;f?' !<ZZ;>#Pھi^{Jҩv-n}?xx:W> 3Ю45NO3z( m{9S0ԧaʋ$e8 S8TJ[9>,}~KAOCX|c;*d8iCugLF Go.` ''Bȯ*fy~k3U!%#p|srůx*ismumiq_ GpBƂͶC xrդ%%Cs:>6qK޸+knX'ZR}CBź%Q ȷEVof |9MܪŒ"xKUevNݰАPRd.Z=̍kr+~^u*LM?SC9w>ךQ7‚cO0,)R? A$\R$NyW=W~Y6#1>qHcG{Nwbpq!,%HRo$69POA8gPZzD2g4Dv h>A>A>o7hڥ.)-_-y_y|\;n?ЉFv\߶pJ Fr Zhk/TÊg.ktJԓǺ։E7D~^]*CP D]}ˇe|#a^9-DxXT6dQD^q #?ԇBE#b{\4Qrq+T0A>A>A>|dkfut`mmWZ'𯫺N0Y2QS򇫁kq3-ϷR"~N_?Ž}}=*t q!/4c %RTT.MH@i;;G>*g4\o|SGi9-4STɏa'''B*Ii|Vf7+@)FK3U^6hoX[hUYkFͺ5ԝR`w?BߒZ uSQ/9sɆf],-TkInB[z*1_LľE~{!XʨX y*2|FYv.o sG$>DU5ZO_Ev~ŏ#7y xk5]gYi^р.ַ|k(fm=zZU@B ĝ٩-iNVFY˗8 ak2*|]"DeIE,2eď+1.8+K]м OȎxaGD|OOOی6`PӉ"ȯȟԧՁV#oRPz`ٯX^xxHrAK&/@~F~}h aaҤvbKQvBЪujҼLJX@ @pT$d#ң œ0旻gg8Q6AtIw._V/D A˒}u;eiՋއa|r."/ã94}mu,{1cwpabؗ`߶˪^3[&mϯ^ 2Hٚl˫kƃ y<6nllI2g|[ۅH?tؖzdm^xFڏ/IUwWm3e'&+Gҳqz;hPjetvִϖb"?UN|V[DatW?c?ik2lZ!tk7֗:jttX}^27MR"AZq٭3ڦAʓm\$A2קZk`O"sK&_m'̬ %s"7>1 wXݯj:_׈O0!hBZ괫*{#$y.o{o(c_ U m_:-:A~D"![9=btX9T8jNFU2R3삅Z Y;:3MRzYDF]B{4]lO鞵״[hO6j}g0fojR;[?nPX{koڱ||^k4AA~0WeߦWM{a!HtaHdVu(_]1' ?GQl09cd-{G/UС`;kW W |\jbXgkiQZ; kX /jFW\fyᙬ ?bU] '=b }}n)³7 ?7-lȏ4BS'O }'G<#㼵?5 ^FUy~ՙ!@~޹xWFl-QQX[]2#?_퍰\ا:A؄Y}꣼ܦp$_o,, 5=ZB'֡iw{|o3FXUy{b3a 9PO^רz8ko =f?ym3ΡpB>vZ8"}o׉|x xґ_1Snδi_x|/ޠ:.g,;w9_kصƲ//z CU]WGq.co6.fMQEF~_%yz'.V%uomʛ2+?z=;FcC_o˳^s^#e$ ?ÉMxMp \þ037Mu ?hS@Dp y)MOt.۹d5tiWY5́C> Z_{>mxfoguc#<>WꃷS`xQq۾58WD#.2P!Ǒ̢ mG 4ڠ\4(0-"c>G ='ȗ骧gҟIlG-vt~P宑[ؽozt??NGLg?)}*9nݼEȜZuJ;=Hkr#Zs >(@{z9^uCt%@Qso svoUe[o9M@P^~CyP@UV` hOˡ o:"m`~Mi ް |{'UaKtpl8"?LC T^v}EuiEgc=\?ol sˡbFk"n::=ZBscjkP5,--z;7"?anCϽWwU-m1]\4:ح[rΘ':rYptz߽8;f^_:WyBpּv4GH(Տ6!sţ},gyxD1x C- 4pz`nC ||lf?y4=Gi'~u_fu\S*>XXYf`eԹ Ck[}{?"L`yT*_>}~#l;<TE'^P<&.`lAN %\Ium\Qܴ1`kpA]8k5w` xm'ۋfTY hW{FfDn7`{lPv|,=9۱MId'–x%w}SaBu|M?7?|Ź^׶ՕTye^ݥlөW18=Oqu︥fZn @oiCյ<k_y7WGmvaD-$Օf^+9epxwgӼD5ojx6MǷ i29$мeG?`y yh|_` $eo!d~9ya V  ɎI> Es z~o Hg۩Qm<Ԍȁ iϤ [MϺjN|}dog}S.3}=z/_k7YFԏ ~!@lzDA\V˳KGsq?j%Lzeo[j檆zԱ~)=<ʑiIמCWW뵺~ @ V7TVF CpTO<)9洃}w/c5:4u&C0QWj!)_g&D~XjZQ^5'Ez"~nmqU] w8b@yaL#`f^"/r[pw'UcfM"|lp9<{R5xAR]IX2^HΨ%#)@~H.RV@Yr~>)6OLr鋤sA>H0ȔLΌnyO$G [S}O(9c _V6c&cts@lڬ8uubW/t48nz"fC {Chi,3A;~rrC&m08[O~ŵ\ΨzAaq3>.1C_uyCSѫM4`0jc5Qu%N˙+g+U\>VJ#k|lZZfd mr6u/VRybYpxaANw#\#Oa^:KWWϨ(\Xh艒IqMH_GL!?ůV4Λɡjj0/w9$y.Aۈ|8de2]h=z+ki`Ҁn$_qK >.j]ӭ5|gܢ!GiFܥe=8zHɸ[jt.LȏOmo\E>eY!097g^l(LfU@ a5OIX;7F~Q|RgPy|$wLX9EFKPYҢCrj"I+|/W&ez!({!?@ZA#ʎ9o>Wߩ/-~<,vg=_UiOb v'G&;_tڑrMAs7Gz|v ,t8Bث-šC>t WՐsWٹY5ڪwк<>>9>s>9>Kα=󾉌Ң jGb{=ר}yç|fk@, 1 #_W& X&0/$ >#Q3Z&D~HDx}=$gTk"K: A8w* 俄q&' '#K;AGﶺFQyi[;68Z#6L_:.0 = ?V o.Wp|@bנUIzӸ`qm*?!B(\жf268+ӱ|-Z_il 9yv,{}}4owOPW [-ݝ66SΧp}1{Iь>0CY{ {Kr)5x9ow /qyj:`-_ 7|M!>UXx1*V>$$/ !/xLrgaŦɶOW.?<ͅK C8%ύkq&'7! 3?0u6 ke.p60Z%4 SgqhbO|kPTT8_V-czZVu C7t{z]W]{G/dɮTZA v,<S LJ=DjՌ`WIG4שN8\,/kq,T $5=oQԼKC 1} z`IL|~/;r~$G4y شv:xVLOv5O|}E}mcI%@ ð. a[a^M:o偻+~inmGS-7mοtxOW%{pGթ%׿kEmk~VZ3W_{GG^)ifWyceONu7)Sr4A#M!Pq؋=B ^YQex'SeՍN@w`B$1^8俕iu6WB/t#s+&Pe4X۴֟\I3:w0#xJ:t~qANFA̶W=SJ}sM')'9O]nUMl_#h"?dIEq~ΗGj;^308WpZ|/Ce~J-&A>A>ɤGd{ˑ]oHC`3@"!eç>2Sl_ >]P' h@W~^u48Ŏ? ?>o_nw!/WUb }ԸO=;AJhW3HT0C gS߿bdC99_UOCN(:!?2^ ?@,+ {ى!_ih)x~̋=xP==3^d sOf nҋ$TwW=Ђ] S`?q`ZUg[F8ODK`.YF#\[0V!~H)!G5S` g3SDu?*~@G?a~#?S_Cf9d F~Q;ӼhëٌS!4͍I'$'''B"L7 U7e(/l8>salL/"{KDxTKT]!`@ +7}0=dM{[csSڦ5G\۸>D'¿JOp@C%J y>x;\}.\KLcじXϼ緣ݡn=[g6Z2H{$?!ґW* ѫ-BUUo3r*byxF/ysΛ{2ja}Tm8{~>2T^=kuM -ݦZBrg‹2(뛱zW;QW(]6ql CQ&v-Ԡkπ?Bp1xSuh;HԞF1{%r1 kAUy`Z4sU?r{Pɩ YRN>TWVg~tsG#Wۺn]ㆸr"th@*w2:#ܣhnqcA%$-A>A>A>"Ow~u~j|P=@ya^L3)ނ3 ["}CS:'q {9WyE\:'.^M;`.dBRO6n1ClN[f3-g7c8ykￏIKK=~S`|<^ 2:  i/?RWt+?wG:+"K0L؎zgN= "+p7U=%8qly#(5YMhJb/y[ ׊|^[|?[biG>?c!@(Qq¿g_c#`o /㝩 L[ uoݱnwopA>rr%]K`,s+6#@]~7xߒK+E5cCAmb[XY]eډe_Nr_e^daa/[L ׍Yq05OI-P/gժC~{!G0I="Έ#y> m]){HU6u=ބ._?pz>5h)*RNQyqv\W/c.&WT+G{Orz2͋rF$9#탙> ӰnI+?A>A>"/ m^5iin^)#YZ4>˂?wL0|jn_39է?\AitfG`0 !_UE&(|/,^5!X3gQ?ƈL>{oGVofJKMIIy?ЭZKLg~:=-^:~}r%$J6دجErz+hM$6 zˢOD_Dx e%&kWnƏN_PϭpE?-F$b?`.+b\TD,,#8?"gTa!P__\;HvA~XKm+L)H>A>A>"=s2LLKy^X_Ȭp2#8%Rm:'Q+/V//A}pmGYm S ¡g!''B/9c?{I]WDq[-[.u'ORTh"=hA>A>"ǨGG^PdGqy"}Wxidf;3w0D !߳Lz/v/ xvچz;hVEMKMOOA^$ϽNcI=Uix~F9 \Ee{aRODCC}R~EFs~@QWD873`ҜX!_̬]řv?Tf0OnRiï؍-tHĀUf?;JCNQq} 9y6dIEq~ΗGj7s5 y` "O<~w߰!:J Q'S~05BvtzǗv-N%da% o}9]'6A>A>"{ی1o gSS>6PžO}^ٻƺsaHLͅsˠ~|F;b;JcՉ =Ys^3Z:Y-9NgIw0U}nO^oatwk}7?Ee?G"`垙&`>a=Y9_Ơ)?buPKg1!ϰ/kk)REQ7r@TQ~AqϕULc}Nܼ 4D fq?7T6΂(=xv]+C7=&ȗpW4 ?m,p-٘ ƀgMO"S뽼BOgECdK5 +.8?KR5i\usurt68 x7jj2n*i>pu*c)1`rxQotuNSY3Vt4>7l3iUa\YP CW ݿnu3V7@쩟[LJf U8HB=Q8jڠY7ӿLbff@9Bzҫ!Sc4|7J\~T̪>3ZK%O0"ONyL10Wx*n ¬'WRYe0\}ցV䑏G\ې"??rGrRyBn0ox A{&qY__a9wcm;w1zWe֯/nt^q"$Zxȹe5 ,pʂN,?ņݭM3-hi<xS;sӬoUlԲr#F1kp`qA/ 9(xYKqQN/8=1Nd.*垫0nzFLǾ(?ՙ: \"ȏO|컦>TmY^zZwztw"lԨq`?S?ްnr?vdzehG\grj %DZn1i6x+3K E!IKo`#g VZ ?m/nv][GG;&@Cޑ:T*Vf%]v.Aۇ|'y̑ / Ff-_Pv?8'@!㈖sP:]20BU4n0R"b)m,5IC+a|jV~R~a^nd -W>AF? N\;aRi[2A 4,8 pkp[@̟r;ri9XĬSh]_3sak)CSu /k8+ns=)iN߳ d/EX0CʡVr!2-7!89LΈB=eMڦP>A[nk3^_Ӭo%s[\<͹L1rw]STMOiUzo.!6'|5䜧7iu+F~~AO]ֻtjoAQ<_]X0rc|NIТ\Na@alxҕlx!sc В3r_&w҆xyXrsO$w)(OEmC{~_#`-HM﹆vJV__+wgޭ.UD v~x䐟{ߜJh.M}|Q?w<7pNmk.Y0_O}T`f|#VYspM9H4nȟ 5ű<>ϕE>BZi' } Zk\Ss(-ko_V MzBU3 T 'JE䓈=F7tNL.!'%G񬫁 =nl-KJM{K'6ǺJ61'V7mvmG3\ (ڢqi9Kԯy) [tD修wWTya٢ Ms5m|K:Ms%Kctz&g!BO긝;zɜQ0`ԯi 3}V뷐DLzD !'''Bn"?䁩6I$Ayv"mcócBkM9C 5O& o2{ ^||"D_MuU9Ux4kw0nL~߽#~ꡬ:R2c!:kgI~s~@QWD䇖[ѩs'{tɁ/)^^t]GUMl_s$$4Mⳇ[of,=8 Q??y%R<*<4Hy 9OVmB{9͌'^t7+לjo[͟qq`VƄ^ZӵlyE6Pq~C}' 7X<ɸSX MP7fN?N k5K_o&L*1ov"S8`LM=;i'磣_5&y/OֲS?݊M?#`:lCgǘ3ѥg|=;*Fj%ׇ'?Սヘ>VjjJpٿ}Z:U!ʀ/x aƵyz)uYtʼnыUTkqMp^Vۋ& ]'u,UF>la`^`L (L9A>ǧYx' d#3Ρ. rȲ\ژcׯ_4 Z)lio˿Ͽj)'[T_!S3L"]د&SHe2nWc}ի+nv;ԽEc-2 ],WQx>{pʱ[Rxه_PHùbـR/ \XIƒ)(ȯDf*&F]a|'ﮕ_2C"U^ֈh7TM;l;ˣq] :ܮr&5Dn;%V.ͫ+c9D26!,Xyfn~_k;`i/mEWU&tˣ4mxU95z=H<\]E 0c\VqSl}U]kq\Le%jK>-=P^3=t9ʎOr|6{c-GlayJz({ysw=0F͂0GAc;s{*ܚzJφYr;~ F>?b]ؐE~ʱʎʆ_/clOCeٓl2 C.q|Y9 <fWO%<3 HX2| ~ޑ;YLH&uP a>֔xgd߆K'??집|G^||%q7s GokZT%e3ڹድTs;vkuBo=Cpq28FgςfT Ѣ׷+/ܧRc5 mN5mh-lt' Hsd 1;^|¿q?WQ4n]rƽ~fM?5&\(~I2|M0+`:sCY_} Mf3^(EAqLI0Yp\_V—/,;E2nGǦ)Ά2[I,dp"\wA k`ڜWj))CTq΁Q8t %րHHۯEڦBbGXEڣrG\|Eȧ"OM--PztLq]ٽʺ`j?^GGzhsj<J=YC[%%!&scyڅ2 `7sc]}d^>PAR. Sx}e`e dEٿb;ؚoFn>KF"B9cX; 0*^ml;zѪ`kn9ZhM_Z^e:0AQ|t ZM9}M-@RT|Bt|>G= ܳڕru`M`/-ނ7dTj]yNU"B.E0(mkIeu + qسPyWH6PB>A+u6{Je٥RB>.Ƈl*N^߱/x~pMki5vOx|n"% (>C>4qNEZK2tF5F6dTǔ+|zߧ.Z{i.>bR7v,R 1ȖozΡ%"'!5']mY^zZˁa/=^/)~d"ZNRh t^.`0D5n:*JTF{(ڎJ9T?0Mu<3[Q۩Yuݪ f]NWE=4MUqqWv_dap3U?^mԑ߷@m`xA tk+t6{Ru=ַ1u6Q|;ba}i Vy8OԯѨ#?8]M`#Bai# 1 ڜH&⮜ ?I"t-heڟ;PqxT *~ms(#] .˂ؚ.ַ|߅𣿆j3٪^kV*dq!~r/68Z/*p{8nxw 0nuc}ȗ㌏l9A>_ݟka3rUM +~ r5Uθ.?sʟ+hj.n^C= lݿf eD6SnW@tx_Z ٔWZqlJ?)l)CuIkB[<,c5< 'sx^эt ?V|:usDZѩt<{ PE{'rc*\Z/#?0jǺ~XkSUO pvxHó/yHJu\/ƽB.pC7ȏb;Xet _Q㎏L9A>wþf_^Zڐx^φ/w&<N3ϒͺ t;C_8yPӣ7EgC.UA2U[샑}q9f i!]SI{G\^V[GBL/ܩO{aNx8ƫ9pY^OP/I HA;*:A>A>||"D !BOOB ||"D !''B )}z1p_׍n!o@ t:@-E"Dē:^kDr *e}OLF].0~?>^?wR^x@|"D-ݾD;1fv<=hQ#jl٦W)晡WdD՚湹9 ,ZBeo@ 4;;O;-hW%㳟 o#HG"a,WRL_GQ)*޼^ykGB>ڷ(''B[{A>~&={&I' n.9Wt%|"Dm򗗗3DhB俺o#׶%'C QA/?s!BD(.,GNo q9Y||".t#m ?\8\?0?7<9 ?ü_L ,??lGfJomxK9A>A>w@,п# %#b L}|ߡ ߱$m?3x^X}D:6-7r-7%Pw#3$?6 GE>';;Ռ۩? ]Og7so iMK:u@6z@> smO1L?r̋ `!Xyl>Jtޘl*X[7  ՝J/ӳ j=@s0,E|DB?iTH*?LpƓϳ_DMPX=~8tapwkqZ"M-Գ~'?/VTσ| |?>yy;=JJ{*TJސ"߫W~p}@+3ȷF+حGCߣΣ fXGt@u:N SN^̃6W|ȅOwy:V+F}n]AB;OV#6\864:4F^9y/ڊp\ڟ3%#7b[0h:8A"YqmooEqnoAO~_XyGoQE.++ t_OoA98[/~@<r*MH}4kGe*ĺ^~pZ!Z:a[ F 8Y4O@C=s\~}b4On:fFL}{A 'C@ ~~K觨~Y]ׄ党h(J][W4&5ͬX'G8'Vx[SM0˙/ZWΉfx5><+4Z|&ԭpj7[qhW1wohpQ5eMg]ܢ~&?{~wg&3Dg2ۓaB!2#IdF(щ$&rJ{CQcP^@@(F t7tuoKUvHӧN:u6N|[_76_K> R"L:MG_l`9sm^g(_&єCJ4uX{_tYRzwo\N[~bUױQ"̙<׬YC0_OlIwRH#Wޅ^sTSa݊kr_U|~Z@~p膠nԝ'v_X/(ccN jO-ٚWQ؀~Qh4uVڬc>K %4,gƟ2OP%6[J-35ؖ|תe}B+Zr[|x/3V.ЦyʊSKGk6م4{p$ G51VnqQvL,2݇. Y)[dpb8]e-Yz>(\O#^ٶPKwI_Z{uga#d AvۜwtK,YU.BW\GQ3_<_V 7(_ Y;9 [2ZK+3!<wLcvmne|k̥&g߅E]Ѕ%EOp,3pWE)NL}I CN\zk}pe|7&~7n뵘(1VX+wt{.(/~ՇinKH_95ʫ+'.#F<8mzoSw~0}k&TW~m. 8ш AcP% hG/{"87#(!.28wTy_[ ٵ?&Gqcǚ,׷h,^˾MC ?߼}c~fjV#!}{ug'+B|?1Q|kD91WS% |K.7ߐo;T6P`br8 ewc+4}V~Cf_> `O>َ?!q?R$)?~]td\Hhp3*'|΀F(Q/N yY\st@Ck.\Nr¹Ͼ%zE*DULDN?k@M x_Wk&V~=vw]5;;EA9AOP勶Nrp0{clf(lMd*xOnBmYvCe}(V( Ͳ`Qo &A/9z/!?,-n~+NYk:i'7dO#5"N:dܕ|nCu$٥,"B>8exq 2XlY6N_/bsnZpuK?GG{/H)9.v-xhyZu䟯n }\q@ Ns{| G&9Ve߅xJU,+-jTQM^6hV'TL3DwA zcrM^ сk롁hǷx뵔F"$ >lCR10">`P ' O;KF%G4qvVAmiZ@>kh/|i8`**(ekic+"?<@m"HnsOE=ځ~7W/\yg~_$C0nK_7z/bw]w^5^?70пb ~>,]nrE4׽59VboȯB W[FB%VH8s eeuz/Z ee%S\\X jҋK/w{WBwx{w~=xga?jlTs>< w1C#g7֊yB^{gwX11ew߮Wk~;s<_ywƗ_״C>z Ef>#ȇ1`4|;o7\W6Tn%ia# ʣPk )-IȈ >x΍_cr|J^ Pݣn.Hx`Ʋ@&n4+h X>+@kIBaeLce#xOX o2*+"?vo=RloB"fԍQnhp TlnQPN?"?zekʑ?-iX>P I 9nt], ֝NuO"&uZ:ɮTTzb]M>|[CWA8k.&fA"d o[!S78%?sG.=~t+?;L^x> %^vXz{{CAFdz? \C Kɞ\73}C$y:ڎΝ5=,\ltpi+DL2?G/]&oSy γ>zmuWOr߶˕_57G㷃noY{hHSa7УFȿ&06ab!.#aZYMD[᫄CܚWG+Ţ2^l=zy[5>HׅJv[vR"j!䳜3XaU߲si[O..|EŎWFDnOg rNwLQxJ֛^tґlɝEtKpiR/)ƁEagiq&hxZ)$(䥩s"9)):L_7\O!"!L$j1vf?Px!Eb ti#R b{C}!QG`h2XۼzB»ТL{Y+_E}n]r6}ZoQ!߶*jF|(!H.7*i'B._.6cv#\qu ը'iE+F5 ;z+j x'Ab躝 tch\{|7~ z^ld=5-ϯT#+'i%d"irt|坜q8x'#_kgvZJ MfqzQ5% 鷆KRJk;U})qGz ~r,"P|e \_>F`oCł_67) h(gBw!Jk餐}gU(G61yvf?ON7ޗp ~5_ts/oD.ߌ7XrZWoXzSpx^2䤯B+RU4"9(FQv;0CTW#_+ŖqdNu\SY+[km=_/FR3!Yiׇ=f& .ttAAalqC%Xtq¾/ K0Kz9?u4r*濞?YKo_z#ү?+&~bt-zRy +[OXv`1- `Dcޖs"(.%gՈ>|-/r;QW Fk6j]e$*峜|%2D܂O}іΰ}`wvUQΆF4/Z-:s,!j.KziXYsTi>^ 쵩-rOM۫ȿ2m}%?5?ȗ/ْ%ΩêdAsrI9̯z{+a}DoSr՗wA8UfJV! gz=I7|/.ub)/.e /.}a~ckuIǒn_-WsM:^:m9شwй/wj#Lezt7ѥ =#n"bϸ}xu֠|"A>^4`hB`0055yqkthhQ&NXڍV'/ +OAsxucؘ3u'bPED4o)?Dȯ&D(\,U/67e/ WLG#W P*TnIJ.= HO;n"G~ 059z'x䏎s ~ |jbtYvJ7mȟ"?K@o`:^.6v}⶛CHjblC}xyKEE5QRVU 4434Wņ|&uSMSE9>!b[_*z|@@Ld֢wt҅"b"1n/KP+$1?GEKX oon.i_fl_ttgXnb;Pj!E|G&$u?{#g"B>OI<=M 2Σ;jKgsu&c71nD;˩ːS5mNg[uY&;KZ:{w c>͹=lܟѓ;5Ax8cl w\&uCyvޖ5ҥtu:R_X`hA1K;COr"CUb|"Eo<u=†ws\_'ݧB~giK^a\#={[ |pRAmŗ"=:仮X Ao J:(ME1`0YM6˩\OcC\R{ {^z t;r#3@>LtHW{ sShIN5i"(gtĉ'.h?H4`-ѤէɎQcZU?\l._Tv!gRW ϋ%Ӯ◉ao|tQljZU" A3pV zv=<)+Vb@ C>L5pRM zFwvf&chZ7\I:SȧT+_>x": ۖob³i= 'RUO-9-ŗϧuVqM񯊧{ͧ/D,*Ot_|qt mCX]-R9%Θ#VE23r?Dދ3P1!@Tm(4RE̱K/_LP9zQ3bc ޡaŠ"\>|4eِq(=y#d8:K@h"w%\J0@Ieig*9 8nvaq{ه'o1#w(|ք/` C0`f6%"{0kt_=j*ߓTW "{Jo9;ff\ ^š\qK,G^S_Q翈u \pبGG`}BTӺ6b<];l)(D@.>NoS0X t;n-$U%i ֫_` 0Ôto;b5WƪԃŲgf͈<$ Y5M/d϶mFFB8y_X3SCuAmǠb?&ukYң'G> E+^#)S“375}KL%˰ t?l2 E$CHb?\[Zn.|j6x_UPNGW;%cr_}GM?U'٫r>-g; _vW +|"6#F*T,-oАagPǑN=iyUzug\O)~dnL}籿v/vvF(G󸢌+q^Oދs.w;p\ _"(hl?/8uxtȧ.$/=:SюF*D!,l۳ nztQX ތLф7#˖-G /=śGA76'KxG>9/N΄u2o;q4l?Kl;«FJR'$ʐ{^'m)*<nCx-D-]eslƥp|],S|U3ǔao&txٮ 0zAcw ʡXg08|FUcDx$ZY%E!]닧mbakz6sFTVVZ2o ޘщ_ȏ=o} _D@S#LeEe!g|uvn8 _=5;`^mCd|F uƕayZ9h ^(x"P.V0A?Q&vZ,[nIA]x됽[.SWG4"N<2z N |e-" 8 +Tm#ElFݭQ^uLEFB(F#u~tZyaGƚSu>f9N-kkx26ϒcR>|pIɷ ^$ jIXSh>e`)ԣPPc ԏoQIzPR zn1 ͫ>\ HܮSFyjЍ  &nL8bO,*"eOH/u2xoO~摟)(x6; LV!s C oAȯJV p.߃Pz.V/9RiFWQ߇p-Crw(0veT{&^PG4+#1't)#ZpoM`HdzҾWĺEMQOc4b2BsOì0ZˏѽRގ}ugxl#c`XPw^9U[EyMӠkքξh؉-ή梜+)]L.pY1g暲eE@>C㟇Jڻ:*sr.tO_ooo(H#k¿zvׯ!6t@Kl6юDBC~JJSqŃ~|sRS4哳B:O umKsu%2FX_SgEʧ> !?.x 6IykD3|{O6He%ۮ$exΛe oCB (N|vM}L0ӓC; |9 >'=8GJQ(Q D|"e9lh}-^W"."1ZZh?Jelh H?!MԾygƒ~)?O0pْ)?`g74844g)pĠyYoH ÞU O~2/nŻVyrD~wbb[Bw$mžɮkF Mʈ|w[N;S3WKiMwC G$=˷N(л_; `)N=<!l7>hlMU=h5=!+۩7 4Tu5{TX2D1o"SeCWn?I]ލf|B+Ɣ$ˌ}]%0`歷Ǖ&`J.Bu$X@nNA~|ȦO8 t&<T1' l+E|>M4lu5t^u0o"SbĹOs.w9k*t,wO~m|3ڼV8~.0r_oaHrR_?޶겼Mvp\{8F9~umGw{kݹ#ϱx8Szt\Yͻtˉ4jjD|SLYXȇznD?N Ac3B> RO 3S#H`m< P! `G{@&~'G k~gCSA9,we{A/jG+\{Ո Sqb<0^r)M0H],]O"quh "aϗT-k:Iu^B@~SL!KGNgoooOWWgGMMw6ܩy|Sγ8FzP]Fپ+:u.U+ ?4:2w[]@W=fqfv{ B]-+}T}ᗢ#fj ɶӼ&q{k^eC Ө ȷuK=l-j;:VkBː|fjͶľ'2_<T,U|dOLzeĹH^ZȦȆQ,8`0"'Ѐ]ϛp?RNXCv#!Gac4"j~ G97G`GBpDbIu`p&_C[©R\ Ac33:Z٣(y[[UٱC0n[Zڮ./vuu]8tH^\R#}ȄV ?|xOz CI_ɗpN޻+/{~K09}=SeGyss#)B&ٸ}n9&O!t'൮jq%2-o|{[Ny}->B9rW5PeEn_pgQ7: pd`_18rxv*G!ǜ7o) (8ޡ_DШK.n;!^͉8ņ`^}eQEތ|wOXts_(l.z'G~~~nb7M"A9PCZp!p)hҁidt:!m^?=4B+k 瞈.r%ʾ3k4 ;NˁT"_rFAuQdy@G ;ݕQ.2TCվtg(k@ێF4͂oat^+*ypȧ%@"Фn/oQ1"d-=ew!8CnǔdAo=Y6eˠ!89F>B@'%ívŲ&XW7mž:h_0#~!QaGiy$@d9 j547ŔGyEe%%@ ee+5IhΖ¢ Z\=AQ:HՈB#?#  o#{B&0!?~%LEMqbQqQqq4@8ʷ3=FВ]7G뭻|E^.^wB@W+|λbIRY05Ut9v{Tfn4^3"-jgQ17"RIzQ⸚f3^h"D)04MA%C~WHIcekoځR,^UyIZ(,I3r*S93˨QnvaTdE rD)5,rEc]>;~);Z!Xtot "_8=F{('s "?ZʠV)JL>TRl|s|͹-=n@sSgt$Ks:1t]ECW|#ٗ{([mY3j7Sϣ){;oI\l u[㷑kmiP{9-9mdlm%Gc ^ "\{nY@| [)-5-5)Ng4ae~`5o"SlwUAW8I'}kOSἇb+PS%6k9kŜoG`Vl?E8;(M- 1B &m>ui׻(om_9= !?v|*"[$"pރ?OgB1|j n{#̊nVNYG8EHϧ\/sn옶?^.y)A676z&>ß15TQ:ݟ熬.Q+rRƮOvs ۏ&ƮKL)h!gШ6~ mkE늇xzw"H>?mS4x|q۫pDBp\D/j|k> T5#R!@o^9*s3p"~ν!.~gkhT-"-sr𒝱_=>V*4eV=kTqSU{]򟖰όF=AR]dzct4 o3<*(NSAq Z  Ztԭ4 M #n/t}JiӦ_~95uؘk ?l"?2@n>[=,5L0EsmGæ+B~aY}TqYȆtt sUiW^vaV]{_&1Tila֤%k9 .q;+ɵwUZ œ*&-]b7(pmK7Նu3Y|?+V?3G?eңQkGSE{ۤ=k>#'ߺZ~bH&g> sZkn|1V8N۷-~hH>Ŕ);TBͲ&u_yu~Hopr[01/ay+F]@|?XYE/.m :";8GgLǑ;G:=򴐏>k֬3^Oeb31Pt& FN+r'N;, }+¨IpgUqoupMGio3-s`µ7h~\Tw|a[Xˍ}NcK8 ._dzS`Q!t /8H;d7USm۶aB2@HꋴfȀA( ̩kH*D쎨 DxjzNAGmg,p3Q|.礧Lնo߭3?pX44^ފ~d[ 698PY16n)+͝zUD>oq:{AO@5H˽}_) [l|-Q@rGdȗxhM[6 x94~#DИcǴS v DR\Aai_tex# ZK*JV]>v#̡?9fElE6qPe:x t#*k}l]Yn=>6:2<8B1uyK~ױ|ay/!@/yf`=Bz 4u7@"]r]Mj{KZtBFVTQj!>^G z}A_+Uo Ձ|j*'߳X:By*CCdP( NNN|>3666<#j9 d mPaę&Ry*)}錰|29!Q6ʩP,zr}wX9vcdzN(eg%##G:͑_>i/mK >Wn<#;v8h텻OͬC^{ D.[:hk; |uu`uOk)_kÉd]jNOƮeKB/~pc96Nߔ%ĉT(AA[?J?}|K|}O^=SS222n߾N'? ZxccG=='Eo ^}iN&|: Dϝ<+3 TLO__ˉG=0H.Gz }zKEtTZ8b#THG)wO4h;#7ip<-'+.jtPI (#|+) e\tZō+ Y 5U+x)/rYeUiŵWΗV/BJTzzU?MMxə9y|zǕS(XȠ8;'0byqU*@ͫNKwe/VYHb_m|h(i-WMouǖO2.J}ENZO,e{Ѿ:Dآl7K!-S!_S}-S3r >8C\>|AD2 *Hc|M`&k,fcu*)΅푼-k;X!{q. bW +hc"]-0](OR_4CXtb}b=R,Փ/'+Irg [3EVd.ΈTꁸr^^F>_g55ç[ٴ5/_6]b_tR A>,tSI{uDEȫ/E{2s<-# wV{ GiսmhtV}Xn^4rD{a"?z3n ,{9=CѬI;/ĒoO>sٟT=V4~ב剹F%bʬVXg|"r }1c9UӯӖ!f[,8 >*-:.kl?e%jH.oX&U}S08n-jr/ǷZW,G%5)`{>2z'Zh Y/6lYh)Iqȣ;xN+\˶Nc&k4gI^ E3 *ȏ|~:p'BW@{8(Ao-_V9HQ_mqii@rOR451(Sf|YfM}}ݼ!|kNT'okjZa ӑȻT^sD dr96l9(-!## "[њ,"(]v5LCÑ} [I2ɹ+rp`"rH`欼`؟)tR>NM;Z@IUU!4`5^t"R WE'.W'o<[.+ 6WW{MO+lcopbz S5)(pKuM hDBGWCрyOHaz'M&B9# K:FGn-,.Kt}BS_DOn xGm۶ u]gE{8m`!(a( K:f/F92xŲ!D|6bߍbx>t+[ %">ߏ|k@~[Zxp~ިe\{ }-7ĿUu3yBtG "n>54!F1uQl0C_# CkWF02A2CQe:(wBr Oz5 \eX+VY7$ZU7T$7DaW@oZEkzv|_GػF,S[l7]="Sx+ 4k&7}1Qu9QytъM*G6ʐMì=NY|`X|ty'숣 Cز{/?}?Sw (Aȷݚ@|E5wgmYVtī@ܥ@:HXr(TC_0NtGAq"!~V֘s)9)ut-iyuA3h,9*sl뮪el;{"Dҷc`~CeeE%%żW6/[#`)GȑbNؚ|QW:ϗ• ΖOaqh@Bv( qpy]e%eeWQ{ ~Ӌ2brkD|!n"H>h!(V&+:<#a 0_lܟ6_nȿ-% sتȲ?L ?u _ v$4{* tK0Ŕ"_=FQyNjY3>F݀gCVܙ՗e#ύx^K[% /OMn;7R[UChw"|}@N>deFX Qr${e|/F`oŲt[ 4$!F4ж@{eyitTQq<-Dh W)V(ꏇm՟k8,N(~XOԇ@q*Lž6n|Ls] 99ТX5V-'y)Sfᡧ.ۨZ,;Fm;ݎyYeNgWg2 n y#vC ?A_[ !7h?_h>h0NOP)mE9+NQ~aرHRG q+[]N`.ŰA\ok?r AͺU}PM2߳{GQzҲ|%˲q$!5%|RLL ;:# (rSPIQPl0HdѬf;q(?|#:D䇩斮I]I,;8}\! ڶ2GnT6^H}S*Sf(5OHCaU1w[a7*55*!,w{An|",~__PoZ.Z2@Ɖº|wY&1ǵjIU^xhG>˺;J]6#I^c&nu[^ h$ȷ{)Fٍ?F~Ŀ\hP.՛ G"}%'dj(sFTKsbBYOlF'p/?9WBX*ADu]rG7o!8D=eI:SQ`)φ}3tFsaǶ#&LYȟ;s>l!YA..ғcy[KE:㿪$)]}h@_K  u;*AYOr~Z^Vy]Шvޒ| y tNžb _ }|d_y]/xRӓ&UoN+㷕7D'][r/ƫ\X=pDR 9RA)vA}6xQ8=}G.\/@NWf8c7rQ7&;ò`zR@pĠm:{܈Q"P3L4(:q+E}&D)7C@:3cHSǝC#uv2?Sq]wZ|8WV_?O`oSL9e 6+3| &]/ CVgU_}x䞜ƶlb(z-oE!=6AnK'f+f|k*+'D  D>2$je'ؗ*=β[e\nSqٷo{w"Űu\r6TO]Vgw9cJw! M!/烯eD_/.COմ9{۪K6-LYdaj5ֲ[޻>} 5Q5+NAVFDk?Z5ѩ!#m(]@R' ^*~1(RQl+F|X&M&) \OLd*C>4#~yqϣy fs?!Ta~%nN{UWEK9Os_/BBAI !]:z5eB\W#Y#?8c{N{]rRBv~-& v>mԱ't e͖Tr%Nr Cؽm8j\Uȑ!=@j7=}=8vUs6- y;㏋Wg\(ulP MX.&+V_|y)E'jypJͶdƒ:?uhZzYC7Ahl1)&/u-ݥ|I%5jB~­Kl)OC@g.Iš֤gkqf?`k)mSyx|P zkF{ \Рi5d0 Y-;c;DSXU~`_I}F|zENUl,oڴDx7yq AJJK S3.eMY4G5kV_JP7jk qUŭ9 d:y׃;ZumknH}O.W L:Z7%Օ_0?v9NxK m˺)ܮO̓6F>RTxM>Wˎm?k +@L<ڜ2;k\Zڮr~GU~˨NYVy_L 64^`ɀx_|Lֶ=~)v;Ѵm۶y@>&I9Xs[:<#Aq< D[R0Yu:5_X[Z%~lW :F@^^iڤS@ x b$=} vjc>L=sjKՊ2e,*'.X/ YX/DDe [<`0[{ݠ )]pDՋg1(eȧ5ЋhHՎo1YT8!b˅cnD$Z "fE9bGqqI*ZٲDrC2 L(4XA+R]B _.]ds%ڒޔrk$q>;`b) &ODe(RT~Du[sDoK/%ȗ/!7P&1 =_k@-M #e+PA Q!12;ZR*^QPr:I} d29+(bdxni_N+%{&fAv 8E,vA;"?G4ݹR-q7Ke}d$7+N=^h ȲZj5J'Y6Eww3ϯ'6ȿqg8Go,l,-jp(%V]/HV [fפlsFt\g+Z%.a} %ڷOn0rW.Ṷ~ϼ% )[Y]ݖ0h.YbΗ@Jvx4:??3;y7ᾗ |,3[FH =mO7(9a O{COy+i8™_~2~I~NՕ.~[N=y]O*?C|g(ަ{.@bٮa<~NI߿/I>?!.K{n"om~-Rt -W bqgMACuDXfo9yۍjnISĞ|<ÚN'dO;&{nX`t f^:D"pWAh.aS ߫n2]5WwWY臚vGr)\RQhD{{V6'qT/)y~[F/zcc?"ػPhs!h)f<m=A_vCZ>iTK ˣ"z8":'fa!ۋ.VPaI3b^1FD$hhdF L<$ԭ-> K!)&O$"BSe2vX"?Ʀ_MƋ2qSP<\4&8M(6'qLxdثjG &.ጐg^ 'C[S {r>߯/_VrZ$+W %/%y #__z ft՞o!!^$Q?ixUHID 5j1yvGP׋]_y5'`l*;j0D|v/q ~L<M{r:1kUɅQF7bjL&: 鳕Y O޹|XBVsRJ>tώu_ Kt#PK]]B>-_`JaCyT7RozeL#_rGL"iEң!tyX&5O>摪B"S3OuXȷU,o8A&HB>R|Gϱf=rT.<=lN%u@?ݎ&5B:㵠U$T$&SԊ~=dzZkuL1*{)_&f?mnb ්U^/...,,|^̴3911>::24z߷ȇkFhu*Cͷzcr {志;kқK-x7bp2uρW(`GNI{V8y]s[ƑNQӥTa ۩0 rzܹ98r1\wP݀y2y0z ^=MneB\C' &<|pID[^& \> R=z=yϻyNշhIV%oږ/f|߹(D>eʚ @[uJr/3j6܁<)yU9CHEkӾ|2xSp/(x^>:SP);αc;fc+Ny[9-_=xEO=~;>t4 -݈̓W yi_o;[><= f),)||κb W(Ӥ|^IWJV8pU朥CWH ~jE޲i_Ӯ&)UZ"HFX[?P'O|XBrEIҁh뽁0*Qg ќr#J)+A@>%̳rdQVN7jX$f^ܭ}qQ| ؟~ ԵV |Dej L[KT tF>G"m,>JZgG-[*/?FLټ J-_/YSɡ%1izi?#{*@~-fr@93gC;;wڊA>/DjF5jXv ^GN#"oE[~Dj=w(32KO൅W9w_v1F>m1ϟ.Rߔpm^DVJ܉ ]B֩G#J#D_PKv8/!_0*ӐʥKOR[*+s"AcQFW,p;l.=ɣ.Z(9Z}Y]Rbᵃ۠v0ȇ5i祔A{{ܻH7vOQ .GCQf<9#[U mӿ9[~PSTz ^"[N=yC;=6@kW)SE[?O4">e|ȟ}Ow{-}XB6Ec1.s,7ԉ؃f+㐦-l8+9kM 'n ~}bs؜( m?=*1ܓ)+|cP4Uy)>Z>iTKP(K5> z4RF|'mGް6Y*7v~7 `{nr)pGԴr | cS\[ۑlx۝? Z s:Hě^̹݇^ooxg\u ٙ@s>&ȟhۉvo1ߑ ?wYwŽ y~8L3c}w4#Vv{9xTqftSldMECK**([ulv=andԿ."6}|P bK._ ax]Iss|*Q}]`D[5OK!A_zޅL ߗ.Zo#c{)N+YlโsYYzp~fUF/&e??Z&? j47Td j:X}a\*Z "҉x"ř)"O"2Xe"FhD U(|"` R xÂ"CD>_g4*f0wD:Fyb׀Y)pf/\ckBC)c+=։RSHq|mm{+a&7%6T-rsU~m)/X&Ѓeǿ'Rb#s:r*ېv[by24ʤW 7Z0>nKY{HYnVO[ٵIoQlS>ǎҽOB&*ϥTT|=<%"Tp3NjiB2@e=fuL>~Uٿ??9rxm-d!BBfG}ۡ| 7e>+*KyO C:MR8Iȹ_%|G&' oua~aM{KOXil (-)t4W[Z[{ 0B|Xȷo WZ ~"d{!` `R V2o]scFc+=Q#LL Y$Jj#M9ңU;`eC X!9eUՕbuZ ~Xȷo ͪKH8"i5[Wqsy/\[X\"hE&WQQ}:^){ J(g^VXq~2đb" "{":-ǐ?}ʲ| Vo!ηKp//b̑Ta^r nɗ^+yF>HRII/2zG`]O0D ~`[Xi SȠN I/YZ Xȷo  /FO#%>D5M[SBk_F DPlg]a=qEuZ KY6cYȷ| E.rV2|0ч\K/8G|>G  ;;5MvtŮ@gvyDٜQdrnˈ;nf_{ PRN~|.{0ق`h:aɭm СCAk|XBf T&JĈ֪Pތ@IO)#%;xu"k:J}ʉCzUj1Ӌ%s{?A NS6,Uo9yO{<~ v5 bh!{ ](=GsRQTւŗ|Ғ68n-^ioXR%[Œ-[*-[ȷ| V| b!BUb!B|XȷoXȷo!*-[*-[*-[*-[*|Sh#[k|$7|6J2)&fyB琊> F I,'2wѝVσ0Ll`$49~"@i,/ʹRZI !#ov5(ϖo!_G s}W8]EoyMA෬m.ӽ+g'CŜIҋfhM&;-8SC**\k;{UcyxL{ZqUͥvso٤\ȓŸz*Th ,D't4d39ѷM#˫g>2g=bsmW覑 oqA*0z8 ,.,xܯ<E.~ 2z_{x*"=>o~~;;33LNL m:XEIZ$k_:w}#O; Hqg1vӡʶu>ɔp;t>uk]ddP8ME K!$09]Ys4#Uk)^}jA% 75=`&|s9>>$vJ7N.*%uMK>c`&tnc,ƉO>iCMHZ|t+AMkbKN<\MMuUθu(u~FG?b=L`GޙFK5c3 >aO;HV~b12s1d׺Kܑ Zd@S$O{T݉R@ŏuiGh??\-g>ۺ?[q?w wl }X ' e299( T-^ՀXk#OjY +*6x@=k VHX(?k+J*8y<3п(PzG:!Y>r:RJU6vSc"<{P+pXtZ}/rփ p鐁Rlçux&m < ET?eA@``;Ϯw+ˮ@ރJ`qnw(jDCnqdi?Pgo s< mG'&fYncwF\gU=sX6hC5 (JnnG56OkpY!*:7ເ8OӞ*8'¬{pܷ%Wn4-g\2C'>tKi}:W }_{<ς@H5sc& =lg"9}-=mK'FY3tW9^Wv@'֧ګm;~|?_/7/ȕշ\ҍڽReVsgaJDgmmg~_}|li`ׂVBޟt:\^\L'Wq5wUK UֵUKו  ~᷐/a3ke׺x{3ض4"23SYjD~ \IC0:D"ׅ0FkPUl~r0˘<۠m\j  sRs{SNAkLTQB)rBc&$D},*IO2@Lwo+i\?4 a V3!}3Hfam If ~hb*\$_?T> $$eɏLTQ;('Lp5cvo4eS$,%ln>N>WOkh1I /"n Ijn鿕:v_?U__&?3t @w]ᶾz[m?B޿{V$Ϸ9"ᧁncxBŌ S&F_MݮaoVekh #?l۾6=fd/lבJWT|ϫ+D>GA/Ǎ'#$$xJAC-+?LRʇۑX/I!4#"i=@jo(BbD h7?a'JOr{p<$^$^Hnh@\pT\oJJD>!?6}w@=7014IXg~Rh D.}msQ=<\/"?%W,cf5exkEGlzy+؟}V3?{i8{+k.4C^ (n0Ϸ$5PVr@=?DVF',<@>rlבn]VóTW$40Z- Wф0PܳW>^mܐ&[d2L졊TͯT]"-|PF^T/ 9]P##WSwlWi>pb>Q.A׃h<D.@\m$ܹg]u <R~Z{Im K3hG%3mZpo,zC{"S&=~}V;mt] 4Ez^ȟ(G`0|"T:LGGJ~-aLeDx *'W -&sp5{t; hO- ]gAǟ!E$g?Glr͓[ܝlWM$ #?Gw7ؖaO'gbCMheWc𖸛% d$7+N=^\6/< NRQ)jO೐Od'Sx" /Mc'/up6XDN[xCzz=!a0 }Z % z2XK$b+3ӁupB/D=зn9eg{'W蒆T]y72R\68^}S{_y"$6e#s#3D_惩J_g^Cm-"IJw8ػECrDz~|h#*qKj65N2[eă jRKG;CldXSkp!,Kbީ ݕox{3!e?!oғ^ygi&FE&1֍MCK^IOg=>Gȯ׈M=IibfIFt(Ւt뮔aFz,F: ?hg0lDFmk''4.>Ӥ)9鐍 `_%OxubY\xdio}8O. /$8As4} &R| iӾ #ӍO#ǫЖ==Ϋw]’M];VĨ/+. _=M"_kW F4}mnC~r}9mjvTՓW;4tЩmXыAԬS1L2Hn$)Vϰ ,@۠adt&Q؎^l3 #?26;: +BdzR߀tJe8MχIͭx`s +He/#(}CSLF~`m,P VLa5t=A4ڥ+׻m8@.At"n~"Τ3;# u|&Ͳi7 fKocH1<=޼'Yk۝Pc0!-`S}P<]wj*?3}|61Lǒf7ܳٔb1p7ߪ>73< >~hSyd8[b^' f;ܳo~ \^Wǩ) 3[:T$cj+^AZST~ŀUYp;"z?NR`HZ n" !M+ީD^p*ͅ7uQYu8+Yc뜬WD?zjP_H<}/878-ǞLMw^l}}Pos5qree'9u kIG^0 #"A WVr*y'+BǥAЅ_| Nrޫ>.#U:s'9HR&['{~Jݝsac?t4ՃOӣ'W+膵+p7!5a%<^wSyc(hA/DܭM8m碈|UԵộy_&i0'?}O@ }scQ,5Œ:ѨgN7SgAo5݃? ;>pq ^j9[ 7|oMS`nr- i31Kۃ%%~~v|ufl/1$Kt?ữ zvKxmTߎ:#'˪A7~ Mw|pmG^Kwo-qV-+1$b2i~;χ|e{>L''7L oF 6 zIT7D ι-}~7mCߊji=bHo#>$qMv3, +@2~vm6 _Н̵ =$l`jHZ25_srKOD3W|@/IQv!>Qd/+/N*"te4zKEV )wO+|VmE*2ՖO%560oMw9scz}2CNhGSgM~HI]!dfsƛ <%0~Xls+m%{"ypȫ_oհ;xX~St5*le=Qf3>VB<{}[ӄ.W5c0-WHd9/E`N+ vnoiEUؼnHKI\?-blG˟[}@Dߐ@qǜs_(_sՇl ?\љW<{|tXz{>|?T_п?~]|E y%q۰%uf?wɛ@KTWDV/$ՃߠJ~Ϲ,v}BKA'}mEFAZ}s$O',Z&`<[_N/IٕܶDLhY/璏d19/hoj|2!?3:}pP`gmqPR>9讗"exu`n^BOY.>(sԋǜOY |" {(s.( cu8>|co(ltQ߉*ύH ڇ8T3Xԁ`F› 66{&aZ^XsԊ G^dI0vLE{d&U{/pP [uu5ULnEzlܫ|Ht`G~k&T,D5V\ |XdtPOb V@WUkeN^OnwhH=7)e} evI3_Agnč^̓Os*?=)aX@VxBݰ&YG%:2 ?tg8RvBMr䭿y(Dʚg~ޱ:?O=p^DB*k>SaT8* "?9>ġQʯ$ A9~2$&IG gX"l Zc킄y)(_"#_w&b&S$XTb?F_-dSNrd+#"s h^7S'Psrpcg@#Dv9uI:\`2R^ŘR5J,&-5ko`[!Q5a̼;< Q ӆ_6`Qgzd-z Wf@卒J*Pm>M4򳡇o-dwv}䴄c[>3ym׀4ٕGÇU׃|&^\[ \',' aU7%[*Ip⼨@#\$)&'\x1=rRlW:BFБ4V'h! 9!-#&#B>:;Dnlij.('~ 6gr6N36Ӑo{-B?"#W,c b!xtW&"W]!Lq>*k?]2ц ~lo `ǽL,8ۊ?2аZX LK}yc  i$k 6xÞ Ikʷ )e <"+1+=D&4@~Sv%%9-c >*dԷ  <ȷUy /K\􁽢ǗP߷i ^CIpp]G6+O3L-}cOg䌷,p8vsЕy'[z>E靛`7}@[~#tp%hS<95}'x9b!c_9ݑNyr3;?,興u I ZCnxjAA0|دMmNp{x| qHޏV-H^AW(`Cw.Yt%!!t0v <%?=DO߭c6\u!FTa%oϬ6aN~hL}p%,'?< SYkM-D<Œ6WO*t,{B U*UQ3HjIUUA@\ !aӧ?8?H ߓgʎ{Rp\9%+?m.y+#.э_{B@~SOo P7VDhX7/?|@q,%T2^$0_\M$3iN-&z_~Mm-Ryw<}{ucjR #_*Йxx~j|)=DxT2i4_?|0oBGe\*؄:_(c$t߫DbReV{/b4ӂpB?R jaЬcFZͮ!Fd.7&pZfRn Щ%oŦ8n 0%fsl|q#>KCdO<.|Aht;6䏱ít<ĩ\w4OI{g#"/4 Y' g~z\؟{"2}_$=eac3!Ob{6Οa6Z6WSYȷ|R!o{ʲ޻ultTډgUyC|:mɟ߶g@>v8Z'Җ&~\ssR||~}VVr7ROȣ|)΁1 OwVJK:zNܩ: 7:Gs:覇42?\g}h:E׉S|X!>7 8&G:Hn#.v6d&G Kb%閽 :Rq=WayrJJ{#~srJPzX >$і:Z(JF')>3RV'HG9F7߂<_# D/OX0*@.Z[~lTg71'"?jNt2lg_Xʷc$ä1y6òi}d299vqGsQv|Qeΰd=qP<<8 \Os2Afkư@P h1x hV/T&=aSwme'9u Z6NZ IC=G~,0lio|48|s3wS~\HSP_[D:gpwXogYg)Mz)[}72"gI<7k"MI!|d̻Wbsa&=oi:4OvB0wP{67.l:f4$=ay>ۂNp Oo$,m>b!^r&=xgRh] ԷL X_8;|ɞ~IO^_rHKmV^p_*7xu'`cgcs?i#{7(aJ/M[T|Q,mjF]Y٦zЏ?O`sˋ|lVƞsmE N 3qשWJ^kio &ҽu]'?_ك.> ჿFN4w 'g@ӥ'jΚn+O3qc^"礬| J5<9ݾ#(y~ƙܲ[yoB=7T0.Qrlٖ?7iv<8Igƅшo+ٳg*y$5X)M~bCd fyI*G{VVCkWO 8z-ND1UCW C-zQ9&_r ͂ϳL*ŢR m*j" J,ڂO_9CĢ޺n=:eȀ3flO{-cVyWF8q/6M|ȟitx_ Ude<# ~gf/@}wjyً|yp Q٢d?6]җsBǠUܜqFکd&8\804@>$cHxmee9 "_l5U@{Ncf6Q#P`Cb.#j({Ǜ>t臔x2difUmՙT VƲnlUg|_E /.K],:|(Ia'*0Q6CG6kŸαe ٣_u{o;(MJZVje"?SeJ|+L_v* qn;5 U?825 {W ^ YL|0YOp=E%aLwՔZոQoB顦{SFA>Ln$h$6"ghBs:N]D&7~b1UzkY_X*ک{(M4 WsWj*\Prûrcge'pp8N6'wWFN^X N=^ ~uNǻq=u]cλ5߯5\p⡌qʏ+*4M!?kP{Hx}DZqb/x6gfBHf IX W>j3U`Uqk6tEH+0t>gg Tq̚Q@!3x3֒VC'?Jɸz Yʹ|gax<FBAdBn}L>/ E"x`2l't\ծ:+{N~\uO#>u4PPZ糬Q׫ 8( C{ の_\10?6xx"yjW׼ #*ϏE@MȪ 惤>OJzMAǩ[3Yf >jh}7=4;.F>iPz}SȧYHMj_x7<[p|qѡR ωx8`?'fz;`MUs f `)/y؟{()+Ξ:0^ T^1^HYg#)֋5?w&$mC} ?]i܁o*}/v'_`%N" }:{UkdCTM?+R~.F䪢RBSgu~k%2MI]DHaT MN^ISW\w<{O?#?ȇRZ_\eq_@'*WAՑt<(1< Xχs.(?x#ݎErMU:VFLhKG~lĶ@_UJ㰸((r\|U%_w^i9p,I}[~Z:!Īx@ȟO>h%Eǡcg~~ V9}r99w,'3\sde%L3Z*BV*FEHDBєu^U[v,IF2uN`*@S28hbCIPk,σ=#D#0l;F>T#[RAM#kh )Y2 h$+)"|0USKW[B&ڕJ*j![0|/Z%ғ) W^'dbi SErv@ |++ z F}@ŋw'? ҐcR`ׁey)ٳ7FFFm3@`&S!U2z5\pכq7Jz*t?zR`( t}O1Q02~fC)?|dˇ{+6L9kይj'΀qt2_^[NžWncQ\". LJI.]]I$/o\isph27.^c12 pp| >6mWwrp5045xq IQs1f6R}ܴ.Z6]yrlɠo&fZ2+V+ږ|R3nF ̅-b R}tCI1σ¤b!7|hwB)bWKIzFs@=ɓïWntΧoh f Py(.nN{yB' {KŚu G7SF77aa:^lScs]}/|[/`iusz!K8 ]sNg̈́}-`ԓ>rQ Yvd浐o:悾>aZ b꿲|2O8,dhQLm$,v~1z\MgHq~;|Q=;u{+t ͙э6B~QIY Կu3 }hN}E];Zz¶I1p a2].ܩQy; CY<)=&-)P\vWʎN-}%U?qjR>)YɜxJOd'Jl?,qVr?T e7JJ~{d_=絟U9Pw+x~)oLJ B>T{fw,rO EY*hUoYTc;`VBX&k>P4swÚ7DU?_&+?ʂMgnJD~=Ku ա&W O{iBMJ@Wސm,e\-(׉olSS"#XOv?Ȓ}XXBD>ZN]'ȆWr|t#(}|gaj>i_Gnrx53~u>Oڛ9 })|/P! Rz.ghir77ٰa~ "_hll£p•t*!7'jΚ׵Z2;u7|;BI{' Ӳ%wX)y<}nIꪴl2qZq~ HY]F:TѶvjS3L>/LTϹ]oEBq!$ңU. 1Ym`)Jk lWѳ4>R =K5%WΦS5m0V88LsKKC< jt9&:ˏ+.?Uөt>MyY~z>]]}-}y m?Zȷo7 ԶwJ[~"霱 0R^D1 +|ڎ$Η= ٠U Q0Q"$̳U(o27ޅȟD+ Qbfoѯz I>U}Y:^Z-~j67Vx)!_|iw\{Q9ɤE -IW^y)<+5K%֌]sʎkDQ7ObR/JǺte\ηgnke>@+M_>\T3H֗1ܹ+w F>aAR>"#U@77VA^RͶѭxLht^WhS+ ) \4v+DK-)Ocb! }w//ӄ&hH/CkDzȷ +sGSsmPn;G='d 4xJd;#>ir>.9^]f68vΈT.Z%%)ㅑt geh/3|spBmpeuA1aDQ8r-k`RЛ$lhrR*SϑE 4,QPvL I ]䧰_?s(Q!|_7zcC/%SzZ%K{=f5IoJ!ז'JjQDž؄-?{}Qbnf6 v{ z!-搏̖ȶ{6=oX5LrGcst93L9O3/knbO x#,A6lf3X JXe $$j՛$6ۉ[#JU]RO3D3WX57 1܂FU(P oԆ3#Hvn h v;H!6ȗAnBU3Qf*q#1B>ϮtW.x:ʺCùznCR(1*, VlwB m8!_xwWKw-@X|SWXS/Z9"Kl(}*̴'bgY#KGLXOu!u˟"^3ԒQ@m"!}c3ӭ##Ws h?Y!$ m`ŏ٥. hB{ё~x*:m鲭i^ c;iOxkڐHCވTtט]e1Az,~YgPSh!aϠ{.Rsӄ|i0d4Te\(ԣiL"sZc9_YRWQf{SP=H٤{}L/iOJIt'u?w?zg>K=p󴛉O~aKi5sC- zOs-kLȇljKv>UQg.6M*]WVKȈ{}~Y?6K*BoLxĎ|E^(}( HԖ?8*d |-璮˩ t⋔?\EP 8H[]MߊM]p޽n1oWw-c~i ^P;˳{eCr:\3ӛz % co"Sk] N",Vnk)lfs ]|^3uwʒy@Y{@$֬i֧mZ {R|{ݜҎ\)euW[|_bQ 9Drc0M?ˑ0Zh ą;  Qb{O,;x:о?R}ܲPo'n'o;s?K}7mRw1G ֏)  "K pC<{g ,a4FH<}%;.0/I]_ x_'[ 2!a9)_yGe^qncvuר8-]7u&zz35hct`#Ui3%vu_}R8ҾO y⌭C>?NjZ-*saf-Ycxԗ@>˰ (H?hb:`}#_g:rȿ˿dd/,^?csl7LPjTb(jDY 2CB~L(C>T3La@>tȇ;)YưL ZhS%bBC< ~[|E,y! dfRNC`^jf(o%/{Drb ,}@`dLWKM] G6WNXn)@|]_E7n|M |yՇVgeP"0|/ ]O$oerp/f>7A&&{mH|#H@yYB\oaMSe |SviVgN >_{oBr~iC0Vo.f0%"rNO g]]ϖOQ;8>Nh+1L{V\>O9k\E.LE}%$päy/|q}T !\p0DԈ#KTyB |&=SMk}m12L80=C?$c[,Vm*om<`9u!^iM8#q\Dȼ}Fv8 u :J g<φIJ,~XG̹<_37Q\!,KAe=\ A=KA*v}e1~mܘrW .>c"T [:mcpd  6|2Mv5VnuAM= EY!w<:зg_8}crdJ[dPrgf{Xa\HW}CíC'+k;.,|Gy6T:mCןeW~3~591>hq Wԃ% .j< d= AD̥^%X9n؟ W 4Z6k#8>ɱJ >"sX2RQ 7b;BAX/4O \Xk 0<33zǠ<(QN<ooq߃cEh0zEY‹b#JE]Ԅ{HDҴ85p@~mb}Ww %8[Ĵ:҉@'?g#i8gmZQyͧ:`'kSNԏ _t+4~Rأ[i5B_u* ;.К&` ۃ\@x_D/aCvJ+b_#|||)JSڰqkSVH5Ѷmg㝑0wy6T8NZF@wAso[rjf` >Ӄs=3D$![^];Չ /ڮKg5>;|{o)!b?"$/S|o0WiFBv<{JW(4>`I s.@>@_eJnЋ ʹ*o<1M8a%ieIhíTpwFOcǎMOOsLlH'+I?oiU]%>|xf[B8U:{kCueFN$&-!J/j|o:xƴIN"op8swr fFX2.WYJ'k_NCVgfI֫_KƊeEgBKiI*>M^ְiQ XN{ MFS7pUuk5E2w a`P-˫>V*{t3%i9?u\ TuK%f 8}:FP98Vs@g)?3݈-m X sGmd^Xu|wCUHus y'R>y!OrQmmeuUU5g #*pjqTJH3t lxH e㥕jؽꊧH폷S[õ=R{!/ oE7 qqqmmo$㴙1?=5XkkVUUQ9 {SJr>+{zE',&`HmX>_>zV[o0^4D~_Ҵ2x@j`_^u?~=T!yj@J#h0N@>F9w*ܮޭ|5oYi?uẃ#ݍ{ H3 [|(?)"7꾇8G/~@>J@B5jKǠ GoA^za\=(ψVjVW b?#7. oz꒝wЂ=Tl!OC?嚰;F G6eZUV#ҮC=q@d Zވ`}z >$rJHZ d8BX ݵ'O!>C`/Hl'<^` s\ V$FQe%{T&$M}RLo@NFR L1_/Փd@cT ~B t_~C~t2o/kDS5Aq+p <:;ֶmqO`pOP{ =\)Dȇں vs_cl4ބ`]x1:owk 4rvNLGQ|_Ft+ro =zMRͼԩ~wT5bB-#8[.zΑ6ke{:ec'+bF/YCZ ?--mvv\(ԣic)CgNkvL8G+K XrwsJa>'o>#Oбi`-` Wۇv[V?57UN<cȷv ~~TW@p8Tkϰ~}q>]ΉAT3Gc.Tu\r z I\Hy/fn}kpػl2p0 ])OEU]P<^DSk#?q<~1u;7: 07Q{\@}J|=WwA*_)O®qwxZsJzjk_~}pS{{Fv7ϻE_=9||(53ϟ'+2F!?Y/ɧ 愗6e=/9ʭQoB$̉8"͕yxKRS>_áx֜EJseW_~x^P. @dAn錫Xc4%R(.q1m`*xRԥ%Ő@וrT( rǣ_1c _!3SoW6/>~v$g-@+FᾊL*;mvikms|t aV:9h:ZbOx$]rI镧|,!=OTK;Y2w'AÂCG[=j BŇVىn֥{vT,BpRr-?k#Z8F[4V%AU:r-HF[6u=69n⥒]T/jw{K)Mwk8SG.ǒ{tw9'(eQe yP/z<*Ch<60L|*W+kb(yvi-3?33=3VF{܊#]Ha'zP}=. aK^fVi[ŚG /ix=~ո=`vLQ3j||iuXvG@Hm##2(pcgAsеѥrdbR%ҳY`U^ $i`?dV*=Vhu4/yza)B>>qO}O{6iHNئ'Ieׁ؃%ޒOH ,*o*UCkjK~zlWF{gvvnͦYȱNG}ߨQ,*k5Q2FhEZ\_cjH]ÎpXޘp u|^_K,ql򇯥g*k@y QLzX|QQ2gZY9E!~UXƁ@[a* d01_ :(ėoʆ!5|}]?fK{bi!?Êz!QzcΏ xlcpQ818c?JҺ؂6a;6>3.ÀI-"`νX!JHr*C̮[\h~[ Pc4YO_CX+Q8 iS|j ~Yn rSUAUۥyY%I| MlװI a ;'oi4 f $jFcvr|޼;?طg y $nQ?xgS|ҡ?; ** &m:~{@~\sO  O1%qx e̿ c㛟/e? ˫~5i &k++x_=h y|w|_*|zC蹐Ha0|_;4y`$&\iB=Mˊ8Hہh q+9!_?k6C8N+8z6$N\)>iԯ.~@($}zHlZ4qہnȟE(;a;B׎u<p@YTdec1 }ǏlϯMꮎɱ“Hۃ ($]%I|X?@]IQpAm)#(d .kHݭKh_5aV; T|Z{3x %*ooe1߷y;K*}o >5;V吿:vk&xٝ:Zq𽇯Zi&XFKødbpJSOA cA&Z鲫Ʉ8Zg)D/uW&'4E7&'L$||VȀ[P~_JL'e>.,Zҟ䙒vGy蕋~j|veϤ? >n/*=;53EU߄4<޶̼ zIo#֓e* :[Nڅ.b_yQűy ')ዂ*b?ăMXi7_XAOtgWc- ?|vqQT_2N_~t6:b wF | Ln=}`<1?oY%5H ]=)Ыo9@gWA8bqC~ O̎W@C?V*S e87PEb zEh JA ! gCܯA.T.-_W<$T:HqZiMUpGְ2Xe?! UbK$nԝmЋ8 ݍ@:/F#jփ ݁3RϏx7+%R,cr{es :kY"[XvowTcUD.hۛw! OO-.8W_"zb5 'My\ h}Wu ?g/8t4'B)߃r=e=,adP8d2mԥ]`p`)׳TS}Lpab %KH9:됯K#kia[)+dnBMdt(:qȐE1+We}[GSw~PW&!@c2(h/kDez &@Mgəc_[ҿ7j^9;[_/RN}AəzoG>57Sy: O4]}awr٣ 'Ľ#'^?}XYy>H-Q9eWC~+Wm[,@ P,p7֧Fx.IXVH{g[>(hȇF8ÊE}O|6 =u6GrSdhḄPİX7.TQ-VQ D4Ol!A|AQoS@~:| ۉ?)X"$Wm||(53'ϢJ28q9u\}vH;BfE %GMW؇l]׬3dpCԈ;^[4`siPHS*^ /T$|R B5jtpUQ&aW|Q@x%$/D9524heeyeEp#R:t<9NkѬ2`r,WP30 fb 0SmJ̏Q9ITDΜgK.9*o*;~5֭}/F{ʛ+niqyR_w=1"fiMnT!3U+ #p;9PiRJQDo%D\Q&돣-BZpe!C?=ʴ G!RH:tRTR3>>Z{W$~jDK԰xpz&&z]h``Э ~"O!{au!_mkZD?N*OK9I8G ?rHAU~c8ϩ*#vd|1PPš?FNfVW3׿Lg 6ޛϣ&vЎ>c7w;ѺHB->jC L@qj^ qp7rۤ08zJP=8Oa/pyxA(?G CcFJc?VΛHH^0F=Ύ1ũb*=* _dWQ{9)JK, exwBy5@~SnǛ`]S:& =F " r͍糌 ig]^|mj1osAڤiH[)2%T_Ĝazoo5:Wool=?ԙj4/6Mj5h|N{Rv& QTR$):0} .=BqH;<¼G뫜㖖W| Jho'y۠щr 7%naZj=Q`;,L"9t]~ۃ;V۝T1Φǖ!F;TֲCz4 W+C馽l0>{> 骰HBD"9`Je$?"ӌڕuxwtM :CțR?KP_B ~͈;͏ݏ஀%ų 2 p@DH!/=.VPpwVc*6rmOK"]al}YO@0Hi=+]gWaM#.8e CH$pwN^[NxFNh>@o^C=ś~2 w<&]3ICA`}W?6MD|` Zu5DbuXNAǝVuC.0Ɔzly=.!?F`GܱVWWTUQ9 `;\B3aSBio%SbDhW|MYI.XUN(gFQ!ӍԘYVb0b:4׾! c@``ܺV 仸|*ݯwν[w{|KtG$5eu5ZC^!VY0)rs'ކ ]{?lkk<S8^en^"*E(9lPs/E"f!#B{ QX=g> :G ?(<| zk7>3ړ 6kJ|)">Vbǐ_EvkkwqR'\U|hYkˋ#c>gef||aeM^ ?5 nڰbĄ8R byz ¾AytZ}@YᯠFە|gIZu ZT8 T9~Q8?<U|6rigwz4\:qo(]<|{o)!ufΗ3鱒4E0ѻo6W{9obPZ{ZH1tbLCbU=1]Of{9z[ GyXǧ*z#QlV X^|իI1M/@>+>|Ky|'5OMNNM&./t^29~BUѓ6㣣#ÿ:C/zm}om}ϜxMWFQaZ7j=Ho@u9gyC~µ,c)bKή_ZqzŦw/7/I  JAg=\cÄ*R>'+|\^JQ&$|ϣ2 hc|V &| b˟mՀr5%JwT9p0">iр|lA~ݘY< F$ӬA=7ع_!_9u}"m!Y Ϭ(jy;YF/tZng>?$^>/[,6 Xڕf~^,wd~bArjkcӲ˵0Y@~U?C|ֈjuɵ03BǿYr#):wCv@Q>e>H|NĹqb7o.'[..zUN?]U5dԣTH(-=v<_m^ezzO ]D)?cb?'@W;w$S.,y'{ ܴ8lv١L,kC> ePq-r=Ж_ֈ e|s?>mW:˜%z1_WSMC4VxJmtZI/8z@!ʖBZ%1>G6a Ac)T e<rT~P#uKTaIBR=SE۹Z=#')w);; xB]ٮ/PDȧ YbSW)ԇR~&P/ \~nWa9vW;D LqOd%QO@A~:| ۉ?)X"$WaG_Ki !]Nz^zK^상>#Kk~HOO:e?bKH8|w`q}'!>atAy+W">(>|'D#lP1fPu(r9mP ۔\p|H^+9 S;Dc_~vNz_rO{y?=Zsz2ȧP_; ̀=%O8{\Ì$'/wܓ&vc=pϸa ԳsLQ{sX),p#z(=A3EOY`ދ!Hsdeذ{Dj>Oe7 X9D˩UυWO% Kz!w5#m`@>e''iEVC:=ƾ6G A)1_lΖ+ Ct G eKH뒟5M%YmBRNuo`*m#}#ɉFX#?ME|~ڍ:ʰ2@tLNBG fP<!|WV9%JQbIO: _Vgo,N5"FZ;PvmC9I HCLnֲC;ry40 \FL}VXz>( Gؽ[J~kqQngs nf,{v l"lB>sd0#7.뼝uibiɺ[-VQ{){+=l=33rv]/-"NGjD5ytȏ5D,mxdE3D0#b|_Q?I(ϳvv0վE&HDޫ(l?&dimA!_ےg +[U:o~&Hٙ!~:0Tu~u0#b|WR\b).))XnMmWwsַ5)Z®]EcTmeayO?uN+K~ݺ21Ց4W5Jy9H%}ZҳAl?cI3xuȏ5ĐV=. e f,,"n|?>7PAvWlaMJ0 0YF0a~9O__/*# aL W}^xP`>IAZ<BS A̰o\ޑ1S.?ηgb[!CA!?J¯W2B.?B3b#eLG=x Kh_Fye{goG\|悎&&{-",d: A~>UQ;f1>hds5q7&ayJLw8r?iQAQ{ ?߯CFcbGuGoQ~}:a/6A5OrZ{>~VqǷ3 Svvejr`mY .[xY`RG:01F݃Br{lj?@F,z|H0_ynT:8]/qa7[AqļvcPSv\"r=}]v^$[=KtȏIOxȤ8)f+3|/㰁|qF[Yd<Sb4,q{W-2#5?{K:Mä1#O!LM1!l*$kmq ~j [# *jkjBZͅ{_qy<+@~Lg8{fI9\{fZrVBd:N` KFn]P|pT8mL@2HÓ6˙J1֏#vs8tQݘM)~XW{oOwC\~ hkD#ϯCGQEVP?KQNs衰C:`v>RU[[Q8 znJn .F' 9#%0!%r?U&zJ8s1`xeWZsO-U3rF*&l u{PbB+mC_W|-npߔW4glzz{'y{^8ƯD9 04ys|\d@ME&{̇y@n0 㽅\WʁHQ?[ iwGb?iGTGǂ+ ܥYncĈ+y^.n-ah/=\p%Xÿ9 v&7ؼcNAT0LPwWG?u[4 f6 |\ `-|08j]Y,~o*,%n`6n\KRÅCI~9M5~#7%>~w /ab$CE"|""}/RsAfFh_QU|Ѣ |x$ȵd@5ק=O]mmmMX@:#؃Gwn-S-7(A =v^QFk.'H30-B)_]]/O=0e ,$G f}y.Z:A N[ZA֩C^x yQJW:͊)[Zy! ;#?8uM͂ Ш5)#K.X-XkA~#V/5p+ ?uN\8m8wf_J+guȗAI5aJckGPѐʼnwU UUT'y?9քa6cTW4d Zmv-X4]VuFpc$CBE;xOH=ӹ }nWm`_m7 hzZһj~eoJZI [oIZic0Xǐ([-?/k!]}a Jj>_,֖V @>.Q9.hh &QPO"@qW/+1KĠC ,9PXq5*_T]w"N%0I&pkE#u-S/Ƞ sbJŔHxTb͐/Q %+`=3`7Ksz}=jB##%O wmr[t54wܥ鱯龇C`J*5&7=uk* MG`0.ڡW#f0YQ@Oa^a@.nϞ0BDEvz/hvz| ~a%}A8x/\ bB,ΝNmm?;pP\KҰSȒ>%uΉсСj)e|5Vխ]6^3b/zz!Ӛʒ'0rS|IDuSc1ﲋŠXӓ |Q[ߴk w'@Uؿ '[!"*wdG$lw(h ' 2O~a&SyhbbNg )k>Pm,؏л֡ቑ#o\Ia*ʮ.[V#U' -GZ B J Y;=jI~H|,Ыj`QikzXR{)6,uZR>f :䫦9{p%@;`/-lHR3Ha+"4Y˘%&RnbCIOo (ٛp~,HV#(U<?Q/d3x^ jZ}5iSlm zz(  _8!h@u:Cz}ǩā |3>N#}OY+N͗SAvIAj݀_}4rPMe|yn|AC7^`< [~Ȋ3-B5ĕ#Y MZ|F;jpm-^7 圏sZ(]ڝ/wAw?% u"3y~rZ=!]Q u2ۼݐTo/Wւ|$l:ǘό̼=|,qvy4B`crHszӛRW5~?sR=Dů~_s xnO G{<?qZuԃ]> ^Ybe].+l+UB׳xdWcsSG*:E"触4LGkh௅ʃ{519OdHuOJ_]E$%}˜!{C[萯'=;dCJgMgjU9lsP-ʣj.J8t<`ϋ Pa WYՏ -gk~FW~׊VczH?'=NA>;ӜY® ?R(oD֎'!FbF;\LhQoMΌ]G9K; !_Oz!/uV!S.}|FuxG%UƾUsc5.祦 ў!_Oz!_ #Ipִ޲D(GyQbHXw[Evd^mɯxB:ofz7iל˽E N7d]sx֍Op\RgBT[iL,[xW#ЕO!}y;ǛM-Bo{ \S.׼ SQ*?SyDXC.x8!΀e!D>R]dY8Sی!_'Sܗ~cV*Vn5$I[ וJy9~D?G! z07>|1[;sh0( ꦚis8W8\ M#Qg:;#@½0]?Kzd| ^:p鐯k陇Z'm̖!?`OPm+)I'j'g(B#I$I=DzB+ 3@P}[R7:=Z>+P{W*بvC!c9cBުCB0_x!'1_Nk)M,XJK,ZPݨ3[XDHR)I*7ۆΡ&k]]KM:!dfRRDVD*$J'I%~ENt!E|^ GT 5} L`#QBU|xZY|ڊiq>ɐV5.\A1$Džwq\; xqFP<;>>5GJ YJ-,̎PMC~/,l3|415z gnYp!F%7]|FۥC''qzz1Zs}SR3oxp ff&]3ř٧a#BGY55gQg@U #C~Ý?=O%_ Z²@\' &繝[^ %&64s5hg25+ J o ƈf툙Wttϭ-MBOWC/qӨ؊\<)vslZVfW;5i~ɠA>Yl5†1" " 8aWp(BlyW|r?nيOMe H4Jé|1q@A̺Ah27^_R>ڗqVwVӐ!x|L\m '! DSGja$$A吁 Gy<nWJs{Ů&CܓiPպıc?}θ-1EQ,6/Fy :K-yx?s|bp!!>)7M4Bs(E VgJX}I{?L2"׵?? #vVD\a T*!Nm`p!0C!G XaȆ8}18`v?&LuWXc(l3X/7aX3\o-=}VtaYҮg~ dY}gR-XfygC|\ |0[VPIS[N1ߔ׬G{?QB]tyC})j_N;|ӧO{:3%xXR #~ygA L:}s ҍjl aPstBRZ[7뱈=/}.W: AY=>UAc= Z3~~ v\2Q%#Uu2'pZMzg>!x*=}|pw7%&ˈO%.jjk9&TeE4ڟel!Rb+aoB3ZЮSO5'8ӎXCTLK.1=H>Nh+Oب@ /q O::6(d^S0εQS'[޲wO~2ޖ$$-?.yw[hp ,ߖ C8Ã6Zg&D/i7c_/w5O/ 7~<Ұ!Z !i>|Z+7Ø AC6rdH#v 6+y?%:|_|\qmTڵmf2?yunIk.p|1!DW'1gXFt? ~P U n:YꅜW%j$ 8Q⸴֖`>|;PSؗB>Z$Ëi pQ~ރrLƲ$ X".Q~j~^H&K@) +`c#Ur.xsVȢx澇NTcZ9DMÆa:2J>nv<>aqN{"XPSn0ǿZ@JT`U1xiMa/qv Ъz8HmFanj@>;H _4 ul4 x`+9 "QIim~|/?;.B>eJ瓈T>)|e_>}m+?3]lvnDI URCyvTrl%NlPa'{ b>wvbĮ6Xyj2 |k../' Kl {N5\1l&$lX絳ɟ}?PqKr)JMܦ i:"ޝ_9% &̱*Xt䛒0^χY͚ = $h {|̞2Ɠ~ 4?o[T]?ٻZCןҐZ]U SӁ9@qwB9CF _~ eYᎵ^UUQ9 DNUFG@!ώU==vCҼMAl`19 NS?-}wl נEuO;ڸ3KJAMUkh_87oZkq|cl O,F=@?_䓭ÅcrO6\[lԧ HY,Ow,-Gp,;Iۅjh=l—GLcn_'' < &C`)ūv2[s3Wv{> iXr)OCO|*@>I+UtdC  7^ D.t&h\aA>Fm9u.~ʂo3C5Éϯ` izu.=w6~F469t\F6iBLXNi6m.}%\_o,7O=Qro5//:7CUvywl6ݘ &@01Jm]2S)$*2NsO޼{=Ƈ۷<¨_uY`AE}  y. cl0,;P|;;vڹbq-/o;7ZǾt?[~w).l-M =E$甍R¯ C;&=/ܿn`"WI=j%u,pܯ>zO@"Z!g Pϙ_ķ@x_>f Һ 4co%AN3_HUR56>Mƶ} C3oY zn}q[hX.`FەfާW]bI<&:R36?NO5])d-DLsCN I(|^-g'غ@WF c+IT+N GwK Am$'fX3_n9mQߚ(Z- t(Ŵ*r`WBm@ō/Z>{~ >T-Tw4y%PA@Ҩ]?G -xk?Q؜Nȹ>u]ʩyjڍpS8/&%! G2 ZCa`;cjoL0!ߊ0w.8]iY7qBAv*,,߾LG1mդdV>tڡVFڶێi0#t[#3Rgkf ٕĪ3o4dD8BZ)mT[ nNǾr].WϊfhzO+q9nɹEU Bi)/AȕjvK KV4|cWCJ*1 S3-jKɌaV +ZFڪdWIO mI DS^ڪjZƇcT3]˪I(JPTj[Va>QFXU4{|^[kkr~ Y|KK6\N__xm;m:NZ?p13^:IwnpL{*lQ` [/?6aM2c4!hwOH+rv2i7w[ 2}͙NہV`݊Y@a"Y:.;`ܚYc-% o,AMs}܍эgc74+WǷ7 $31;Zq 8ظ<):}AZKC*Ύ3ȷl _l~Hs_cvOh"Đ8LCb =S5+4l0Q:X:[b-O6~j|; >s ]Z?F?cct<[-K=~>ڈ-uZ K37X|~VV;VAȝÚI|.ǧُ=CBTڭ\7Λծ% fGq 2|`s6”!&m {Xm)>UJ+E,yGaQzFI2bg߁:Ya M"RAәva< >z|_[h6fAf S|Piȗ&lښ''|>((|/DGMaf<6Fp iNpc9_8/7ˇŊ"r2SLkYNPeg-x:.-c˯c>9P^9-?Kfk)Ys}Px~Z8׿f@b%|,|:loN;Ƶ71tڍFt%%|<O6 r3DPV> JһŅqUnyqJa܌h0,,1>,!.ylE>}|L?BBB"##xt{!̫W_p3[:w(/kW~Nx/}w]ׂS'ڝss @yl˧W/~nSouݠhr>qH/C._Ax:޻z^hq2o[j7 Kk!d!>~3)oo= '>N_ҝ|Dzka&&>r q_Sr2b˛O~qW~DXxh')}ih4oMePH|\6R@2#nH<9(@.(Gy`Q-_H+RY ȟlH@ItƍqvY4CZP3u/>-U _乷etTZ~)j35i fL?PfnlާkԪ=#0Tý=ZEJmϾ)']GG2ZiB:ڗZr2Nö!k' qg|p:0sTp<3g頖|= :^9Y?O>V hAea|?~`c?ɓY9CIQ~qB`,k^)9 N?ʳo7GƎغcwVi&Se9VoL9S1vTuhbf'nM)[q8VP9o7!e>." v.BSUhAEiu7p:7Kܠ"g;Kߒm;^ ΟY}k=$DCFkTYx=$ϙrjQ°XM~7[__]~훒2DmҶE-cM~CM*:Qα$㸛8a|-:~`k28*W>LT&~8 e9qJrf*\%:Qv(<;x]# !'1/瑧AM`vCH"$V:]"O< ESp[b2,+Ωn4̛WLGށw:8YrC Oߢ05f~^iVase43Ge-3/;^OI L=jA>kj*Iz}!+9jr^,/ҳZo.y!ߌ!q=8 紙=q0/N:;sRQ“ʺgtx]ӺZ ǧcpb = }q:6IZYB6{9lɯԦ{Ƞܸ;(&qɿY_=Ce߲SaUUiAJM pqlӠY gJLLkq\'E8]|+s$WÄcE|f!?w|H[Y`=7jlmhֲw5]PܻdXGB~2~ӊrȯD섃 %b`z/w)tgukQna̲/1} (I.5гu,*%`BA?[LtTMVNs;R;q_&ݛM|@Vy!vd(NY7>1^ aj,c&nB˙q\3GqՏ ||} }W^Zh JE h3ZQ4t(;1cH$r0-ƭany]y_ rSonrq_|doQxB#kR^$%$TyMA07-16u -a-ȃ*5_ţE~nw nLNv#uRmv3Vk/n)pwYXa /Ili -~JEU97 imW3IpIo3sL= o|P6RZ !ܸfo,nu:I@OQ[78o]RC~s!gɖn\e*k$;ٝH!~`5yGo 0 ߁Ny$#ykW !]bP"/0vA5oRP^ΗG|[II⽯r7E/Da%} da`'W)֧(&z>w}igNhaXLթucܥmo_^~_QiU௴L'dڲB!%hAGkkk;% ,eV] xBqixybb= Oςai_CC %̿?kZz0?$ƫ=$E9Mʋ9-(yPju|A<45դ:zQϥ=uCnq4ezZ}U_>A s&xPZָI ?C>PI7~~"0EB-a /ň5ca =QhwkW&],m=?dBlyї/Rq]Urde#$D:ސ5 gA !@A>h].CZ$i,GS(%T' }6}Yy}}:=g煙}we.^D%!x%O^.%T,yrR,HM \ȸJXAmXޒډj֕ Y_~JδIZ{ݦm$#r=y* O[e,$SiB?7v|#ĕxCjSX-",l8@<%qH@ k+#b@j&Ow &`_"&[aT&lN%O*>ρ|ʙ͵Iն5rPFmR|x 3#7O?r$ø5O4ܗ3߈e"=7N#!߰a.p9C>7Ǐ4rf߰]F7j8'bC@4bd~g_{E%mzt,QB2qB-A0 rYKB LX Z8Q HZ.1sv2+'Ii!+3~Ec9SmLWϴs!Ԑ1꟭iHU5SXCbO~_(P =eUO!QapOUx웱jvK9,6!`|" Y@L>"cMcdt ߗ!iG͉e;I$d20%B4RPp5ڟx"&7 p &xM}!U{YtcYcEwp#a-##m#qXmO7](f- ;E)DuѢ-s*3ًvͯ/3Q(Ӝɤf}rR0,TMQdV>w:w)M2^]z7>?~BlQMF9}J7[0n ) r+%,!D='˧Qn=h~(=!49:5 !YoI6g#>222:::66?@ 8P3:4]t=Qp='WX;@zٿx1U|?LzGjwkkr)Z*S0z|mM4+TZ˲̚ZՆBĿ*jҫBBPi, Ȧ3 jv7rs J}G` lxLK';ei LԇQY#mRc_A=X[Sww7SSSAJ)0-8Oz@4 xS(2F0Ol1JӗyNkeѼU 5/N?63m@c^/MYx|4>q2 Ty^{ytsS(~1/c0(/igz*><;IENDB`flycheck-35.0/doc/images/flycheck-mode-line-menu.png000066400000000000000000001301561500215546300223610ustar00rootroot00000000000000PNG  IHDRih! OiCCPICC ProfileX YgT.9g$,"9De\ """AE$ A$ HRAQ I^ {7Lϳ5OULGDFGSL = 83`<H};;+?!:lOb}| ' E#ix bv*$ c(㭇:"hxb) PڤP_FAQMXh ![R ^a܊C",ipo!n ƽ1f| a,'})FDŽ8*DAPoBpm hM 3E;B9C HtrDc\l f#*đƁfg0!А&_ס88A?Մ#¢ ZCY7F:A932&02ڀf!O1PS|eQލ:0n`mBΘvVaOoAPL P? [gzO8lA¡Nq~ WJ뽱#B;x0,/v Vk[=x*c5Z 37&x?Y“ A侮 ?pp7'13&֭tGP +*~0b`VV`u ˉrXU>VGc??z4QQ7 ?^OOZI\ta`c0u@ӂ`no& {7@(V)N+W h]pÈxjP@`>܅}7 ++*@i:|sX߫ξdP47G|O##|baiL@HA:zX[v@YǁD,p䃓 (2@<x >Y0! d AqDQF4-1b8 #1H"B!'sH%ri@ F"K(%**>j:t'GB֢wt aÉa41[C$a21L5#fcٰX9>ͰXNl$[>¾b8~,n prM\'|vx<'^Mw|0~7ߊAC%Pф4 %B a@"*Mpb xL$N6eӕ5ѽ[gסwG_H_MI-{ dB+ ^3,XI2$C')ttJzFF&%zdr4N%`dcg4geXX8IIi;SSu>f:f fCf sss0 -K!,YX Ƭl6Q6C6lelloY{g9X9T9\8vqqpJpsrfs^\Z~½#c“S+k{wOχ/?/N@PT R@ ``` <¡…³""f"1"DzE7HnpސfKQzQMQ<6Y1!1kD*q:qM@] %$$%%$$_HtvJH=KkJHAededdQYu Sq6o,8,Gӗ{-)o%"_'IALC!GK᧢bbs%V% F2>EʏU*&*{UUʪV}ƦfvPMmU]C^>!Q1ɮiyHN@kV&Mћm-}Q{jfeu6Ptm1]]n=Q=_rI}i`K  7  71l5e;45``Re2kf۴ gfic6l.`c^i>kaǢÒdhy򍕌ժε~a#nnSg lmsm_Ie/㼓Ssg)6&OJW#ccn n{{<\<=oS3sh]o׽p^^V(ʜwqzy~:~&uOL l|&x!6BZkhM1+!5<$#B0bW@ldZM;wR-QHԶhv#s uآq.qw /?`p~7vD}9$y'ݛmir>}!(Kuc@jrUiiԴϤcӃ{3T2NdR*Z9skGfg>?~t(G7˱cֹyyyw/P-8sxBb'X9xIAQM1qF)SNW8ufl٧LՖHKcKߕu<_Y[Uz!XCEGFeEUhUL%K.WUɺ\y5km5WQ|ff-R_;[X7V^?`֨x M"ME9ng776$̵F 3޶y[N{wMwwӹtnj{zn>T{xWO_q`@GF>6͓!硧ÞcO}N= }e$vdy ܋̗/ FGK^ISu7}?LDMM}G~W0)4Y9<4m2~"?,Ϥ}dXIӍz{ff~~YzϷ U͍·//dQص4BX)\^miZZ$JYo _9׺DF.<:^"7 )|iEՏ}S+ϕLfT,b%Hi핒TJ43j7L⥛wU!Hi٨b)fejlm{GN'g[0n<^o\ضxSx|}vP6 !c-agGFԤ G>G4VJMpmG#I}V>~,Kњٓ5t#˙?6;T=QIŅOyp񹑒 2=.]V=P*57nkzV5͕-e'vw:UZ7v;zk  Ƀ=6xLo?חڋɗ9ڣi}x}8ffybm޻Z&&'L+LO>23g7gf}Isy&:W_c1SثdA(G'I/ɰHhÜrmSswA@EpP9 E$$դ̥des7^둟R*(oVPVR/h|fx-JzW >M͍̔--}­w$;`t9%5-h6q;Pڼ}:}op T "4VgGDRwzR\Me [ gG^7SO;-QU%s_Cw=wt!gطټ38|R(T3gߞ{Ut /TmT|Y pZ)_[WT?؈ڴ;ێLu^G8>]dpgG<ahëcn߼o8v;I>~ 9r6 kqsA L xq:>D~<&+%ӄ@:En382#<3VJ\=\:<<+S|ՂBE"yEb)ƒ’?zDɚmC)6*]T.TIVRRǫikih=tJw^gtKn^!0fR~|ɧaǧ #"_*b|75=mh:0t9 ir=vdz 9, œi 3M+3] f@3uF`~`'2"ja7.aD1֘LfKn†aKp8K>F,G O"PbΕnޚ C K&ONM0a;'XYXMXoiղobopspKpL)!tW8_w(^ulPIK)Yi[O%{*h)+*=Tf.QktӠvN-]z#SF9ќ΂dn%bjccng։{Ǥ'6.;(?|4.] iBmVu5a={RRؘyG/ Oj[q6lʳǮi[lPɽRag/N:fGϗZ kKˏWn\X?+֠ '-$P@"bÊ@ A$jRѓh;Ï$bj0Rvn7nߏO`&wttt3&pWnLJzL"ed`8lʲՐ͑%L89e8pyG+bz)|]Ȇ Q1n%JKH˰7 ,JDE)an;w45k}fܬc%H7ZhfhjejijjKB H >Ӣ;EZ#[$-c S+'4:DQ#cb}wJ*K7 1TIx|hHQg_ +On/?u%ʻ+*W9]6i*u =+oNwvݺ@gt 'OF.}9*flMm$:=ޙOL>Ϟrk7o /=_]opj4\e|deyiOO֐5絋WJx $X~][&9kk%kk0x@kshʴ_P̓d^IHiTXtXML:com.adobe.xmp 444 361 N(1IDATxSWdM2qW;I=TS;3 1!8l'$˲1# $d@ jϒx2K^@V^{5``ZF h4``M0&@ h4 ``M0&@ ݠ|zԙ.;쩣gTc|4sq0&+Ms`ʁ<^454^~F~xHZ``;{v&VQ۩{/9z@u}T6G`M0 !`uں:M&|u  J`M00-h-M2\Zu CYt 4V10:1f?rܿl<{^Vy_ Mdo.d?D^xm>x L|Q.·G5X|7?34 mfOfO'_>^2eǔ\ԗQFZ|]R1jrjie%le LOz4רw:͵M= kԻMZI!4ʫ;фgh U2أލ, \;1SOy8As 1أލOdhMLԈȒD/hnQO]^&@sLƃOh4^ih"C}t7k$ߔ{c`8x^VM3l|)WRh1^ghhi:'&㨧˸ BS &;?69Z?4uu{<|<1xUtWh&ÈA=su~+øpb6D4I考&//1z9CA ``j"hqQhM1cǞuCs|GFFt􁵱ktq3Kqtl\J[2;[3⁢Z~>vXm]c2rEG䖢A z~{MФ9Tߺk3Kn;KޱҲY;[OoKc"Ӡ82n4@S60GmuԎ3Cއjr#p,9n)IǣxЍͧV6=CmMDN_zi vá$fq96_&1HsрP+*6 MrVǃ`wISuY!|#Uq> Lnz`xDLE+\5ڵa?WAe6;A:@3?7̻0;}hʺ'K;3N]:n~w:BhLGdx=2OeB؇Q{mh|rLP8 M[7  3.e:s<6N^R -yh. ucd?ׂoxVy@l8騿^/79ASHџIR hpVbdra*iR7=i 4/LpE``Mi#l4sShh&u3#O=@Oƭ^ađto<~{t.2ށ̀z[2XHG&4eIqQ|M[ԄO,,'RuhZrм4`MQOG:4 ol.>WFn!ں.BD{ju5'hrstLG<44`oRuBY͞uahrb$U3ܵxnM2<̐򢷣 ID}\Ȱ)8|F(U$Wry"D'oJ?_-,-2Kqv9 >W^.L$tzo)@h>z0BsM=hg&vحMMM[ȖiD}tQaMf6 )_;?@>M0 MQOš)р 㡉z: k sA)l D}\&By 8@s- >y{E;@3oh.E ФPSu\h`h>Nz=@3oh +)4``; ФM&@s  LkN?Oni1͝ ع_$/sZX`0VGo1no4~3 629i)-)-Z6bZ4ʇu l aF}&mLv'} ".$&(@fSS#"￟L&rYoɴ.7q͞V}POpq9NqS)hN~d</\!?*hp ]_jkonЋ3t7nM'Gp01=qɴT>8|h't[nɥ!nz[рnLSUVV-3O!R3^`4QsR/w E^K|^/H2z\ێ"(J+WH#7L'GbnRp͗ ~kxǣpxt쫩)EkY>v~ũVtnѯ.)Vu>y*Aa,q8Fb7CJ6*y弾C&| 3;$o"Rҫ5>]eyD9"" nռL]EmE& ƫbx^wog62KUZ_]sX^RoI_͡I_sV;Y MȢl&GͥCx6hl2dF$t᭪NdX\%IG~z%}IEdtT8L;Y5уw3*42KgC)OiVYQfh\&4hgMJgF-='WMk1@CVюJ_F>+js F494[[F^׮ v5- ދΉI1VresQ9j<|j]aknMkQt;RD{ כp|55kM2+Фsih/KX5 횟Үjo!7]Fw1fF:]>o[1\˞9h\K!ﵠ)1,m9j f5@%i|@_}Um[>{M7MQ\M,$#^)Ps:(4' ~6Ar\n8cMTIA%qrGWjMjˌI$:lOhLzqNl+zO5MDע3hpOEܜu = &zlaQUME; fNDm Bͯ P:>;4o>GgYi6 M:vk[>{Fy~WAS9p_?Φ;UL2?Hi.|saQ&=~xF_>/=HqK$E'O9:J7 ,m˺SL0%NB~=!AMeOs*?wÒ=пܨ؍f-= ˳m8g)"-l6g7+X؀gn݌(y)9qC'4%D*r~׾I "=~TibKYp]RPTD3&:PMi!zh44)x@* ӫłlR>1fIJj21\HtƧ#v9P)&* !l/ђT@2sp3{k~ݎ[j1M5=z2=B=k]g*n 4wԎ Ma5ߖ얩Yh Ȧb+3c+”dW6A(sjjT qS7"J̮*VmHiA?4_k<`ص +ۓ V@#[S@_#?vH[;S$ִH,z8a@AiGׁ:OeM&@ h4M00&@ h@u[q3o֠mbkM\pu_]h46*C{/hz.+xW;?2kpUA\E*uiqaV4YYy֥!px6L a^ `&}y;=ƣ%[1\8E ͖ئ$9//D/rtrQ\|병ttԔ]|.^${}&I_}+;`7t`8k67W]$ݡʓmU:Ց,,9{% bCrD:{+0&vڃGQ +%ꆧto׭1§܍gGO,Z>{'4@bBA<4"zHvD\ՙp0ŭ K7ym_7wq\XA͢C\Ƹ9jmz~F(B85ua'0~ѭJ58onyF(As/?1읗23܄ x ]UG޲  mSx]Mދo#!l(@S>74s⩍elD/Hޣ޸8'WSM"zMDIAJl4G"N.67/K9Ig حs(L?SS3eD/rZi]݉oí"!#-ie >(T2yĎ}lx5 u^PhMQ┛̓?L,jC/=]u3 xPi^ˀw?4gO4}me ZF|O=֒LLS>?4.(V(xybny&jOq$"EfPqE~`,8cJMU 4ʱ)T)̛,}C// ]߮iJm,462ϞKyf:7dX+:Εu+eoY1뉒f) $J W5 se/?>u0{y]hh3IEonBSU-C I5ԡ_ ۳BS53yF#٠[SD#t;Ċ QIC"Q&#QV&{ZɄE`tч.zwf[Ξ,w@r^Ls>347CGXItRw=ZS*טkfh^ӾBWBـbыx#Qx7 8ogedwa^#Ur; ;mpnUh4_u Um-#9je>A@sfJ /AQe ĵP@SU"~z銷Ş828fDfCS2rzA9֑e:E/VKS{5ZjhP 6ѓ[4ͺ,MV^iD(4=\D/PA?Fx^#*)5`f+|az 0&@ h4^hniml\2f94îs; w? L0=Ƀ59CSp{I&K1 nXKI3|O,Q_|pUxvpWDQ=pd|-_Oſe  oJB[N^ɏa^-&全<823zKVuM00{{{7 00&@S3a~h471# @ ЄpM00΀&φ<*:9'$-}-t1#&@sLxb4ʵ4lD?,D Tj~c0 0S6>5+>$|s-$~÷K/3/ Xiv'I-NśC􆵰*4u"9'+|IQJ11^k"?7f[aIvI 5駶' 2T`ͼܡ'5 " KoLv_E XnzL}>wS'o-6apz+GΊ̟zxmh6o4~Hy1I#/MtVGW?ᝊ Jt୪ntN*wDW4>+ӻÞ6V7t/3&"+46*:@v\,S[.$*Oל|z rjBO[]/V|UxLWSS y<+63GQ=FᬫkAZ!0z}5@hXs/fћo7'\}wZ|ۜK^{ǓU]@nf]Juw39q6쭹pX.GEjcmſFFoOMI:]"b{xf؊id2G}#)n\Sm吐^}7 [p!Q;àĵKW%ć?š:y c?#D*,/Ϻ9-B~ OYI]Q~ QQ;Q+Ya3T͜wd0k;c,%='cvKF4ېA- E刯.̇d fNDs8v z/=GA/}8}F-VW,JkDWQ|VM!*."tydq$W٪: +7 `h4 M1İP&R١)rWтf4wۭ6ud|isQd Mvwl㊫kA,&.JMFBkKbg9R^ZcP҄f4MڗJ6~wPQ27H"D[ީڍ.AŹm@╝%Gtx^QsGMa>hOg!47C*Д4V$zq߼t4'4o*LMZwy:|c2<; Cg0{ 5zcрN a46w*Cd4r1\_:C\1gڤwNΕ]r7lwJMt6{D9a4 ~06h47`a2OYh1Lɲ/fѧbQfͫShd'r`Df T޷A>Szxwu w_7{W4Ha (j#.^M*hAO}3ԙ\UBky d Ym^5)\hf~Ejo r[&wA#F/YDfkns4 RhƥU_#"< hq(U7dGZF pxNc-CϿ@o ,=ք(=&wf4Ab+..ܮhޤ4n7 J j$M,wAEN'ơXz-MJ?09WX.JyjT[!=-Sq rk;I̙P’#>qL;1~T6fVKPY:1'$7L3ކs T@&Re8rN(6W\E7(!jAd`cs{ݎ/= \xlՊibx?H\HMO"{|) @.V@aI!bfSӌmKE/a"O*3U[Io01Xo=*ͭ1g8 |zx0&@i4M0W=j-gM00&ol஽ӕ? ;>.h44/]dU98E}@3  a)'oOj VS1sX'FBx^֓ڢ͉W,*,9zYѡS#^f@sϐ(NI2D_@Dg0 &rochީx`wx /{׹.zWKxi+Мx%|氞**;pw::۟-47 36ymك1C{BL~]>߄c M핢͉Wwxm(*kP47- 7z!6k -TPIyĘIYD7+ҡǙ8y(؃īMfChn4i5htfn vk&zm0LWyk2JD|K6~OL~TSP*FGm_(-椩8f{Oca'*;e4*@%1M"1Qrn<9~Ր̒KA2*lyo\bY~ũVtLȜ6TX(_V|H-!P׋f"m6"hW͡ZAʘ9B08홇O!^ +O {nN7.(:hGQ$ޛLkB"[ofIκB6TX/0̖]4O6`}.͉WvqqMb 斬ӌݿ% +"ޢ4EX?GS=$U4u+*~zȇ2׳}>t4}TXh6 @SSmB[D/;* b "9nI-}hExCS 9 bȨh?\.nO:Ϟg&WFj{[i{Yݨ]zc>sM hYm"sV%KMDNLfR m@(T`9(y{rzF#(I Z0p n~tXlts y-hjMd&hNbI>v:\,I2|Ps/$O DlIf&hN4!ac Sq4Ez*v -R[tMNEo\frRWP.i\PW՗ڼ z XR; *n :MefUɇmh@Ф" bݒT$m "`W\tз'J\ o%G*jJňuMP6N.jfro2s(-\͑ ~[[MC V%G|[@eT< yH &ύFVD,"ؐ%aǦMXB4 7R_6=sW cޘ9,G/K Мh4!5@ h4M00&@ h4M&@ h4M00&@ | LkN?ON({u'n:<1qp]'4![U!{K!V1|r_`:6.@M-р l?$xu~̊n mz ? yuMsd޿x]NC .eV[:yp]sJhRp+nɻ/}`6:=Ӽ=5  ͆&UyC8S3OG{1E)Nþ̦3]OWӁQ?az u.FVr:u=#mM\u ܦm#}"C6? NOOS= MzL|$ÃMVT`rSSN;BQzбa2vQS]}W`pf-L~844:Tw :4>H>&dNxi\iz44:-p[Dx]ܞpr?#:7 EY$q[NZ&2r&/֪t?x?z3w[:&h]MϏȬ|n[irlIYs([%-}$sЀ5'bz9BSkcnOӷ=OXGӟ9dZs}[S,~6.꡿}&ű31M\ :bLlaP7%)cř^ɸ3؏{ 5qbAW5*z |Η'6ݚKof?2C%;H}zIw뺬T9/ =H`,u< kȚY2@{ӉO8D2H$S>OJD" ֻ#(M$w(HD%[{KqnO<=SJRMIJS~r&kaPB+!NsP2M,2"H溩!$^2x1%׻ Gױ ܊dj.%AV(?ZC#N洿]z 0lw1;Pw'.Ly:::m ͅ=GDZ z Є| h4M00&@ hnr34 |Y,1Ť^&JjnY |.]g\c;?&%,PؔlNO#߇s$ *]xEb-쨳8AsyaK{M8ڳtCF21a݌0,4ABJvy3_jД]@3%VPelm*Vz͎$I]ḭ0X@>'nMu@vLrrI&ضX]}>+a2}XCA[OB͸˷@jBC4[kp+jЋ^ /W7;͟%\U]l;Di&Lxz[~©]NUCY Tik=#Ov btHl]\~bچs+}gXI36]65 "T sxH4(φ2ۯ\f&\a"y3wRaΒ c3GSA[OBM TI5s&ģBkj 6 ݏCA6UPӮh*"y(8)4>Ѱ2ݩ_NUCI8i#kB$R 'H?nxhX(q#C%sg4S hmO\½p .8mL0ʠ'!&u^xPEj hT@ȣDZ?:!OYf[4ۓtY]^O Yo4.w!*QDaBKAGOB M[ՖK8h&EJHwLMҢ&ƟD`J50`S]6G3&~,&MNy9UHSB@S6 Db$*м4 & \FRaI"WwG+2N?(a .Dh`E.a CTeHReѓw`>.4)G꺴y q:^sT#F ˋ4pfxw9U T=Mn>UDID2<Ϫ&\ZLh, <+k45!M9:v=>=?zŲwCn#ȃ6$޾;E.7YMFz!ʠ'y*کuۅc?'b,h?T50T+c9EӎģBn8̈́tֻљ!ޏS:)\ΝY-FigiP ed[Ч2@ƣ &#{ <ؤxζ;hn+BJXyReϜ*C6= ID +RhmdsG2xv֜! 0RRn˩pv! :< DC9~W䳔2)(&s0ed(3* y!{;W,Imԩ}xg@Ś_d !kd:?K hb8=<>vحM"[$gXv/ v}h4!&d9h4``M&@ h4M00&@ h4``M&@ = LkN?O΄&fx'$YNQ_M_8 RTm6hx*Jm֟ڞc'ܿ͘+ (3Fh52l4RŴ/T笮F,'Xah2doWFQ|`RѸ/3>\nڅYeM>bKO>܌\Y~*?fx4~ ^v\J.3Jr,-yxҺw^*+zFڀ'ӮwaCxQiRWGxz`3R^!=;PV6gh2h_2*B9@s4N oatwfQwys?{uG˿jFPwU{',#2?+|s]աEyc Mz8|߮e`i_3}K,}s2"9e^eoEuG=1K=N;ckiiŵ&'ٜcF %ǯj/uH%ůLhАc1KeՠY2"b\qt\t}?>[m4vݡ &@sN{x7s{w~_2}BS;98{?.6kt5\^DhJg]~-7xdiƾki. DH=y{[˫Qr)fEe*O9YZl6$k38 (d-hk.VdjsDj_J|dUչ*L5)̛ӒюJ_DwUAƏk~NIhI#a2+:VO8.9 q]KCCafY\c4Kr7ʠyYMh3Zj+Mgei, PhdBlvL#ALZ%74^nXs8UYŅ^RpB'SbhV4;~GP?rOMT#L{m\gй` V٠ɕOT*`3$sj+z^ 7i7l$;FLN2\#'tTwÝI"5v`@sBc 9 0wz'Ak}mkCz\gimHY lC :;1Ϲts&W>ݽj'$O<;d8y# )'fn~uXS}i U%_zp;Y 79ec4s?~|ejeg$GFz't-h_ 4Y2"vLM؎EoQaЇUYM-ߠRYf +{264pPAB.aʈ/,A|n}$D*0&7b>tޥ5auas0ޙ#nTL7 >)CM 3fbn\`.)97$TVG%GwGlqWѯ<@ u*)p`M&@i4M00&@ h4u|C9]Lm.6`?~XEr RMjٰ&3Ko,s ! r/-4c\D9=y ߪN|Q9mF6j&pc8Lc#ױZ2 7]U"oho|vlYb9aa,ogf. 5 lRjx[ǏOdnp NO/@nشe͝"wD*pIG%"'h)%U68Efz7LtTr_n6hټ$ >|l4ߓfBI6C~۳G8) nخpȦZ W Sn2š2qM囫J2.SҊ5p2×BLv= U >-q']|JL*x?|o/hpL ܎{hDѤ2e`$;jW!Sީht~oǛS]\]ϛl'|C_S_$BN̥h-권Z$KeF,Sbb*4Y?q_H哖IiJ|^wgԴ9!wE8fuTijdCx74cf*+4W.tƨw'I= NZ,D BCtc[ U"zzT~Uy}??q}a5)OHo%Ÿ'v ^x ^$P!KQ`e_q8MxMGZ Z *ɪ8ݧi_ pghu_?FRU[s'S %bSUә|çJ%OBOm#9CS͵9;EBG&㟧%vQ"IKU"2s+%5YFb >R KhpfJөBDσ]zPľ$yH#錴a|v<|[ /%(\q\hPUxܠBܛ})հ{HƃۣOL)GrSL w*!J^>oN-'\ ]2l22hVARMQ N,OEFݢR#NGN :>*,4L7Z-4TI2}֖Poi6TJD5WJu?d/\#9BS %Sa&]]Asw9}1C*r{vLI%B qmhj ]qF̃ UЅ&?T&qߎQ14 ͨ+v9ꍒ :EBCԧMehedi0GUV+ZNXYAKzD&n&;&]]ϩЅ.-V"_uXgQ@謙=,r!i|hՄ.8#QR`-*d,jEp&R2(V@2qQxd((?NTkp/KCDZ-1-]G3rnՅ&}#Њ)y2R0BBV@z.U+5?y}cnG}-IL:M%Pqdp7f"Z{d()t>oGw~$T0!Ul" n2uT5!"yvnXKoxv7ɊWTI2 iZWLQ>4W _q!dZ`,sledO?Qk>Dxy/ wAu M nc _&@NF3OB\?W*3\·> E~=?đ&U(Ms Vrbx$VTAZ8KR"FY)ue dJp5FZz?ˡ2jn nx{퉟t\:7J"CfET[FM-CR:n)UTJD)U!AFtL۔#lbZ r[jڪdu&"KD1%d4:eT.tHR=,r@%UM}t}Hz$L~j=!\LMD0L'BͽyJvf B 6JrYHPnmEMS}M]*8 Lh4``M&@ lBswSH {y|-"“/?2|;h4^RhY|o > =>wEeEGO,,iփ&;rhEe+%S O[^c}-.@\a}ړ+#{k.zÒt,4``EW o#!l(A {%! 7sli<>uaoYwp#zcrF1.sEb63f8:h4945#2^ADsdo3?<_WB|ƌmb04X`2 *䠓 M޻z=CPe]/w{_>xhmsh5bhCfOs&6W ^Kj ? hzм6A3 ;\;00'*4=s<&@ӛ 4ԠC,]NzP}夞& 9x``/YӈZm"H[]E_2E5y{5:^ceE. z01M:!se/Z{r-?3zO4ުaLTN|q8,9hT4}a/n$F$ɎC|``\fYe]W^yӰ ̘bW֢$h4!@ Ԁ`/ϓXSR-Y,][t&x8 gfI1tp8BkzsJBse|i FO՗:ܿ|2yOޙ?5>uk;RTWqzﱚj\GldeP@ I a ѷ==$amw[%~w}ަD"oIg|Pq2pXJ1cLs`sd`ʉ-%W,۽ehΣpI( 9-/s ,/mcl7жkJ4#aDppsBMUy.uA({&anSҞ9Zm}v걪aMsC<7A44܂zȂ%-UN[&+3iZMMÞTfe'e1| eSڋUHNN*(2}%L%(=ˏ\_enkKttr |^s.0pt&?#癟hFnqPmPנmIkdnmP@ ? K<`vT"4Er6:?7) uZA[X 5TwWUUWUVWͱT\26UĥM1;VUVݖ|pUfKqmԾ}MխVA}ܖUg4s/WZ欩>ڶ4+Uw=yKCsXVz_?"41.H049'S"tGW*:؜q|`Ô ' *F)FR2! 8ps[5*xKkK4o ͽXmb;!4c4r" [5Q(a{@yS 3 e. .Hu~Ap>J.6龜PU*~mxUvn|^sKLM~Lx{j ~@ٕ/ #8jg}u|KcsZH xygzm=(ˤɣr,Vv -;u^ ;\.>ns~u*[{c\h!hׂ /,^v梩:~1)MxBBI@3L˳Jxpk=&PcR~&`>|{\!4(W$Y0Q_2ŧ\vl9dͷ>kl6r_^[,9YR)82`R"&ۈamtF,y߾NNR ̛7A2~%Oamק24%. ubguMǶFҧJ/8rD Ql- a} 4+9Ь範*5@d0OPBEKYqQ99XЌĄ&C8NŮ;Mu[yX!49g144q 5+"Qv}qjƿ YUjû>Ny^ih犛JfxN qWήŜ=p)F M&vYπdGŇBa;OfefF z?ԱB9 , !'M )CSҧ !!!hrN.\Bbv)\;14mًԴMq :SΪΕĠɴD\J!IMi'ϙ L]ǼĎo1F#>-Bscƃ&eN/584Fmy>]s&']륵/?T\(6M鵖]~64H5IhBPMK[K[[sl|vY]ᳺљI듢;3㩅}c3kCG]}jjvk|\ƅ&LPf5Bd0IYV_sm͕qǬCZ4 p H\PdB4E7&fϳrAX`iAYl".ag6L876sۈ]?l7mn47%2K-Q\'2Vou8l}{ev_v__'_z!:o3Tp21Csyn:4ڪ!{p iK|Ф|NhMXUvRcLLJGEW9|Ct`1r ͞cfkX_XUn-!;^Bb;Rg¬KU(Bto|yF \&o35 )Y"|ӿ#p% 6v2q<\G:wE2"8N&0QwWuY2k[̧)>8Ddh͞7dC$ U·&ӄSyضkl,K}U~4(6js1c}L%zQU,[h:SsVRh6.'EM#b@-5k%u϶6FơX&b_|MhNirSR ["CÐRm]umGQ;Xڛcvi" MybybYdBSlܪ9CS,24eh䍸j>24eE=(Hٙ|geB͉'>b7,׿EhNH ^̛ ܆Ņ*UIg?CsyR[VV4̞'4OL5^i.Cc}}n t'\{?s9K/NRW&8 ѷѐlC{ 5TԆ)7?)Vd $6[2Y-w y󣌛7s;Ǜ-ЈwN^ChZ֩nL.sr% ?ߤln/[FV_sop v4g6oЋ!QBfa*-9H +82`0'?_X6xa6Ъ(IB&zP $FCLoCBxK [Y4^HUQV=>m>Ըn]Mhro-͹rn\Iop' ڨ1Ѝ?T#KYJ? 1P>[ٲ ;'Ðm4EI+:6+ _nZZDHm@o]|_F›5PORxu AW4jŹ(BE"dU7nTΞNpvљD `puҗZ@ (BY;7kBDm+vTK_?*F[-Kpwf*бpr7R<Tݮm$\O8 MΏ-#͗e 왛沍UVU"a@Ӂ8<[7 O$\GP` @|TPGVw 9A*ro%:>k2-E|'u.{܍)]MC m%:g /9uo Č ,N %0ێ2_%ASql-m)'-ڢ㱹84Uy>iU 6@bd0>jE/\ahh5- @꫟ؖMg lR5Xɳp?w@AsfViEah~ىG&`Zm1ΎO8iKG$C:rC32ӐFYdc^* T\1Suvv >1`G>>)ʇ4*4:fj<~KRIM!x@0n~8Ԥ^TkHuՊٙ ᥙfbCN8|7Ao,M-AC3,{z|c%\ޔ[x餚LJ4=v=3U Iܷ#3bT6FJcA5Ji7,3U;Mm u<'O3)l>4.Qg9nK,=|xQO0Jgc0ʖ{G^kTsJm>kFʟ ϥ *QY9a%)&%F#9zI`L C o--@seR{mdg"Bw۷/.hrav:w;nB^tɉ+6]ħ} {si0KBCZu71mo Dhk ǻspzuw3yl/b[н.T/O_.'Mx#uJE2`%^"]'&qןRǣ(5 "%/}X>,'q tL;Vu>.Z9rEm}Pdڹ;}eeh*dIltI?Y[K,lkׂ. CiξyLƁshv7ߟc?\5<-ayK&OdKC>o4OPm$xD"Jk)LsH0"&~”dEoGbJ7$A)2ҽJ -vOQ)"f0@GX;1 O'f[['w`T:nFmV Q`ɏB֔x>=`=8zhtc);xk.>ҵjx:z{(d=Hs^U ~laC͓pƷ4 m> ΅X<ɁݨX%xmR:kth]18M>νjs #V G>ͱ'Of<k.hxߜf|I} 00gkl3A͐H>Ay<ͤ3"jc7BwGdl$B(4~=.4Kápb An% џ}xJ(<!A(4'h|A{sf% 43PdrG \fN@,hKp6vr(-5|mGAq``/꧹lPSl4'Oۉ=M\h9E,eH(ĜCWipķ4'Ecp%Iۀax $|Teܚ/6XöΚ"4 &wΥkKjrI`& 4-S@7 `=1! @`+1&` Pr%|y>49J(AR>Qp,ht Q_jܱyH!o &Mz&H$VI1}:FhK|F9`HNesAzν4K)›DQsw>r0nv[dcM<5M'i6'1&sc+#I|Cz5SS||6޸\|:u):4y%|!\lTy_ݸ| !6Mбpw $o1Z5(;R7#T>s=ܫW^{Dxfw8D$_B*kğ34dg%-MQ&NPDst|AKŢ#܋&>ˌvS`ǺRJ`kszRDn r_\k-wG*ÿgԅJ3#pI~Iz0Xg#pL8#qYp4E|tzIh9^Mҧi-B׋WyB#s)hvEd.Kksǜ404:i<{^`[ _-w.|ڡϴ NL{ih=fݫk( Y掵|knu{QHTLxBHXbѥ>2oM`iNR[.{oV)/ +򋊊WvXï'T}qY%BL+oU ΋/ǝ:[z_rɏPɕGng"uEHWKI5]']>7Lb~?#*zranEV#Gh7K3"{0D1Ќ3u+QZǴyBߝN3Y4j H.KN;$gnsIOlE" C3u"1yuGni]$d8hꓖeVÙ!M0;RUjڟԜO8Go O0*Lhc4sV~zƪXHGfuLD.۠)ZPne.իm`mGɖ|E9SkT da7t*pp}|*PI6fzT٣:;楌c{= U鼾wK+WYJǞQG @R"LNM&OoO^~jwѱHHC_ q s໻QFb@sE(f] Cohikڟ7j=il6iG/HNOe0oF٠kvx:9lrT5vEB9/鮢*.ju-8B`o;OϿ?FqQ^ڠe]EԶQ ӛEXh/S:spCssg*c(ۛ˳s&@A@+vH9E V|#K(LuI{{ 'ɆbP΃QePmnU_oKmhRՈD(O̿ a2$-؋I\#lK򉯪@ǁ}Ztp@h7Wij1|mxΕ˔ADŽBvAAu`J(bH=x* #UB{=H6b}w*?@. S@*+]VG#[ A>ώ ZELhdOB{q<:ާYd/TtYNtx΋A;Rv~^l" ƺ.InBT?w?d1DI]ZT/P@V#UA6C3g{udJ 4tD9/p3Ġ!ʐo).tsK<*⏇iY|*<_YihhRi{6Eʣ,VA{JI;DX8:-G1T4r'OȞ#UԶjꇗ(kU:hMՐ&[q`*'Dۈ}U=OA.9\<<mB[>Si`D{h#r犛ڋiš0G{Sil?17yVd?6nyPkr4J;&%)4qUZq*bMxH6!x3CQ^*#Š e+ }BgoAH /-)P:sUrLhƫn="mLwq،BG>2Ǽ谽Tq1hsd(YСQQ|qsz.b@*(^Hn]Y\H oD? Zu8ѸD22:?(244qn?,=kHx"o=d&JCTD;O\IWHN x3>q25GDrƁ#~Zc9g!FqYV_O^.ި0G'cfmÞmT0cRئo,8J_#oר1kNAӃNySWYTeP &Kss%uݜf-sxG%>DʤZ<>M2c<`LN :jk^ wčNx#50ׁ} 0:Ft0թ5pmq=t'ށ=Fp;bŮr#UTqŸT0c, Ykq#: U{y].W;p،LYB]64~0Z:287nop<];Q_A* t WhXt /Tqv&3&d<'e6Ndhz_ DE@7= th._@F͝+eh&M\֜y;9같ڀ1om2;=/+p?ښ$F=Eߤp_V}Z th(S@gZ th4k\&(4 5#t:vW@+񁞧^Ma"o^mL@s- 45wl24Mƭ3&Mv~olrfh}(,yOV>b\ z ۘc ̈́dܚ2gF樏KibM0:{ }, D@+1.m2fxltp&kIENDB`flycheck-35.0/doc/images/flycheck-verify-buffer.png000066400000000000000000006422321500215546300223240ustar00rootroot00000000000000PNG  IHDRELx iCCPICC ProfileHWXS[R -)wH`#$B TeQb ZY+XXu`CM ͝?g9NfPc* 1A̤&(e@FDG(MHk6X:_Eq@!N8  t@| X] @%8C5%8M6q1~ SlaJ"N$h'WAds!unndӾic11,E*d(?=\-99 af c$9u `*iQA|ϕKLqp~#kXb8;GB/G#!qr&̋G983y!xO;j Vz83.Qm+'DBq(;6L8/rF(p6m00FfiFl9l\0Vaf\K≒G9py2's`u}Ks6^NPlQ߫d=bFz_'ㆣ b@΁K6@25|Ƃb'D< @ʞ6 ]:Z$O!ŵq/Ol+6T@'c<8ulB70`v.#<%tnz Ax""_,9D^-P]?jBN/ C86D ssǸ}[瓰>^RI"mY5>GKl9vk`X`bf;!cDZ He8Q:~?͖/Y/Q!oVc˟-gd2}nc8L;{g${lxÐ7]iJ2㛎m}]Hlǀ1W?98 D8 L0,% 58qpAº/ x!!4h! b8 #1H2d DE eH9ى""ǐ3EVU`X=5>D3qXx< J| ^7m5!>%:+;!D $*{G wGxG$D3 .Y9ĕĭib71qD"iH(TH*!m&'"]%>dr 9, /&WOTL V+VhQЧ0LQQ<)q,"&J=卢dEBM/(>THUZRSb*^imfJcRhUZY%RWiRRU &>ӕ++_QPQP1USaWT9ң2JWWRU]Os5ZWm.j݈GЗwԉf!Ye;54&j$hҨ8Fc5&8q>xVwu{,Mff OZLlZMZqmK3i>c&&Гӳ׋ë]eXdyk+=oi?ȿԿ3@- >`K@ 9A ak{BtC8!!.B¨aa[[ ["ЈЈu"M"MQ *$j]h&'GO4>fnL{,=vFwqqƛNj[&&OO,OM4/rv2?9'ehJ S:M-zsٴY.Nמ3 S R?존Ag#]yy=ӟgxfά_egmz7{$'1!{L&η/-p/P0( !iBux?,*,03aY:f[^1Yq`/s99s .pϼi[-XoašEEً~_l|%KZ.]OA?Օ(Kzy,۾__޹q_K*>䬼ϛ~Ysmkkkn^[SZ^\x]ĺnbĊ){7ojly[2ܨlҩZQ~+wmmumΠզv=ݝ_jh)e`ooMLM[Km>}:q]hh(;k7j=zɑH̦cZ[obk{###l![z`CxZ2<;t@QݽRϤO.{Y/ Qf1w cM.tGY,*>֑/!.$BZѣ~{fl%;4+Y pHYs%%IR$8(IDATx]`WNK[BePP]B4[q!Hqw.1.yLƒn۷eޝs9+'T`@@@@@@@@@@@LcccCCC}}}]]]MMMmm-llW4vwaA ьZ(.ΨM*|(lg=pR jlI{-J`{W2slc,WyQrdA({75Vx7%R}ǎ/n8pORh'YG)uT=*\M$\M4 7pw+Wqb%.\cRvZO┓;uN ;v;'.LݨG{@ٙ'͈rD'DAy*[g#SB9I4_ĦǖK,b>y!!oDK*{" B(i%XI~lF_nI i0.lM[l/+vx2@rtG"m%Fܼ%P3_yB|!]p:$N` Q#Uo4óx;͈kKWj&˓# jlt8YFTmfNrgXL+ӛq$!#z6p;}Tsߨ+U_OgHZ P)Dm2u~nQ_ SmwTCքOcfd\5zuGlnD/*ƬÔOkK4cDѨ Hmp h_Mi?q`D{8OPhMd8 NkeAŲzu{ow,A4=.R2CU:æ=,=2 ֈ"!I5.`'PAe_qV⺦3%+q )z42;|2EF0bWL~i;RʙI4m`]4RX {P5* AJSzjf@:8iWu? "}r2̄646.m86v[O\gUMk<>U' r!tVMUV "KJd,3DMT(PgXrCSyih<댘GUsR/_ :+}%/E{AYDI5gtI#i4YǕ~693~=;"5 VƮ.4|T;y>[;u{>[!x?"pϒr-+yq|4\_* V-qDiI#Hy*[ZqG*"6%6N!gq%R۩$8N yٿ5iиIǑG/pV:TWEgH5QF3u{,k 8>Clqk6I4r4\dҙL<#"oμZi@#@8gwf&yXSw"DRڛAq+RJ4mft(7VSpVZ%c~DF;G !}}hrVܝ8|r !`K?h='S 2]l;Q]Id.LsD+$fäGD/9M6PPyIe+*̇ߠO7w`HgEN5%Y.FN4p6r3V $F()g U@yyo@oX<-TR˸.KAA̱EÜI34+=.r*~{ 1ƀޒJH+zG к}(2ظXJ$]$W>.?Q NouWu&,0* EԻK *DN"i^Aџp ߠ1 pzQQYp@o'T^zN`8OR GhHV\I4nsAI&-*%:+% hhIR Γ.=xP4S kCmb:Ն8<&R/^X*K$M N}\ 5t nbK|)ڷ;=^@~8s=T;sa_]zEjxI U| Xϐu ;Hw\"YiT1T G+ē sMdTZ/>l@g'y0>i6Qo@WG%!F{SYqؾDCGGܘJJbgϐz> !'?_;B uz1JU wNEKsE֥7#\ i A?K3R9ܩOzF ѫC-{HēcHciu?4~.%Xw?Csx5RvA" JzpU4ZuO4Tz_>4vhӎ$#RjT1v]ʣB<ϊOs>͊HuFq5n.QYhd( O2K'ai~&AjM@-HQiUQ8(؋ʼns,TM[S펠P̆-gãgG4{<ÇD83HB˜J?S#B_"Zıw*V@eզT~ZQ>FKbD j& *Jw6ёYi8 *&JwPwp?)D-&Nҡ7RE:TnBU[ m6*9@*wifd}'$v3ތKCu2)4;;s_ gyQx'X[\TПxhP{y; JZE3FrJ'd! `Y ^YJ>}-tԷo.Hnq2ITu,| dv# } Dii)VBuVSSCgH1w ("|>lB@@@@@@@@@@@4T'P{ 򞢰P^T$dL,D2X.] 兊LdRT, (NqH+2$"X$F'SHާ{2uK.)F,=zXtJli&qumX++D(M;@f\QmiZi<,l(TȖ ޭ NO *dKqqVF6aint_Z,΋_xmSaL1ڥ&Ɩ_dT>i_$IQ4>>L>S"k!B_L&D>G,+ e^4D.bsEY 3Xj0 j݁L&bK5XycP&Rs}pcʅY3[# (W:K@OH7v'{@2m 3*Kr珂 tQa7RT υD&]폤> w\y|{ٵD\.+*ʉ1w 7_~/6-s41ߐH$ KXz1ceaoKsK/3:IN(sJD*equv[z?Q$U,Or $ 7^x&I2hMI$wqrL*ɀl\)$d2֯p:riԀ?6R wQe5=3G+,LCEf<^&'[B՝E"3Zc:O8(jOo+{\I"c$x;!UI2QJPiz4^弑IdpA@!Ν:n•z- H|F~=QtertR#Œ *?ЂB)a[QdƻibKS.hQ?"!R.)PEZYaL"EHGjÚe ,vqq^d]@@@@ܲf4Fv XdJl1GɰdƽjZ\  J$]/d*z45zBfP&1-!O(((Ms yn"{PLiWKN6VHR 1f'_B@@!JC-׳5657p\7.H(tV؝vo"K E gݰfx&҈wnٹ;*W  @'|qxʕ+W\  dr5v^'^;~Joj=gnݞHu*6lw*&#:''r@A+7;/A& 2[.hQ.ܸxj͚)d|eεLWoٱULX$..ણ֫Yn% ?HG8T{.+k ټuH@F qrݚUhWo}u@$H^ȿ{QEBSBYnghJ!ORVV;֬Bys؊"LUkG+u TIJ_l4fy4Ԃ.!s\]ۜ3dƽsk`TUcgF|Ofp:Wd/@,pq s3#3&-l|a]@( Aw,pu0GvX;xyox!:L3oq |Fq3>yHIbfbdjn 20522wX B&F?doddHceagh8(\-\E"qmBcSzƦ+'rB!r!aGo^ikeinc}7, q˄:Z:89Zu3751u_2!@87ؚ[+r1172[xQ,1b!3efh###SK~A\D&)h߈Ꮬ45_~V%҂ :fh5u Wo`H8kaԭL-JXn73161urrrqv63600vq1WPVf=msmi YA@@@QO̐u9 /*Ԩy&Laܜ>8 36U6ԽEjv Fdn=@3|St;9QRv>3)U v.3d>#عaɊ Oã,>xA^7#(1\/GgD" 3񉧭׊\b=LG%t=G>7=Վއrm|LO͗y@ztTE/nO#C}O=᩹{V8Djvu&N[N'gaYpp*-gIlT3y%Rn͓z3 Ioܬ},_2&d'8m>~,P]=}Ue ].Z::/>dA%/q4Ѵr_qe /2]gڼpWx:?[qO08ifYb12Ib}+]]grR$qMMkNy9Iayijnh2`Ɍ(LFՓ 8_>{7'3SRtf&+ @@@C |a~<>??'3@$f|lcǏmǑCOId>ˊ]'&0sz; Rp^NZoR$2ы3 NcE@[2R& crM׳yBugϡ\TS(p._gl`nX,e'=qqq JeJ3L.ȍigiy S,߱01X@."n[a)l 퐳W/IJ@;K(nԶzJU)^ܰjc!Ba+ZڶKw'1Bb0>^_\H㥥kwE\D,![kizq$wa^ڥ.FG%R1=?}+oIɹ~6X~ZK@0$SAYя}mvKP|P1>.:db )趣9Bqhj}=/q,F buͬϼLhTyc$!ׁĄ(clXnlnsYL*縟@"w4b2@Il_M=hba{9JgFD%EBnؓg:%p I1/;hh% .{osŬ - WGF>!>Z=$T,u6\?+gXR^bs.w30wpYϤF}uFᵕKwv&Tcs\WW[h!b uO#+K//.v1512253qpZq,&2၀`Po{<;'Gѧ֢q8`M"'%?߬%|>;7 \wOB|3¦b8"Uglk.(Eb*qxl߉s>g$2^y $rdشL_/2J+‚k>sIU$܉K!7vۙ9xtƵJ\tʫ,Z# bV$ 䃮Ff˗,v9p{~s i!Gč u'‹ uL_ , TX_k8n:Rmg1S_ +|&L<>0]ս^a ћZxOdBBFd1;*eGO|s-7"S˜ `Fs^wRt>M*>\VVq>CEiP2$p)1e߼p?HX~ozk\`(Mi6[gqx]cG:}JQ'JEMM7>cuئfaA@@@PF  uW/N9=- ]n>Nލ+,XiRyѝ,sͥ0RDNbEg)]9 ov[n)p#]UW_{A1;6^{e]jhjzpXy}x-Z*AZ{r9m &زx }3?! "_Yt6K^n_`ax;8^ϊ:gɢ-g"S"N؝sOmk yx⓾YoqsO;yzps}"c=yR`dۼеf3M`Nfn.nL&7tɭQZc4&̀"fWNg\JAw&1f֔tCXp4_jG<8 gr)L:/,|FF::6$ڈ ͋۷KKCco]8HO]p &y̛v> ~+ 4-=_xў-;Ia ueO120^|ðo,\C{˙$09ژ;. @B8/2X("%-<~HKoBC=FsҽRr9B!;ٔBg< &"[- .]8POSGiD:qx\t45-WmuxěyhYm K+|0PHNvZV'n0K+45m=۳FKcޒR󐪆9g3\v[.ښچG/GF~b@B@@@@4vF|}ϯަP/6_M˽վ@쳆pz965V.вfZi,N fcq_fT iz2LW 1BL0a0:bFY@.˄Oxy`KL\+܌յV+SuSO<̄7V/21(qߤ\qXʚRo8lpM=\s>F}z^W=Lf*Ȏvd!$22^nSxZb$l0ѳr@yiǶ.ToMj.bqGKS @F>{%d2B|ϚL++zi.;.!-;K\mLu]\4i_عF ]}K_G*X_ zs "#+#9^I=gF[!FVkv?T8X7NN~Ю)Ⱥ&<^#7^1P@@@@J_K$KjФfn.4֫0ivk 3ssjv.3ԕ:;0ϟcdf ){ @i˒519,z~K؜)'8$>f0A̞farr7GRkdq RLJC__^1"+0 ZG~7) Odf<{{eF^F.3=bۣljw\xKz .\kAw"Y̎ MSb(#6/_r-11?}tKW@d ߃8p'ޝ[wIdeǾyqe+W>yyqQ7no޼84*+/_vihF.F޻q#<1ӊ#!2뗑]8.9e'oUL)jjjjkk|/` .p[M 6be3䇇0,V,` 2a?2\Qy +FN`3R_lna3_ΚL͚wss9 vDw yi E9qer;tl|fG-};{ld$ g(Jlb[>Gq Ju@I̎Owe=9dЬH".@e:(@f bw MV{$Bm}pDآfC,YLbAS`7Ҁy|g!3rE#?%gC%/|>Mt 3B^^n\XPha ~?}[ GVsd2+SC< /2eyX>zۿ! rLs`?B@@@@@@@@@@WSqn;aXBg@N|F!2;pgeWA ] l6 < gA>3J $| 7C>ܻd(O@þU`pIro h/͌ J.mceD?Tn-O 9}ޓ\nqd2cNj7M ?yh?/m%ܹtЁ|3Elae(2rۑ-*|2~ kU_YVU"iśFqc+|oFyo>Sppm۷=~ElΟe4TVT4U}_9$JӱmRQ.{?u#UUQQ=hP/k΄G>j= 6|I]-g6ghi}VUq"N6?Dʠ[o(hþBWQT> w~LN^dqɌgo`UKSLbm# <ϼy53G 5{/\+Ig*X:]wWa}*죕=}yf}cG43''3.֭=٧׸ɸnh_zzo:վs:xо[ҥǥ -oWW|bx_)g⬣ [/&U.vʭ7 +|(9 MFr(n|py v҃g]/^buEߊcWmg/3Nό&wߠpo1+Yo?$t Ӆi4,GI)W_em\rEѐ|@6q~s WY\Vސ*N>gA>?gJ>Szuu53UAGф;YU5?egT邖ťNj֪F;E ii(++}16WW-)-+j&3/H"zpS]5hJ:nSYfUi)[zu9t+ߖ-yc 㕰'[{s]UiI򊞆ݷ_V TeEYqIIR?v_ψ>Rt3D۪n5 I\Z^Z++j KiiYYYqq}2>;;##'7_\HT{tHwLy8/+3;;SͰ2  $ŔOY$/';3+;)*2(Dɻ閦Jt_PQbISQS X~q-oQ!)[JoGIk| f.:rU%ue5Bm.EDcII]qDKSqq]UhIEkUE}Ii]E53RX r9Ƈ0'$3oKJWl%=|%yo>C|7&t38kb |y>Sj}[G2dkofjz|+V^2epo(4_rYiN{9S'M:syEmRtxwUUk9SkMʎh)S&O:WK f(c'1223bv(:Y 'Ie/rae.gN0iY:ck|槾'Lb3.՚7qڬI D_dn)*"gF=yisk3ӧLߌ8yav!ASl.;b =i~{bı#⫯8M}1yXEbJ+͹nj׿F2nˢ,Y'9Ta=k_ŗ_};rmVQUk!l"[f%?/X [$fTaح$2ѣG?Pxɦ TLL}N)i{?;4_['Μ:u׊M֟_W.*հL 2?񶮧>7PEUN XӦ"|fl?Aÿ9b`o xPާoWu8a׌>1UђϾwî:ϯsߪJ $^𤕂RM$m,M<;)ܪ ׿3fܹc>9k(;&7Ξ0I**5,Ou}kCݟ?~1Yqg6] 鞪-(F[U@%֑?b(6=7")1"\h<I2S/m7܉ ly TǠe2㳡 7ķ͛&o[%X7pHHRaHF5}chnE3_uxRc~rx7QƏ2shpr4 髒6G}j}@]Ѽo6 d{*5pHYΖڨCun$93Md#d5_?d#Օf0f MSa揤ɾ%]FD%ܗoz]ԓު~b{ivbT1*NG)6vjz{% Xl^O_6{}?6B3ˎ(Mn3ea.I5'] Mf--x]cu7eW""3^ ęI3d(QFa);6?n@doӊa)8%Ȝ1*Xm~Ԃ1Rvf "K]2?}/ +AJzuרyQ<-eoKʊxx*(SyӟOq=+(lhllj~yc}?(cETR?u9E:+RU` [Ph]]E|4n'J;3M/F>WP'o8*փjkVQvE" ('Fˏf ːk+b1_/Isn|}A#|knqU"k˹ۭ_QBs @sCmUVJ]HnEO} (emψ.>eYZ ӱP_rX IO/ k3ST[S'QLI7 K ,6VUE_N)xa9TT E?o=CXJNܽTTGTLvCѯy:JqG$IcGj!i*z髪:G=ʪ8V8Lg'"TTPg_?vܸ1?q eYD/Gd۾U Kl>i=?O}ijמ~W?E?(UTui|;kO~s"fxtfTz Toa6,7O rE}3{;wo;zZ/&{zw%O&0[(tqYѡU?kE q).}3ݓ؀i{dk.pNZqYR\YTQISm`BT9eu-եUgLu;/G-X-.dtH4IF5UC]CSl^i7RVӆ&]v4 <0yyV4Q_װE5̇+a j% ]z(cJ-V$MrJZKV^Vdmo_[ZemDC&PrI}v0([+#Qb?5e]YECKCCs^dwN|5cK¬%*@?܊|':'o j؋#9NqRxA@@߅2?qtޫgh뫤|E 6ū717_ec:\a}T?i'hcItgSƺ{KScMiU90>}G~A;gЋ_V9L{?:3/; vVI6ZnKH̱)9?R琇F֞6 S%u%AZy*@ciie6(Nw;S9c>`B zϿ\Rh9v?js카C{Pmҏ}y䍄0ЍON-5Ei֣~8QC N=3?Uj$PD)NZoG|2_;dp9Mo +'pJI`-\|bCZ.lgqv ϠomwkMks ? >OD\n=Ym>,M˧;cە򦦆FޫK?*Bÿ1Yv؉m e"(QC~ 'CDwS\o&T6əa&qq)^G)>IWLvg84\z,:!)Zd{sUmzYj8i0JM$|fj+1ź}T~[v|=^}M,;x&LuMI|[Φ쒶^ZxmEI%8Bk%[](R'7w@RV/,rX<=2,;y*kCqA5LpM=V1՛ƻ=FEKBgQ S01+9"9YJ])i7wT8d ͍dN[!L K]wJ}WCﵬ 0.W^:9NV a$W5y}됃iWA@@o* f((?4=gZ^m_}nTxn,=hJO>SToίb?C|fl^?-Lv->RhôN{ysC|3avƆz̚^b.Wk vcgh}1Tm]w>s^cfw,MM39zBc`ݚ6]v뗟=g, s|qtꯂόWUvqQH{Ċ:xcOcnݺE^.?w/958>c6e|Vsm͵v;) ƪ[Q>,&w} i;̢cn y?gTUFMgכzOX-S_zz)*v' CLe/Q>-#th=Gk6^Ì駟v>`dzUX>3d [A5v~8}ƴi3e贝I1>#GO=k挙3'Fp)^ihLho;uF6vˠͧT̠_h uLwoa_КaYY3'/G_Ma[gzaD-CdBq$~Ru[q Ng! E7%{hCzLX|&Ns+HZVy[D;YuJog#Sùs< 7rg:%FwNkJ9oxO_͔)LQfqѦQ~9|Bk yQ\/>w0ySNq%r۵xcާ/NqK_  `cޟϴ"u9 NTye^ޫ#TG-w[fUzMbw[jD[gV4a %/ g1 ֞9?U4|?m kte+oCp% >K_Q?TY?uڗϳ>Rc2KD_hA}s%qq&35t(t_Euu0YF*qox>3KEuH]g4V&Лֿ/cUzxIꦑwd5t|榏O:3ɦ>FQnQ{oVQx=um?l%{^ss@Fbܷ̽ i'.~v?ho~5B3Td?Q4~K~n' jj}ݻq䇜ݶӞ} f̝hi>诠Q>q|- Ɂ'ǎr~jzD7%~KZ$켸<?;E~m$;BάVJM&EOAwZ[^Eg ^9bI/ ߉lTa,5wLpJ^qHtr5sH}&*3ϔKYgS6K̷0pYdM%lɍ-D\mmj89ykzPV6|Xg7(Ji3&\ <.~ca{ &>S"Z8#iW¤m9Ig LwͰޟϴ)K9#}gyK9rKxǩ<^Y7n"Xdf5<PQ=rfE@s gZ+~Wo/?GEe߽w7] Q2rL̿V+}Vݎ/ \|>_(Y#qGCFuퟙjcڎR^['oc Rs#/XF(Q$X̨k)^KSy$31lJq?|KEkUYw.kUTO鬹uMḘ5@׳;khό_OVza) E|V~_e;4gVQiNTi|̣$ɇ3/<'OD3jwzW^v[.gTv3̒FY_?APGݺ;|]c)o쫊ISYRp|Y}CsCyZDe&O/ۙ1.oGα t tVi^yͶxяQA}7/N"8d}$fA3۾d)Ι7ewrL|mex%>L [p^/?wNc_V3Ә3sk|]BYIWi i_r>/D^i޾s>úgfv+ܻg7ҿUy`%[W]^7}dG f*ֆ hn6-kV82#fȨk6~8N^WA7"EzvNJ|FBh\Zl2^yu3Bc%HO"+U$>//kgϴ_b庍O7"(_ngNMi!}#yLO}"#gϜ|:YaYNm2M& t~٭-gҊ3s+͵ĉ˺L_◘) eK)xCe˪~ o٨02lp |Z 'Nq !nϲ8u(3$HiGR4UnA(Sg|Bή]Pzπ7]8q{r7N |f)37^i܉Kfɍ$|EQ ޻3wC3HZ|}U찙`s S,$O37i pS%RsiFߌyƟd:Dy3Mb}9.;WO8m[063M0(a0y6^۹_yYRY0ңli6)h<\Hc_:2>#?2GiI{G^[]B@Pi{u ;^6ŪYV;13qzti'a,yzk}G_~9+ \a:?woDjP4k[EokSÅϳg>V1Pn<ӗ_z`$y؋l] {21tvg 0[!-*ũ S#'7a閸|SW.u5*|&C]keqgC!<;94w.64GLN*A.A(cQ1T3ȅ Nx`c0>%lIшi2~t.]77-ŝ~  ߳|W$yͥb, Wx,fy71Ǝ2g.CH'(?4]ڈeha-v4H?j츱#cL Mb%][XxQB-?vIlzϐ]p<ߣh6J=1ry ĩ&o2WjҕޙQEyjݥz9曧Y> ;̉lnb![ E-mzTsanΤ"Q襸Q$]|~N:-NA>b"ܨUU[zp+ur%r>é97p~35&)v(*ɠ# =k,#ZK0oߌjg(^k/.* jtGmpP3b{ϭ N&>6P ԧ_QO^}&^x۴;em`7(zzG7f]1odyiomXs>. c^gN.}J%?2=F/N:^Je_r_߫S42kׯO,Qb9 U:+:F7-]{O'Hiw €{uQoSp̥Nhul_}Cw˒FbuA{eøS֏x#{!{4v2hFN싴!;r:uޫR7 \qu3lUĴ"秼 Jݣ_ȑ5xi[Nk+J$9]HK|bt){5گ(Nuwc TkU` <5.< 'lݻHBt|N#3cTog^-ĖVCԻtGe3pU!3ed3'YfSt'.}f·Y{6sn{Z,ݫGكtkKptxNCnç6t~ќFoLq|F[:Nv\GN8}Ie47?YخEOwܒxoR2 MW#a2ص168e%W6G铖a ןkiZf~5m."܈U1ӷo&.X*RfQQ-4ZZ(<#Ѕlg=u3y+! YŨ룴%D5x1OgoRGGCv/,*7v;%Rх=x +ǛǍ^+vW줄P>3=,a͖l&O@u"[C4r}޿ $dk_Xsll<~Iuy{1ELӌe?g'ʽjR}A:>I͉̣x*]zaikg4gbkbX}X 33377foLAuQYs%C=B#QFnrpK({؎eM=a~҇sZZ!d',Tn$oȃ[ۅ9%ٻa%dkVgPőArԣ8bԪRJ]~&BVEܟ|;ގP]Y«Нgw:>'2kka.flIa(sͭKOsb?;&EXwZrݤsNNd]Ox8}vk+3W6=@vPյQȭ!Z|m~ '؆$6-+ /Z,fy"׋-Y1OG.}Ӻe'j9xUw6ڮRUo?g-y!y]5?a0K+ + R%uDL0GVDV9j3R 9Yv"Yt}ĖPnG5 Ya~!YSN9w"(Q~6mj9_vrHWK8 ++:s(d%ke˼Q1^z`ϊ{nRn9LMfOޣڝIS_4 7Qn2vw_3Sx$aʒ 3E%E[!i-{Mqձ%)N(':$&V+JgwKg^P靸T^Np\yr*'$*w뱍KVO.+Iâ >'Wsg|Z~3sq# -Lf||4R UW[K8[߫pLB0as8?cV|aV-ZOȦ&'WHM r燀`rkj6Vt<VW˫eOhd3ZS!h+>S͏7^0{DAW]@|fϛӵγ픔u(鍦,^K\+<3][ t矑|HS6׊^eHI{Rc|F&g43\.=|_3͎D|Fߌ|3҈ :|fid3?43gdJ3ͤ|3a3hOa07Ffg>κ6}id|_3M3iqڂϠd9kXwuLK b53 g4~HLٝgh >#xgX(#gԀ}=.F62>~4bf}F$Ab7i3&pML3&ë|_3fƈ}F|3ff∍t.g173BA-{J3ͤ}Az5u5O}= Pd5}|Fj248Ӵ ?g#|g)g>#Ϡ273Ίf4w3 ?gHh1_j#ogh#>L3tNQ~ϠC4|iFgl5_32ͤ2#; mgddF,7C ~ϠHͥ3Mi8>'~Kyah~-UtuE9-{J)t/Rլ3 ^F*Eһaw_[̯iT]w}Fg:~F㗗J+9JM1}NJe"ng39b K#;)#zZ\џ sqk~nJ9SEmI~fǯ夥T*2kl,|g#g4yFgXy흳YYR=puRBqf~՚M8EW r*45"D\SQGp4ҁBW,&wZ܌S w7YHcWFOZO8e[ٷ4H LiܥfboyF3󙚌p8-gV])H(;j[j 'Z-"l=F|F@Ο5q~<IV'igiFg3B>+nDZFl kaX#VqpN#!/ML-u-~żֻPm#ML#np(#pkަ.7k+ Yq2+>s}/RkB/7vfdSdCb*{'8NN^)Qxf'|_yΙ2y֖[&g<=+ݓ^e6H :w!aEE1uh{+QϞpEϘZQn}ig8iXF>*ٷkHd’q֟ʡ׵5}zsq.U2h7`2z\]$Ln`8}[Ld;yig6̝ǬFx=qcceI[|FGp#qkfɫ :33RdxUđ S.:H:|!v⮄/J %MB8ܑ0jǔGޤT֗ X81s8z!x)&ZТqo&. [}">Ů{&,!'h{Z9k GҳG%>{lh[p"7.Qط&Xe |HDL:FvTi>Fjmě92j-[v8q3${1;iwZaCE>kܨy 9ujG!OZ6pRÙ WuB_b Whu;D=]3@w 6v1vo*N(ZhZIQozZ.ƍXsvQQ]؂c<|ē+#hFKTl%dwz![#G:-%x&=Z"rW0$b<`t7gD[frZ:E_6rb7`JDe饛v=Xen՞aS% ۯ$ݝL*½ >R|ݏya@[F3+&4A2,7O4L8|1n{gܝtE83d?y-zqsF u ~B/{֌Ϡ#3mgV&š a7(xzٰ%tUlh*rǧFT5m4cl/}V35; >Clya9}h '=*gŸE[ũ:TUE|F'Y,zږe.ɧ?I 3E֓!:_vȬI6+3NM;k y˙:]AK U[F;`mMd}!.KitڄϬNo]1}яR 3kWFH 5P̑l7 &Kb73r#zELD-h>KLen5X#7 ꋐEZ쀝g/'ލǽ˜;rSܻ솮e‰k'`s٬v%M_ۋD9F}%Zߞx/ 7ψ' zϴ4~F )N*g@\[Qc3n N5;B& _4;awjGNXGs sGi S$>D|S]J4{ es.Nn3p"u\I6'->%e@4]Z! ?LԟsZ/3ggZO6l#liI!ĪjN"!i'p>vWzL_!T#ב6MzV8%ۯV0L7="X!Y>Q>{J's+85UO淚_I0]{/1 }#qڨŸћ)/Slj-&JNxBي؛Z>yZڬEؓZ(-oO=t4sKpW컞^f+/HS}L:&eY&]5ے*;>SL3ұgZm)>7s6z~R7pft*W?Pz˺z!eh٠}ԴC)u۫)X<13Z Q*1oRkS{Rݒ]s5'zϐ>XLwuUV#c`/)T3[5Y$bȕ)SG>V3"&硒;ǻ>|Q +J(-ƛ:l|' _';Swl?qCes^ MDoʸE2)ʤ ?&-x~4Gv' ~RVZyaWp ޿?t,ba =OSw HHu-#BTwlM=r>;" zϴ E>#TZg ՗)8mJ̪~azDSr+G}g;C>4W6G5'җUUKw"9_rHDfIl;ͨLfψ>W) ">tcd5 Z~3)5tfW8i>YAqfC4]tB4~Hgϔ1f|F|_32 g>a&Y|!^;p%Tw_bH >=|Y:F:|hv?1r9L=r]ǗC|3bu kFgjƴW je%*JMLq$q\g?ӚHu91G3/>gmaMnrgg>gNψ}F|x\6GQȭ% ȯ,J @ O+Χ11$jl?+z3 _s\r4D*5+asg1vcR(111q5}DXRѱY_3|FȦ'"EI3-%HzwkE;Oݦs~ytjNBRnBB^uQr9,JRnrbnZu yԌ.'ʢlqQ#ܵs.]S gc[i>͚Wôo[=Y_߾+ yUeo }5IÌ}scCRT+'iqi'ih?OiG>RXqcӲ,0p0d҃ &}֤璓ow?h) +s#WSQB~=Xgǔ!g>tSF 4xd5E]͑TW|yJ]vf9%8*ygg(yбqPAh r >بI\h0|ıJҒWZ{x6c<ԥîI?hՈ kco-]]/31gl{~ V3eA >wk5@O['yLv{jٹ#FG5I7w 觩z@>(>۳Jb4Wgw`Bv,UL~O(<*%UBWAuڵ+,Tֆj.#N_z8wG3g`j}wLJZ7Ri6/*30jz GAg~t9|Wyz˄Nƺg?ڵstԐkosP,nYq>u;ď@]]]sRPs(%u7e^u|1 5*Jnںz]U<Ե QRmqlwuU ]ca^C\+**_IN|F:x=ߌO?֘7O)b|ܷ' NJct6%g X:i&^<3rּw?HU%>?v=(8VsKJtO0r 3zY^0-Mo$Paş,q NG,GR~Lg keU~h-af|på8;ſJ u֣+s'w_3Mف9ag1pHxG=\U=4NJfB1)Gս=',*ƭ:MUES软"\]c'-̭ĥ>j^M&<#^6;_igk7 >>#Z0+y|e>G9’}Ͻ㋫j˨%P>#>H61Xl8@*a~AX3MvZ%&ZHJ1F44%!s (()UQQVֱ}^ (`f[t&)G'Թ9_6Νt_r{3V̸q4T G1bvg;[ƭJnU~I #@Z{VSPTTܿOdSݟ5̜ޘ^501ڬ[IvvPP ꛈ{JW%E7\BC\,O'J:FQoy*x"ckahmhmo顮ꡪ;DbhK=ԇ"P%7 ã6'ξqmn.Oe 34i4G3e >s(jE4;s-a)XXt8`rz6 hp`fz#ͦyi=/ht20224ohޚmz(2M8մy/%>î$/U~J&{떙0Y2>^%qgn?g%qh^v /y{feo=ch|jR\I:]A3^fffG͎Z3?jf}|u-d^5so=E!]T<<ԏݦfL4NbA|}F@s#j6B4RS}cELZ4PkXc;:Cep^ձEd>f2P ͖١I=13C)ȗzb0e|W# aIIB^m 0}S:SCobCC$Oz>9y-V+`ӲC/>߳bs_CuOMEMP3tHd4||&ñ_/^59S[(|>l\sv6ي[>cAwd 3ص` 0]^&>3F~QD2uhx[蹧fu`'괕 ԛ|MT?kz^pݹ2d8^;MMCr Wcpg>9VT 8y3ǝ[4&gUi+ΏQqWSvUXB {>S*3ʹ(5ȟ½!>cR oz? ɹo eOo<~FLi1;cگcKޭCykޛL-CҙRYʊ|q<OgKRjaa^\dȺY,gE:w7}'9#;j(Q·Aږodٴ@'C FnTҭO% Bk YE% _􂥞ʡD]گ8QPA<*ښ^ڈxQ,EH&zQSPWy|#QB͚ C-F:9(j*|I g8Lp%uo)S3SG" KOo#`xM⭽ }ӱ&sDriA*"kFDk^ uR6aJzNdԈneZNr=I{nN4@5}+Ï>;^GWԚ/6{|1ojXUN)e\YׇAk42),w{O۱PALit<44սbq`J;+ -:ح{|Ii]7LYA>+C\! :Yk>#U98g¥\=u FS`ϟ}WP0 W4G~)%5Ja—g7"YΗv01WgggWW_d7dN3 >u)5&E{ԍܪ+rNuExvbr~On_f3S^\zqYEۛ=\]8 AjJ("u?l#}J!W^UNk"+ S=[..>'oUA礟 %_Mm%U&=qñAN ل;+p"MYµl*RL2ty ~&U&8*%] f"tZ{^d楥>t˗uH33~i)g~4lVMfFfFb9 h֪"6m!)鬑vF|$$oYg~tM@\.B"W+{!nfdA}FJ>LՀFb߽{ϱsb&V/U^z^m{G!Q50)?gd~M{A~VLfgd}R3|A8V#4?p\s7}=s΀k}Lf3>#3F43ra6Fv˙g=g>#V_u Y>#< ߥ<.!RB(OQ,x{"ڣ2oyԜ7𗂉EEP4F,3> XZ5Qo41ngѡ7,E'G>ay6}nK qr>ܸsx?nGje<2H#p[ȕ٭JWbà n3_ |u"$9hV= ;UI7DzYZƯ*:- a3>=G(%^;: 8s\uxE~㪸tkW=!,|m9?s=CchqԋnJ~XIk+Sb= >4RQBpF?zA!jެ.ut%geU^=5\LodAG}*2E4rI|1'WxSPwiw7=akU.{wп~@$f}H^R>Pr9ܯQ|HTFק"6lwf)!We_S&9=R]Y&MW^[*+[*rK T}TP,9ۜ*r͗g{ik{-ښGxy=Պw3 C/:S-}$d!C4F]ؚ))9{!7U5O g؟E<2Y L{4.n"!`=ܫᬨ橩a?j܉Ѻ:ox!Xې 7,l7MEEgL:p7rhzi|׌hL>#,>c g3LÝ^ۢ\7$Z3Ækhziy qQ*YfSQhҰa\N㩎ȑrPtUTpUVꮶي/hSOYzh=;Tew )-Q%2*xjElMWbTk|AհYf$F#疴GM~R]gFtU!9Ⱥc: 0kkNd/]feq\4!2"X!9|drx)˟_3|SSE 5DɠriTDQa8ڑ[1en f{N$O4TtR\~>[1Lˍ%e%5BFu~\F 1T(wO::3I@~1Г)"za3cî8 ﮾&F kk+ i98<4սt]ώ͌%gd~C!2TQprxxY%+R}s8v܇ˏ)('p_ΒgddSbԲ y/N98PZ>ܬϊ/n "_m1T⬽/emYM>8u҆VA$9*1$jLlf 9''IRJ$2^OM+`6W5 8Q!gÎ!{2 ~ w,!wr:2RWy2?f"9GgÂ{̒ݣY] #.+D@hwW }zw_Ib La8҇Q˚'vZoxnWW^ȦzOqZbQ^{ٻv{̍/Ebj)͢2CX;}U*Naq_3H;]T/UBӚvfA6#|FM|M.M91䨑QSNSӤ1pԭ&Vmk }t}^M5ÉSm }tgj*H.:jiyZX.$8PWӓ|̱7645]r@amQd$Lp1rB<55Oο#U]Ftio**.D{!J!7 ܢ'**Nx]Ҹ\v +#o= w- m=aA6\s~|EG&θU2kk\P($={]QЬ_IW֦1e~2Í#ת鰠XTS@XU_T:-6qA䚡&]TM~c)_T'篋l6%V! κ6'Ub4B#5嬖ʸպ#JCGK⧹E_sZ3cs%\!.A;v'l-}`ɨD2mm/nz2}A;xg_AW5G\SS\1f`io1Ƃze>b~jq+s?Q-y ̻5Ӣp*\kgno0,.662&`zREg?̕^Դk#\=F$~hvï+`~ėLK)fbi!.Sqj V|}Vף#F^ןQWzcU^Եإ{&!-a|Q9IaA*a:4;a͡C[fNUt[z0zEp 1-vn^cmւ'_Z5zfG:Pg/Om>bNLC Gi3Y rCgR+.XڀI46e; b]{-Į1veBEQ Ҥ{o3gɽכg-) n]315<5y_'4~7#bUM? 1gy7<7>$lf EbHD8Uϔ"3z[ 9wet)ʗOeO/tꬰ`{t!LœR[-JM7!|FV>'DD\&cP$ m'pb:$NF$3%:b"k/{i!<z@LٗLSyv#( ]5@&1Ս)2)TQGt-n]MdyUuxFdPh{,AT{g$$Nz e{A{[U4ɢTQP"ģp d1*G.1$߹uCeRy.`9(Ga:;yit2?5Wtk64/"]I< H~$^A_y4.4Evؕ"2N*m#0 ǰ 8X%jbdŒ+,9=P"Џ*)p],koҧܻ1'7^;v>g aa*"e\4gz- >]l1.xI~6V%ș_tM*& K'PEŨD((8/m^ɚeNID#ꮏiBFab5%&&8JHJ8,M\p(iθc$Fohg?璊]Z~bD"hz0qtq:*GS[ ;y;'E@eukX0mn% @q10rd_!z^#1f$#2tʢ؏u !t#CdM8Q_#Ʋ|X$J%JmӈA]eu,.Hшx:^ўeZ1pmD慽-Ϭ]EN6HJ݅8Jǡ`}C {צg;s CZRT-/QpN:@b׿i e &+֪ݭz"tyr.L>DU£dPAPM怷()7 ~p7 U2LOeV}/Qcj+x3zR8&3wn5$"H)h% .ˍdنAXjuӻnxn-sǾ3t,C7Js϶JtkOBDŊ.{;V@+xo_iB#9ӭ#L4*j r]H%x9l@=3sĠ>np8Kyp֞(6*fmLSAmu1gXS.WzSJ﯁wi&HU_HxZOӅܻpaS MgK/[k*?{GF6#ITH${ Ap.>*.X2KnX[}^=0?#[[_JrJo)ɞ8u$E'wV&٩FD:Q޷55.e<~ v ̐?g1ėW˙w;oY7,>qx}Fp1YQ"1#630⺛u u=Foٙ<[|qu pT3YiQ=Ue쟄laph&Z xl!ZSO槌w%ggyŽR:R9ZTY5 Q<K.FVMMI$#R뼆 )iy+ vԇm4*,vXI!J4Ia;_@r|QLecNACu]}iBfk B xC6d.Gm˦*%W׏>gRJYr}W+olk(nre4qZ-J cy&04#(4YHOr xFY嘉a,hIϔ`(Uomƒ6pȃMև;e7>LA)6wf^YXR}s%r$5-*oc~t$cH}᧤u. b7?ayU޶&dƂ=:'~I D`Hc'2 xӫU#[:]a\M!!V1|Se#qq@} frxqA^Ĭpxv[YnlVxW @e GTױ0-вJ+ʯ7w: Qd:ntWxg #"˞յ6_lyϰe4d)9J3{'Y' 4dU9*!AFH>]MFEN^0P׶&TUUwSPTfd'>l/1}b0{>V̀=A#FL_GcB٭}S^qWd"Sz^h<0]a*{%% *Xԕlabq pAJ/ϬyeQ)!17:;qަÆ$V!HZlD%?PoN9&jrz2DI\@e cᄭwqx|D_ޢ4@#I*(-6?}t +r.U7:Nn)PڈS#B♸3نyC%E,o O@In{򩫷uۊm$6jmu󦴄F.|8xm kVήᙘ+LD}y(&.hg$99 EI/w' $ RT,)girǫV-U1#3(ʛ]Koin xK?8$4DH@4׮+j SwT0,{>ԫVcvx.S׽&vYx/v|ӡ7gǚ:H NT~~c_SՓ♞?MHl3RpL &o!LeawueY6aQC_- OMv-(t)W <#hG b㌼<VeչnA]ODZ²yڝܶa@+e}DbšgVXa$>0dNy!T~x}@,б6؞aٽЋt1ȩjr Cu6'9s&]miEz24vD %xxЋ3=655Xv|%-m} WʡFW߼]gQ[3qx"?PHac5 WzAʟ>zd"03Ŵ cuNz|㑽j!^E^1 ᗤt=*xTπ(>ء媿q_.8Pԯo<#%L=*b)[h>3g=yxzN%hD>_jLJy1 g:ˌWxD`mr#9<$JS;,Z;ZEydE7rK <*nP{r<{d~kĨϮUo{kvb-^_3ٹz=3cD&#.v`8QrjdY-EB%2hnߋc'P$&ٙV5\oOm2HRtԍfhYt;02쥏\v/Tmegؐ6ΰ/l?O@K__L(ό/Mk Ɠ)#el-t@} ~9< Tp+H(ވ@O*@뽛a0t?Ž%fM##(BTOZxua (Qq۵aO}Ɯl㙩Ga#3րF-J[<9<3{_fӨv:%랹UN%AIY% *I!a꧃P"cFc?$4@bRdMV94 (nx-gZl{TvxoaECJdrs>axm(Bѕqr5+OQ<3]e|8CĔ)a I0ƿwy|g:2wox9GDl%^/$[3}R_^4RbŠ]s9^Ĵ2$ u6wRk r*(ͩ+).$mgixZPb`wcFQ Fd]IPpvoZ I2S09m%5`x@%!zG"e/Ien̔ЕCҌٟ\f@3'" ݺ?Zb\)L_eac ˳+r s*յyMՐ^;w5CvFz#[>g+Y%ƽYb^NeWUC3zGRV |gLu}z Q>8VAf auc!r;QeEH?\yr<`1|7V5$1^ 'GY OY.%q;Gɓl Z0h(akn[F}M}2_ڎ Lгa_C <HEVw]tԭOd xE!s1&I(.1s."8ũR=ٞKEXU@>m$">'{ڀw1,٭P|Zp!$ej\U+gý!b sa!g=)3G=Q3y&*:r-w*Q_&Q:a+ä*֎Iw6#03x/.*IJtdv{cߜӥ BNIy99'";ibo&,"'˲{" C~5 otxȐfpgZxy1QU#Ͼnhdqi ֜.bDW_o-EBF$ \LISg=("R[p{ ΢Xr yu'’G>1;~wO~^; Y?l{Mg=#P} t$;M,Ef`Ⱦv{7`HK dغt)t(Ϩ0c_Oő$Lf&E%[zJ@E,o?etȺy[&:ҒdȺ 26l$\AXl{=+/Fw^L<@OF1:ĔlWXRc 6?܁xJm6IjL{. [FU=5{Oiuxd;hnmZFr$Jz LݖurR=Hς&05W=hP'.Ϩkq2n8wu7gy?Vg:[3X^jW/ʫ\\\ ,ijaμzһW@xs;Z62H(G4ZxM1HM!2b\E4'kccr:ԭusyf%a&/ΐZi}CJsOw[ky`ϓ!59l~1+nBfIH%ыo=,hf]*=]1><;7HF5ܵtoJ|@>q( 9]CedE`9Il{=3x )xq'6½8 x}k-Ţ(w_g,KK M2'3lFϰ`>U#7/F=rdq}w*d=#LJ~h9{5E0hq>*Lf#wi^ mU]ҡCJMQ3]4!)3+++9CF_Sl|y2XpĚZ.vLDp2:Yi72T7^XZFeBb0s ]#dF:\Eb'P?G+A;6 )o=WJ+kF-&O~C|v\ MHaeWɊӛB ?VAyP,ҫ)!Ny_MR V|w|q9:UoB//hJD&X5dXWHSG, *E?3G 3O<I'I}삏 ژ|2&rzDH/C2X*=Ĩ\ `yPHm, 9cÅ$ 'Ա͹kMdĩ.笖mVZ9*vCSyv>D >CX[Txf'F9EN\!VB~'F^gb/$,^0瞺K)sr={uxɢ%)ƼĆȁz+_++&{~ I!%4\J1XURBm\,;mx=! f̖9z8'pfϽ?B~Po[[̖AY.J,~oPF) x(-l0kN7rryswpx.|ÅBȯpVCnwHğ[̴p#K4ú}Fٹy4PDvTcMH( s,2/{BB"ty^eљw2l .Qz>|V?"`Eo>הtj9N[X #3}KEpG"koMn6Ь[zb'>ۀte Gm+75Wb˷sL9b=xmw$ VO#;w=d>iPXO|,Okfޝ;1 eKz(u2#(0zu@)!̚WEJ^es>shKzg0 ɘp2[Pd9ąIrz.cY*#.;\'3[c}4yTF3k[ ڲF9x ^[C\d㔄> 5=!S2s?,OFamz װvlf& ͻsֿ^6WxH1 ΛM?PVC.!魍XALxFVS?y PGNBGkH kܻ󶼼zHN 7?;Lmizqњuo;G-*-R?X0flzpZP"#(MnQ>z"ktsS~A>!ҌΏ 3׾f&ƆFϝ 9tt1uY#HO^J# ḵV0;džFFO,w:K?>Bod;wӃ<\z=;T?Ķ6H<+{Osd֐@[gЖxW m*?4d[=ʩ9l:{kjYӘ{ڙFFO Qc)iK, NoTLvqxa<*)5>9(=Ma+{H@U iHqawwN={S^X=ɍnyS9DD;X{ꌈ&y1v];&]tHGW(4!<*usT47x8;h^Ucب:_YڿH|[="\:(;'+#c|:V>i%yTWoOHҰ4!y MY~ 3,,9E}hѷ{:?M)}i1''xaEr]ۃ8r΁rK}\Ac6:΂Jj<22b*8c_cBWo_qkOwa@UM#pOWK,2ƻ)/ .wWha\稹:"T?;7 -N]VaQm#oU拔^q߅"gEsRՔ!<S! .ŧDIJhK:bXW۱#`8E]uj/S H+j|hؚd"ٸpOO,>ٞpd )}1=S^w&>oNlUG D%C4, ^%=Ub<3t0搕f(t O7(޼9%szh-:o*)zi"u<3^ 3 *fIȲ=refᮘ c.j]>W#AWZ7*uSӧH-ƫ=z%Щ~ c\Ry93Z⢤G^HP{zs#_Pu 0rs |לx_/{Wv}=:뙳dgx =5g?0{m03E| hG8:Z8r.}0oc[H1!B_hMl uJId * 3lN3vPAk Tk/{Yt4WU~q~oQK-l+ދ?SJ(nwZSDhIlbaׂ3Uvpݲt7deBr8u|>rhominnnoXo#uI\|鐑ʉ#%9oCx /p a}R'!US xD^ bВߣ< * 3+ Yi\?@ykHk)?`|rmJI+oj`_C'IO=-)i_QӎN8XID((($Fpn3͐vD@^OXMLdo+ʪ߳r\ щУp^_&)PwРׯC :{pnH{6 hz[sR_JB}wgb0YW765o*--͕a!Ar?oE.Zk{x~ C]m-]#VS׏\^:$8$<]ycȂڌАQ9e# CݝmUiŧdT676jc?P6ƖȰЄN~pEuj 苢-ΖDwɂ _N(ihljdi]W' 먯vc~skko?4M]>gRBãU6w-RLA6π{2噶R3(@ ~ Ӿ< NwK#w3^ pn78L82"#"8.I ґeP1@Bm#g`>ΎsbzUΉsAs˒(8s8x7w׮N{ rX * *(|&tqyfv+}Sғo9ydi}#0i.=%|2Io |CWچNR8tM.M6U@pҤ3Zq CEˉ?uɂH̅SN’97|hck}7+S~,!jn3z61Έʹ-5cYfiSL\B5_&UՖ Ϋ\֚%~4:)5|~f$ngg8*![[{g͜ɓg>ʤ J?N2idЄ)6 lb_d6NG(yY4ΞiNBX#^V18Du"0͘ w7N0Bc]OB?i8ψ"}UӇз3g e<wD-̙4y rhUX:K6ӿ$T3$H ]NM+g:ǐd(Ѕ23Ҹ7AF2>랆r,+ 'H: }Ԉ!CpzK!3rr x=ZH_2R"s:9n6Vu@VCzdf7} z,Qu{ʖT_sj"R< * 33<3ycf؎gh>݃),UFcTW._̓<_ɵҔ֓`0Sd4վqqSoEβc2X&f>Ey//+ :[5m۶,QLW7nٲ%?]G7ܲeڥa0Izc_L_ w\h (nWlܲe ^g"oTC^5WuAe^&to[O޶kݚMW\U23YJUk#zGv.2m4hȻuf5 `]4=rTNڸz~j48_ Z`~Ls7(# BX}?IyWn^X;MlDQOJ[6Vr歬ox<4i/rڴuƕ N!:Kxqc7U@{э{20s`lPqz2?vLF#<bzaQ Pʝ 6eN!豂X謠|zrX._tϺRG'3kV n ֭@'9<3@gۗhYW\` zm% Eq9\2`56]s]Vþ|ϮDgPATPAy>߳ϴz]:ˍ۷o͛;}!(aBI0T; 3=7ylb/mó˸nRv@kTYIߞKϬ:|=BPn)Wt f}OV8t i(i/{pP# b9u7HW5{7*3s+؊w'ʇoG Hph0?~"^1_w'M-^_mYxN 1V@`^P&fAB%tqyf|AYBמx6s(?Yo=+>=N-a—L;YS1rt! DY˕IBòG3ҕ .R@_3,32d Qәp?Tx1z*\mS_ɏ!2$b}pu-ClL8Nq/H778< !FSIw8h@pJ<#5gȣxf)NwbBV9gfMpIN{(QATPA噉?ÖV5 gQ<a0^ZC2-dBӠǙ͘p{\<U^nb0t TAý^.('? %c.[Οh PgZKvڏWctgVz/3CYφ735ees`Bš1Fa,`)oԏ4 3S'IJ֢?}#`_:?!|>d3_Tݲdko6͛1YX.xf3޳g>O2uB1q;M|< :D"r4=>803?L(\pL 3mye晓_3pK>QTO,˶r EGÑgYSoħN58_8OFaЂ <ά.H".)odW7AkL TXbݐ%3vk>3gc= |tl&#8K|Նg.E$DxR /õ3﬑Ljqu#<<3#ҙPg6MAoS="4̓Į ? # $A= /D\rM*'޽@U;&Fo?nW$8Kp6!_Ίe@g Vgj\puB nPϜL8z_}gIݭQ!Aaڠ/j0ϐɃ}uzV|5oc g."c| 'j# epQ3Y\'dyfr^2k竑A0zfىmۓ Ћͮ v!/\ Y#נ< * 39OstdG3I<[3yA>Uo3{Y7Ư4sC4.<2c3匣AeҼږ+U9sex VcGx0F#0}jh_;7H5~(>B*0}{ i Bܩ03l0ԁ/7 z${3/Ov1=QH:S!3|g>*&{" 0 t2K?I`ƊZU w@=S7}5eDHkAe1ψWY<cLCVʙ(cg-DFFGEEEFFDDD&V ;Dž^:-!&t,&*‚v9f1xy"Uy FPOq Qdy?dK[v982!!.4c BM(0Y@=n͜A1CreOj9D5#{< y)7D3y*>)Iu<*=CTuBLcgn5<iҿ~kjmoޑ՜giv-w`sdS<| u~h e&};+2bIuN#^ N܈W|gk72R1nevP{ r*ύqq4X,Xyl6gPATPAyf"f#8>S3Jk;(|1J۹Xm2?\#8SaՎC*K#b'W-祧 Ο,ɞ r뎟t?)m 93-NOfTğܮǩy$ _V[䍫hvս?M`^eڻGQlȦ,\#b>EcU'0"?)ufK~ *3yo"D>zU'*'Bwd F0 grAQ~g};Y`!0g\iھTa->oXEOy;Nkm{Q[Q^ujj(("8Q $@ $$7!,[G痟MoN=rǶ6k'mN觋.?f4[`950+<&!!P[ ř%}:ݟ[q]z8ΆSkkKmqȡgmp/b$ݘ) {C=_qn$e]_;k!Zr62gu) I#kPفH#{5j&!nw^W g*Xf3P ٻ@ݼzŋ/; W,!r;wyG7Q~;Ry:KyեϝrK 1g%=uv˪kUI/R iL;{5+vVgk :XfݹvE{>R=x✘_E~U@Q{.^l+$6o2cH+ZpC҈(e>9+ &]X[=km{qX.$]"n%\jyq-ǮzVA?nw0!]b aB+/\8gm}4scDK}O7 5104pTYΏ‘pUFJ+*q2CpADR"N0Y\I2 \Sp0S8!vEQ8^iN OqJft're/`TɿV "q}{dA)IOq')-"|T*>÷wn=M{;^Gv[ hajRovX oJE/Ȕ038l7Y򒴸?M8)V h&g(U12ߌ3Zy'GMҒV߮e럻e_1}] MqaT3*y'M=}p鼩Ç ߿acou  >cN&;0Am>v|+JY-.+0 x|o+}33Y1ng|vE>u [3Z/i||F4i3)T313^(JJUTL>CI>д6KBGg8ZT^L~ 뎁Q>VLJkQj'DޔhGc(12ߌE4&ogXua}FƠ~VϰJÏM *&3qg 2gxS>îЇ#>Y ogbq3`=Mޠ5`*ᗃޠ30k/R}>IYs*Ҁ}>cd5ϰYgx>c?m4i3) L)CaWtgx#>^bͅz3lf36|73f|6fЊ ognb<h64ވ$a4_vpo2LᗦLe)+oPr9ѪҰ}? 1>ߌѾlK> 2>_OF|73*3~!+djSv mgx>,3oV1|B=ZD=^hGf*Fo @3"!H+)?M)N-tS(~Kz`!SwD]+]^M/3(Jx>.Qr݃d*W}o5QwJL_=|Ѯ%_&4#foµSI xWOLe4|5)K+XV8jkRWKw^ X ˉ2~=zU#q^6~1S?9SDY]/3LM|FVikf_ͻ3+OQ-DĖ %AyepCދ:g&:a yhެ`e$櫔*"+Cu%UXSB:*"-$>Lm؁1It'(WeR=2G LO+MJ-IޛZ >&&V*([o=ˋWG訂3o>z.͑KKK*SńfxX jI)%9ŸL&z57X3 D\U؎))%i%JsP*W3*yyrjqD$Y*.544>ڱLEU>r^2YyjvYFvٮ~efr\R~2V3nq)/cp3!狨G~<˽&K+ZFoqgJyَ}S4fo¾EÖ[{}t3`B gn䒶t_>s鷌9z@1/L,ܽ'x|рEaT [z9Ёs|/Z " 6wBQy~w\.*,Ex-n|}A%fZ&=:g|ƍMJ 5". >[޽so2KzA]f;2A EƟ& igL rU>S&.k~}mI{-vڴ%`uz{QΓ@J3?.4fxGO98_8vWl󁜈7x/?)˨Asׄތ[..>bsKEWۆ.&>vK G ~LT8'Qyw[*dWDor5p}&'Nrq ro?N]!r3[#!K5+}'OFZ"6J$';~~:t3mks*zT=>Sg 2:=]xQL3 h_υA¸ȘVBN݊;K`X~xIR~H)(/!gR?z&tՙL鋫gGR4ua ^ =+Am*37Js%GEr,wح|W35cBL^,1=^cHV#7dcϫQ}v84C4D^9^}س#xPc>3hh$n'b}l7NGBz/ :|3 ?c\.7`.?~捯I^kxC/~2l? O ) חe;6 6ħP>_)  *$KFPsy'lH׭&_]%*,P4>{A7>C VRܵA ~]<$g_$u4gE+~X*犕.[!1ZEшn'[${(b>L+}:xSTfF5->2:g<{p]qw>nh$9)7i,:iLgEGc~W<3%[w_\B6?hySR3w#+gq>*.QJM|P:<t+^S[5!,?]  *ž[gz. r "b1(C>>Sa4_sϼ>C.#:PW?:kAQ1"U;z/~a_#\Ll+$t> hͪ|"O~Е3uW) VJ,Cys G+ǯgz- rM*Xy+|fmtDeGvo#3BG.NIɝL4mo\%39[g |lwQDY.*,\^K{IFDeoք6ʓ!T;^gVTLTT*_e3D(֗Q}\F.X晬7B{ݸ'dv"#agH?W8iKlh>WLQ$?ggpT:4LZ$3>;bYAa} NjwڏF~G@uQ~e6x՟~QBg ;oe\@I|gT jm2*4o \AW ŗ~ܯ<Ѧ+ņ=o6rh"1ݲX^ [ٿ&>We^hژ{b3 )/V.|TRZh|eRhhOXWQVĊls$d3|!u0itj t|g |=f0\Fڌv gVFGԠ ߧ)'Pdp\m1|sW|gȒ}=WV~LvҬAkB*޽?9i"#UR{?6rh꾄4%|qT>f$6e2ڹgځ73V736ߠk8P#nz^} ^7|}覓>fw¶U^f! /¶]gC/}@ KT3 ?Ȧ{ޠ>bg ROgx>ShgW|73e+ޔdoaЀTJMBJVPTJ>÷ھRBU'(J Pui-[{T f1MO74Qt!BMT#a߷kUj#ht=:'eWQ\nCWW!5Jѕe\aHzۭ8hWѹnt[lN|S_M%T82n(J[5\kU7B)wRtm5.-MMsIi)%*>SϰO PR QJCqjzmS(`ȑ#f䈁-|49|? .ǐ~p?z. n'e-{Qg'p/=]ci93YJ8<:Ց#QZb~0\Gb'_.]Laj8cF{h(Iy5-Vt }V@ftJd\=}'cYGԡaa(TgdoƮɟ>gPPKRlhx0sIj%)>j58gziǘ.YeU|K;-&⸂H5(=deRWN:vÊ,,$)8+gǐ*{queU\F8 |T3.Z}=;U3tW^qV)-+i.=yۡAJV g~NpU>S|CwgoXfL !H_߄wSfWso\8}LHsOYzQlFC;@j8D+ &C] ]n5;aqib$?C'9_=mv5 qaNSsVNsx3u88>=55'OZ8 ò֚(N}P5>_8cn~c>:'1& nf$aK3낎we&Y\c掮DW~Q8[nGVcc[t7&dbr Ýiܴ+*}앆pkOזz;[t8gnĽl^qv*~)) ؀"߱M,1"x8QU>mG*I$\+8U/: {_q-Cn BKэq0g 2\~7saOȊgPj?#Ii^ÖKq]@6um~rgh}hwt'8#ǟ i;LYnEWV[=I3)U w?c[컇YWgb#]CgON"GԴ F_bb'{c\!\^~Ll睥 w\xۋwϬ OXJԪvXcJ~z&!M;~gy+F4cv>s@䳯̕DGhɾڸIֿ^MQɧͧ,YiSzW&_Sg$ƾ!~l߃ ݞpn0unIgr6ХL3QW Yt;j''\fSD3P̖@6#c;zkiGbBiTߤ 2& S]tU~- D9>c;8ׅNcP02 ѵ﹒͞42zOV[M!k&䈦VT1tn2)6TR#q]XD;fjn'@n˘ґZ yb.׶g0=7UH?]~sp斓n/}Ѭ1Mk[lb!8f5>SGO;^wROv\';V(9tLe>_E`z2ÆӀC>Ʈ9ٯcsy#-.LT0u/[X_xvkN421qźVƮiw" jU$/vLL1o!Woo/77 ?xĴIyײﳖ2|+:9]Y6;nKq=Tזgq#g\<<1}QMﵶM]c7[fto"0_OkZ"{ƠԮڎ_~SOoosF|kß0%6>gϢ鞋"A&y'wq4a9w=<:ۃh1Dzr, :\a eù޳Vh걧=sh#Ns׭rDb ~Zs=“W>" (wEfc%OYjuHS\\Oy-LɃ&N]pݹA86Z#N\CςfF*g\ts" MMSi,:݉i8>C} մNϔ3!ߚ:m&[3dN_1htVӌG#^i̓b[j,Wg3HnoG:"iT/NWNb"O_Ggѭty8n,T=LLk5ϰ%h3?wiS~#\E,23&T̟؏SoDtg&nqn^I,iw̴'pJKu= Kx|@0fZ Y{ti~Oť}:; ,VO`Rw_4C-y!NMMM~+Z T`td{9PG\>W]-jI_ Lޛ2 P2cc8o]횚4m9gr͞62`Ux:n|~EJU'gH΋ƹ8'!'8/g`D|kO@N892g\]t"mq# Н\ݢѹ)88bEy fO)+:vqj( gFhS#RKgtwd '># D4EȕOY"tr+.Bf{qJ(K|]Gg(ع8q*kMdicp k? ;ѭbUy98#g쾉>zE9hnXq?!pnr݄9FT0ХU8Z#z@fL~qDWwXrj+MC5ɢ\,D_oߞGl:sى8̟GY0z'<>S3ڜf1Ch>2~=CԹ߈sM=7{e +tu}V:Zc kqU#hӉLL!lz[$Z6WEW;ȤĄxĤCX屠 {j3iDh*^7\ 9Щr= v'~ɽ3|gwv" w0g( NT}g:SUE3rf|dZR@z3> vMK[ 谒fߧ 6k}QfҸ}"uSStoRy1e;u4nԨGÆ ٩e_Lzu G$qohb(2gtK{M3L|qw ]G i__7jԈ yXydGnĬ'9-C=Y;?j|&Q3`;QD*Bs}Gn>+c6ǥ'?^cvæ fuzW4>sfytȇQۥ6 I*AY6v߉wkuvqU Q5 'n7 KA8DYՄdtn7%=ܫL\J|qe_.0Irxzxk v9r>L7\,9uG;V3w]3Gek|>CI>Sm22U ?#!Vo,hfB/=[ >CkaC hݤZ &r^iZ^^O|/3%L?_8(řb3۝⟎fm?LF8a0O|8%ՅZrM ffW=/V"ArRuM4H?tv4uЁtµ Xt,y:Kǰc'.4G {5M "RG 6 dLs][Is;EjR#E\/Vn|h[ЙT5Z<Ʀ̆ &=4Cd#FsvלP `ivߤ E-rtu$wI%e$8.3BBIy!)ITn$z*;r-.ˇH>)y igwENW8&*L;n\a\sqӟ8-9#H!dKȢ,RO2%q7vV?#Bק Ab$=JL6eqag̿38e'MM[q5{R"gѱe3&- }$ݎ~٧/SC4ec)2r\+!8@u6TȌ~fpf>|Ӂ;9EmP`ZpC*N}HCI[[ZFޘזef;\J}}r*صfW941=qjӍVBti þjEE=8{1\}uz}!\|w~;Htm/9,h:?]>j}{ WS6.l=qcr B;nU/TWǙyNt=+cAcѝz&0?Ec[ >:Le?σf|"2>2^G'O7Y~ׁzCֶ-X7F+BSvIԫxőukhbB|b^3,mYP xp]sˎ\Z{ U EK<.U꺧vzj:H]K{D!KЃyunKLOvs|$*<^3gw N3dqɕl1qUU`zSn"Iz4)GsTГźd  ,@'5Uf<1Nir[N8K,J2]]$sf!n_k}fgpqfXjQOKs1jZըϰMs/Ü_8vJv~Ɵmv;|iÛz~(ѠEe]ZGkE ^12nuk(=uOb7\g%'# WZsNP`:T/Ÿvkx; B&PC>Ôuѝm3=jo':?ez"\[7xE+b]q=q^ BHqW$L֎#G& d~QTBT*¸NpBVCuŨ=w1,rR8^tsv{?#bĬI]L]ݵD]{.z6Bz>pX3Uqr(zzY >z9 qr;.m?c4B2Y]%kp=ƕ\]OR}0d5>ʁnggi 35WEq #I!ٟ,̩,$jnY"5ly> )'CYS &gЫd1c~'LJSȈ[J|FJgGlg^"A&[ |$U"nmFjrQ,[3hl43hVЭ@NȡQxU6`tf{tÚEigQ4Fg glQW qM{]NAa^"`>Xgtz~qToג1g^18?%٣GςcR!W{ABBŤ<,Og!4r; 9v#&ˎ؀}go-6O g8 *Fgʹ>MZf0f9yḱ|L$4@~3ވϰS Yat=Mv/|0 BU&+UU- XCV& M, /JXJI&T譹0&jREg*ifJN>ՍC5z=B2kkШa" {P2uk!VUɲ2z :A?ĿԿWh\O{oG1v2#oAv)U(I&OaQmgb5;'Ѷ菭i^چ܊E/ڿ?#D hۊ܊VDVܟpц~ĴtZ~z5T33٘)2F|*J> yAYG_9;CAvSjT<}&(Dz@uǻuEw荒PeY{#'>nI<=2?hLhoh诛oKR>3} ѮѺ-rk  ?F 35cwc]PRP1wϞglNS.yXqy](EԾݻp$2hc*SZ{}^%9n>}.,wO]tO;bYOo=wﾣVXgf|(xG1ёΙٳ ^$ɿW3,o;'ۻgv=eFs l~Æ&M39Њ2G(>a/go31l:hHݷC=@7#mF;KE+t'ꋈ} ǫoDDVD.hQtp9=+Efk7 81' s YAp7܄3Yt {H0!H]AgN;q^rA۰G%#]sD6"3gj?cPV>8kĄoi{XrdjkRd\>3v 'J/\քއif3lxf;uo԰a;?2=Ee|e@L <έ~A]XWP) q׼K'w Ԝ 7iژ9W[<)y>3柎3LMy*j3yQ~ s5btvRßa]Z 73_]瘵] ~|F#hEģc+ڂAnk&Пi q̖-kĂF튪q>I֪#3Sn4rІtE]A6\>l(#&&Z$"O:t'f)a{õeugj3Q~8 k.5 EڋYC[R]鶓׸xyx8?}x[?#p(n/sVQ=mS];ωtRKG9iN pb]~ӆ҆wmE|:L)ڵwf{Zϩ9ELґVg-m|X4QHb\wz *U^=cل{ebeWJg%!DwfgdsK,K⦍ubVƣ~>Ft >ϼ|32Cῦ5wg~;ψ#xyB _t57*/gs:HDn'uL4!,?rI)oZZv! mu?tyocl%uUCA{g'Fg䜁gx\]FPղ UG$trlJ ~8H3?b2Pi~&u/Efd:#YwݑV?4m cϟ~ـo7 uL+{z.@ t&1+ݕ }D mMWP% 8ʍޖn<.. 5NOуqC _q|)՝4}[G]Ӹ6:T#<_"8+9So qcόg63D|p?z:q#td'lBwpz&rz0;+'v7iP2bzt9+ss7='m&7QhHH'L>;Ī݂ɔAuuXVyj3ݒӖDU:#6}{G?v<;'v-uR'.A53clO] Ѵj[};5Q~bXOêg}I8)я=1B$|MW:֢$7)HofA,Jg葙Q wXcD!|+q( "f@>|>d433cn!WDMrz\4vD ޯQ~}m }bDַ/Xp9yN{[ >}AV ʉUϤܱn`O耝f о-=ǃ>S!_s݃AQ?d(k3H6L7Ҫ ގg~A\G`Lh{՚:9O8ǑD4 :|E?:yb&`nqRU@gs+լ܏ y>+t-VŞ)|fM}ӈq3G.p531*_3M5kYu[]t ŋmmm\u*32u/:`/@Oή^=e+WmmtPͨ ?uDU̧|BߗdF|@ 0z[Ξa1b3 S󙘛[M .N2Dy;*s ҆)İ/_=;q>hƅ\y8CBcc>3;$,x>#&& R!5M6ܧ3@{]݆^t|PVψ qˏJg8x~3|33c2>vڢUÚ 6sM7b~ t-84U冣IO|Pɗ^ԥ<֥ۗ5iվ,\PŒF}F}nw< ~R=)9\ipHYҖ M>0bEZug5뽪#}\޵T 736$.A&1)Řp|34芶;*L/yl%kp vω_1N>wQ)I5o FBLU3CI}Sh mE+"mjk Y$h(&@-|gQGh7<'擘NĘg9?%Oޙkb/2Qo7Am}I}S: /}[7P]Ӡ0a`t['qiŚc* fQuއПt/;Uteewn'hGJg#txGSeB >\jj.{NZǛQ}x#-ry)Ap$suAڜ陸;kZ`WT?erI8z)ng.g!f%Ĭ~L_zALF ]8?]*0dn]BlAnϐ8*{sųĢ1e2X*ߣ3n;1sw9RHSa.8jNǖ12mXlɂY~5H ;u&Oѭlè }n}e0Gn֟y>C*3:otiɆ.U+bJal%m lB篘cZ$X/3|e },ejb۾oF 8[uf}wg ) }efijJ3T3?S=ew. ZuM\^`xiТ gݏͪM LXwA'VL_ز96r(D6k+;\K՜Bn7FrӞG/ݺ]O{|Tzg]ܷLZ,]_6yT3g|ܼCc' d۟vZg2$+Lڿ`ڽ~=A%8kHSl:mAtivuۛmQ 7WJLݾ$.sy)е?m5;~Hw⻶Weӊ]jѭ SrKpsb3^4?rK5v rtm/ZN22bw!yjI>>#2T.qI13)̡/pЌ 1;2n4pDv-3萡65Q6W H.)L H-SzHU/JjR&SۋJ ,+LJ MN\^Q0uYq,]Ј bHm<fDGGD'K* enz}zqE+2m\ V ԓب𰤌S oh{D7;UEł` TQb^bo`/$@HvgLfgg6q^f7|G>@g+g n3 o3 FPnRPʗgkkkS'NZ|PH~*͔>#WLzz:̘1g34[o6g222444{{{hNi|gT|FeE3X>>BeG|gT)QҀ4MD/^Z`4B+#5 2{,*4{DE7o޽F% "iYb#J ʘxHYҲ|)XgK&XHGV*D '>Ñ!?q|L(.ʔWv ]zv+MMY"P {(2ۄ,Qrh D4{\,֮?[kS b!D͔MN6G7 OJ9l)-W|3b)pҘ<")=ȷpR^!f#G/89 !Mш3r~:r 2|MF&L0ec4"̿_=TƎ#Vny\לf&d I֡y_C>ݣ< H)V7Mi* {,iA"ii[UlZmL*$|nh+7xV."g;{Nv:?Zt9ߗR#w#7 /K#!6#6 { T\B@^Dsp ]g<ȍ5hb >.⢏o3|rh5rg%wh>Ba5'Θf_C_CVښ؄9䂊y9N>3Y!iߋT 4AQģuNKw8vuo6nMgh\aS ^F:)*@A"GGq_[Bn6rqÊxGG їʳ0eB?·>STi̬g俖>P FZP` Xz =XvR9Ŏϖr˥~ UI3e bbHZ%ps-[p?~mHr5?u{\}9]Y'߽{+?%ly*FߝݾEvyJ_ʨuۿu]<.|VEݡ΀"XWN:6!&NP34`5r<y&I( ~؀ÇSBDߝD_G^C3ST24)|-%낾sCTI[~:: f">w>h.0+/4(l  B_A>e-%a!W($ ;\sBMEnGcCUD9gD?E.>gkƔF<1brY|?Ν;3BEF IѵЋo*ph:f6g-k PfLyU5/;NݚT/K}l/lp*0Jт ϐ'wN}NLp6cӐՎg"sV0Iy*VɋtҬдXD3`y=/F9mOW{pR[plNLKVÔ-]5TyTow LQԳճD6wX~ž;8+ģr gR^ZuAȝY4O]cq7BC5d'ۑ剝9R_5dd䐺ܰK\\V苜\Y0y# +DnSb>Sr){y)A.r|rvX)UaGB|>e/3  UQÑ'}gUn Sq1~ژ?VLYrc3pdߪ>Fŕ@-^N[o$PVh>;VvR@^)飡 );WܰK\]fr֤y SoB eTY'CfTdub%9~:3\a)xbKcJsuhK\f]ѫegz)_/ͮc5c#xhIĤ}mâcXѣF랞bƂ :G1&!~oWKR=*s)ct&ZY}EF-Io~­؈E{3NKS'qtKD~OLZ͞ af3 i܎(8Uk/Z^Y=Rְ\UWL#y6|ɩ{r疤fg*xCAwȃa uyרK{g),n_Zi5gĀ45t!ǭF#JGhOF 1%17oe-6wfng䄾s#ZV.- A|L#g'D.r acшX)D,H .TʥK9hb(%T[1Ά_׉H[)M檋}fJ|"4!ZHĝSv/ȳ2ch7rHvE| $\1c3ztۑ|&aל(o4L _|j&4`fyw^ZK +HX[6Y|J1󎨮rib|f!3;{Ka%ں0#{ܳ}TFN:yfyu EQ>#lG"X{Ѯ6m$.Ǟơ>ksɪ{UIn\_FJ]euJ[ҩ>#zt~ >3wGϟ>|,I LƟJ酼A_,C.3WO@27z04 D3'' E_' 96̮Kr{ZGn&VyLQ:!F+sxL㛩OS%qGg]oUj-rJm52_mM}fq8.foFs>#b\6kep4; (A3X˅I3띭{O6v3`/{3>y,ۙG*7~nd}[y* g4m.o/S)C{1ri)Af|g!܅Z94%4um>ʫC+C9A-H gz.ϭ3J \4]Djճq6~_>@L*|s\5>j(Iuv Cv茽Qo#cKY܂Hz5ΒȯC"u80VGr8Vw>g-V3SϸW a vJ<|K~ G>EN7xEb>k~jFS1ADJg;[[$}3?kU[vX3`{@H -Y0u X|ce/t[6QICJh&it52+#?Vj>á}ru.{P>M9n@^e^ R?* Yt}oov_Kk=-01vSZu ӣ@NT\=#ДYS 44Y]5P(DJQ>:$Z-><8spb\yQrXvkRH+B>>@ynnC%үE/u+C&!Sx*c-r8N9>@$Q7kk7|Y,a?k:\X(?AhlSSR_ 4/ Qτ^wk̎}`7G35Hm  1cfs@+)7j^w9g7'5oj>SvfY>Ll+u;c6gLV0Tmva_zekkc=uˆQ \/IAgbΛsK;qD+9FKޮΣ eGfoF6ZgzjҤ̪ψiNkuW/Ԫsf>b"~{P_uլ :h3Hn[3&#v3VgBhEoVL Xoy n\݀.ܞMcA]$<*lVyu_y-y =їw*qr˞c0U;3Rar{W쮣|gkV3ɃσԌ(Ã#~n^ f{+'9|IeG6/.`?5STK>#\}NܥOY5mO&hGkg4eJ=ovܯgIoƵkoL&Q444UKo/KоZm{p֨Co3][oh54TUTCq;;i=4]ΊX Jq:.}έ9 ѱ-mZBC]}bkʦl޺' " ܜd4E!Nh ܦ2 -c OܼLg^ȣȉ>Ah$Wgf*lq0>S'XXZNH/.KvܴR_""bUN H>QXk&PD!RY-%@An۵44;͋2rSSS22J=9))F#aב ut߅\FVQ9e"@ƕ5+)LNI+,א  -ͦdHIՆ0QK8 ZkC鴌RP" J 22332KʄffF?"X28#JUUD,Jifŭ MZIyaW5ʕf*ɑ jkJ O D"V",Dz!T:*KфR,l)OUJW@3?kH֞U(dSS %B& q_rZPo#>9;ݫqi9%Knw!:z%@-Mg8Q١F>g~HĜ|mZ6os]W_j`3@L3^UT5(w&+rʙC޽|ȥs^Sp 4gI`М>S5fg0JKK_ԃ(hN3Y>C\9CoxLXLM.X>`YC;|FLi5ͪ里o &)գaY?S=n gTvSc qZY>7S3*䯕>3D!H$g(e|3*ϨY?S} }}̪T(g{ q`?3573>C4b4>C q G T_9#7E>%>@Sh 46W>o q4N}!Pa>@Tg8*g> j|3b:(qg.>#!@4}F{DRi3Dc3 w G_X?wT)dTQNGS|3}FuP(P͑ı +P g<>J"4o.2u?Sg0 g&\ޣ|>*R3w3aGq"'JHf'Ky* fGL*;HGG/g8?Ϡ("AU+bΕ_ EB/{<}`y.OBE^@c yfH$XQ3ߌǞo/dzv!gXVMV$ā|W\LH6?Sg$7 .xȁN[oCu>#_ՏXF>\[tx|Y:wy `> |{?/&ￜ]cC<7xnk3?(c׬ܬ/fE5^<MR,M/c?"" -%5f"\K\n7X#(uQ+?G|=b -@.˰ҡBY; &Ѐ3P F(QD:>C\9Ö'{7zu)y$wZ`K9gro,.WKaE>Oާw)`=WmKSnyQp; s_ >:)N-:훺D_J-LOOޣ8Tʉ;/BUh֛t8'݌މO}ZJ7*ROJ/.TܴʬbKo=}T x^x]"Ɉ/{~&y$׃Jr*}*Ϋr!!I~|᥷n9_% xMg0غɒpa&vdK~vd3#"(a@1C%WHg؄'|>K9&!~Ʋpg{TgP̖E.3ډ<:h>ԞlHǩ^VCG][@+G/)foT,E!(&v))NPn<髨}l㗅p%OOɕׄ4M×q[RU2ffzrl|ߤ)(ƶd35a[)ݻbDv+¦,M7 BE>- 1w :P:5ˊ&xtXti0,a B̝v4?vS9n'iجF6v!c8 8)b1О߉:zMyXuY2& QWF @So+ayUQ7? YF[:ƅ(r<<ʞ< ExoBHD 3CB03[~5͙?++F>3h>|Qy‚ qsC7G)Ch3&Na}D2WQ bT9Hn{DY̧ v8I#s KEXJ(󽢰(2Q(c"iVNTǃa4^I09pƐ%C[ñR$*xF9 (8#>؁C(Sv8N1cqjG`8{F ]AS"s&9GML$‹aFvϓy}Ri(i>oebl>ȓ Q(*⇗̥.;#|- %5_d>V[|I%=o1t3xAԇTB!=Lˢ-^C4}g"Mځ8l^$$ti{Ϥx=/)hPg#%$1VnZ,|M!k#hQT@\qǾI#/*W$δXKHbԸG\Z5dgU<2|ED3N!k2% ;/gVLc/alO=&txA%:PJ}D}%* vKh>4sшMg&DzՈ$VyeDtTu\<6WjzLg09jA6>[v͏*G̵;C/ ,$:\ܐ!}T q&R\=tȒE6gT`oj񆰪>;.;ԧo  *RIqʭ!C?+|f.r2`R&3}feRz"+ȇyXjy! fÉ:؉7 @P3Dir3ḅ(Gߕ+ƶ(oAc>s keu̦D|*2#/_1|qkŬ* w|#-_OX$b֚M!e̘)vVGa ّGȯyan+3Tz t=ry|>*)3Bvs^gP~ygҘ1I#:Y…3QڬgSӚ,Wv@tƚTc[l#x3yaڻ )R0 里3(s#u'9Ȗ+y?3'c?ew"_Vf$~>ͷ߉mr5JEie).'AdIQ&g0ӹ!ҫ\c'ȿd:0YH#Ducї,ύxX3O ~Casd0afgTfȨk&Qu}osޙٸK3K{F9'LLbT+;*?)t$a9e∓إTG\oz[@ SR$:8ysyEo3G>񤰔8Sa0oW2_YfȢIK(]2TfWDOo% Ysi]i~ A7oOXy*DKYNB;w>RlYE1[Bv|>YajCv33H|Fz0']NE| 8^"SN}2nRy8Mgx5Sc5 d\զE6tXcL<:tAc+Sfy Ƀ#SL^jw.qw `P=qK5f+0v=xE[8Q.?~i˩=.ݣ(ж& ?3GiT}@T=Mg(\X#zb`!oGD?G{d/c_N!ju/{eS.6^ _p#zڎĐy]0I-QE`)zǭ||/,.sjd@#^Gw$Y{P2݈kG9FVTE,DJy% ᷚHeLa)C(%|1O c~PV@܀JNzE%Q(H\_rX~5Il>^3>S׿((}F3Dwe|)%EboDؒ%#nynYMWY5Gu8S&@BK2[e>_$j)D" jRg修Hweͥ t$w;X,p ےM`5(mK-3VJ#Giޙ:СvNb;rjT}F8# \ztsi~#{MNvI; )Mg͈?Vt4(}G[T(qC43|/!ڊ3}43|QWF9V>gڢgxH<L1/je>vL>Cܧu U­%(2(b|>C ֬>("<7I˴Ze]*hAt L}gxđ%3@gJՒY?{4il)L=Q]e:@' PϜӁ\^9ۇhg4||6T-}8 g* qrN %b $Z$lf9&"td0X9 ׹d:^>e31xիDҨ B$".Uy.UE9)y)ih )I)EY%l|s4g2>>hvn%wi9tiWBN=rJĕK3Be f/]D(({Ö[M;lc&^\-b9h;k̈CZ;qhseG:tIs_bw85j+v~SlxDlz}zÛQ%+vkf) a=1犝y;_)qg'Zx 8>bE5OƖ3īsN~f\Z6 _`|]fԸr gS߯&Eۖ {ZUvtS+2U4\ߛˮjO oFI|:v:stjn[>>''`YsC]tݵ3nopSu]CݺtҵN.LCd?bRgBTg$|ZZZv*i4W\bEO1C6%nbuԣ IYElˡFN)_bO5;[1+;;xfa>6h{y L& '}Z`L\]H-r#NCH +s]|](g_6;a"1LOeX<;.0=:0gG$IGL1x~ܱum7c3y.ԒqkELhͱ_wGO).b@u>coɓrLKڣQ\U$g-xy^ro߶kC_tmSh\mi2+wpƲ% |>CWFu|F,cޢL2}xnGm6X̆9ĔbR3LO$3*  (/ ӷFێ_d+N}hF"9{LH7 ꠳N<N#ϋ>[Ԧϧf*MǬҠbQL&>I{a`IsLoQ|wzhUn*7p`׶-/JSA"_\n=skF">][Aƕc#|ެfg/7!=ZhڳKw6T%9u=z9:xLJ9%,4=0A64gT<FQC xrq8}jd~-퐍N2|7዗u$ew)3sCtjݪ/ڞ/s Ꮝ:>4\5iӪc1"/MqӮ=޽vE jwuB1̪R7ne"'0qvsN?bAN$,JӁwmv3 q>XM{Yvi?ڵO`&?إ,].& O4sP!R}g=N0wӍS-{v7"(xaWwCCOn.ݍs% _H%-ۭFO=>#E[' Ē~{gJ :fZZ-iѢh^K 1jf4}E fm4;پgTu۷"ڛcn{k|0JgkN{iO1sDIQԄcZT)ff;t4&%5żŽSBŠӇ6 !:]{G׵ǰ+S80- C=tv>],i׿;K͸J>xAyWVij4b:fPD)'c7HM*>#fxvjcXlF\s=&=о:FdR*HHH-g4uF3(ܮm5türLrյ=d3-tOU[Ru>~i sFtfӍ/ OJJIT7L,/牾jibۭq= f]M7Gz}> BEO jw>d0whr?wu;d~#=b> Q@5TF |:lg Yd>o`sZkXLtߌf[jՌԮ UAƴh~J$BS0hٮkO]쪺=k[RN+b&@{gSK*>_k?f)=8?LS__vm0ZzY:?SWgw|#f~|(xmOK|-v폎7>*~-xuyG=jɦ[*COP>jQQ.z=NLSP]n㦣}k]:U77.uĸA7nvt_ts_R5>0QbT5>2 |8˦ l!>Rc_Jxtt|+ D+kMm4f zsXݎ([uXhWׄ1_6w/CC};1+V :"T.rB:6oYʠjb3Mz11uyxi^Y#]W_)ydEm>w/LYKv;aDCCgm^[\o.檮Gђ335?c*+4_PL?F]]nSz^2ohbgTDTTu9WgXai.Mrjua_8}8JC|7@"kΨ(!?MZ86Be\x %qg>w kL/ԱEfYNfaZXܭ%p70^|A͵ |a29|x3*C PgA4ijB|_BoݞDnnĆIR_zv  ~׹GowVgjo&etgψD"+ݻ ~`l%v7lx~)Ʌ:hR>6^zE4*sgi\NIQq~~1ee?YTx|^g`|3lj|Qig># fʳrT|gekVڨ}|g#3ʱ5M#CEi352Yil gg`|Og.7{54CL(c7؈& mIWi$J <ߑTFK1%MBD̸ZL#:Po2nffu>2,VN+.势]a@י6! a+緎[>c~mSaZumѣ۱uaoH{fҭ?ιfs C$̂,:C\2C\`anj6|[gn"~>C[Fm?yO@jD٥g~< EK3t[hb4)@QEs#yyj4=b܅3KҽAO.pqrg U~1<-K_xQmݱe*( ;Խ[I3G9SK>]/؛;}.{C>83¤gFX?Y$vF싖\ur >|!`2qp85kVFP.x̆qi̙9HuNկ}HvOĞeM_CK·vv=b TJn:Y?3U7&u:Eij*WN4[.nogT6ɬmb ۀ QJәN1WwW!E/))+gCܲziiGUÛK:;_{|]^$U3:_b?Kʘ20xrjZU^PDR;q30`;w+lT"fEdF礔UQ"J6#"> ;2KYQ 3"ie噫nN5>#i11Yщy*("=ba]]{2LV^,@^.0g(P SV]L.P1a-29qQ1y꞉,lb<$=M+)H|$7n&'(U{O #7.X"bbT*bqY B6=7م YQ4zmfıa^9fB<&V9,cgEGdFgq"aWd-\6oJ&W,pý{u:{P^>~FTȋǞո,I1}:2xj>er{ SchYqB)>SP3Ĉ|/l>p`SWL%=-v;u+{9X}XEr"-r5̼c'O ǝڳd(K3YL"dkl<:Ξ4H֙DE1cӌ;&iwƴigUJiϱ=S&ߴæ/QU6=ڱyCd>b݉2q>x}!f5u޺,5 $IcSgu==,RhfA42oY[ 8fIʪ<\KM{68lbqvݜ6Vp#B(7}'PJqގW8fn&O{5111QSL6Uf(Jޛ`CDlX(ޫ=70›w{s/M\K7o\?g,O͑YQp~G9|Qf,[-&;O>$U |0kΧ1%|=mCN^w0cne ַ1Ӥx=cdk6c٧{?0zQ?:+N>'~Xp2҉ZQ_]tlU_8t6 9wl;x" E?<ܷJ{?'*bڶC^,_; SZ&o _oZ^f?k5I~4}avۏmlQ1>APtg:o==X ~ 4_?gɩȐX-(!w"rY[ EWO>7e늒Fsrǎ֏|/E[閜#/?zPiܿ9/ፏЭe}O=x% _i]4:!NVysxGs={f9|F覞i9A{7|xmq񞪤w}kywy';J*HOZx_k]Mֲֵ߱8)8/=(oom+圍؜QķkSsaUoM+]ؠѢÂ?'u{[jQ֤z!3S޽-Dlzb}-+NA2Ez{wz[ښ6}/Z=wreOW)%wF"> ]븦, >)T};4-Dzb##S=myZ1Ο'W BGsx.ab>:">Vw/TݡЈyFbS[ mCm4-kAb=-+!2ۂf8D-tHuC}}:滆gӢ-UYki=S/-ui7ky\Bk.-.;&ZOOl+ѷMweݩů+ ~Akiq_~{؈k3#}MӲ;Ɲn3THSekcDA.%G}?άkavhZxp37C[E6Z:}ʚ15 ꙮ*z=#OSgn43w}#9{~E{{k[Z%L/0߽^tn<}O<5CI%ժe *LV_EOoC>dOKPϰQ֊{ KgQ-y~}۠ $*r/Bl@K ֘bb7`A,pDž}g6lv;r3~v&"a%iY8 E722BFҵ16jq彖{Moc&N<˜h)?`&fb*L`:\Ylgf`ouF}:=cBpY-<ؐc'F37 |.X8`H6:V}>?^gJsB̨f#GG[R핕~tD6&V }D߯8]]t/p-ϕskŤ9F"L(wނEs܀ -X0Z\?-/Wo#l lX5:{E觳ҟEfqV0h$!x66z g^tC(7sLF/hh"={UCۢssf=zADWz\Vn^|?jϿ9ŷg4ziQF.D㹾Gh={|mTԭe~G3r)pF^]tv XosӭeoЋs[}xn|n虆1}J&qi0JNb;=LPD_Ͻ`-T5=?l&%3x "c=>B64wGF{}yv3_ mL8^ƮđE}LNpINeV}c(mϐ Nr.̿six]xlR8WEΡY6}tĆ&3|n)\qq>V:}z y =z{f0q.礖56Teƥ,Sr=c̬m݅ߞi#$LͲ[ꕭԎ׳lRRn36oI5g[Ϧ=ع16}i}i1TIXi~z&D%4zimhsor z@Ǻ{*Z٢G ņ\ff3Zj;Vuᆳl>=0mHi"%gu{tR2=/77zi[mD}hE́3i[k5@& ˻3\_lk.& .)l$9 25\|#Ls)f{ Ԝ  S; t߭%gx-_ l޼u_zjd77ܜAJ$vwQmOڲIv9H |Os/Փ uQnꙶgz.YSp꧅O7fE%"ѱv=5*e@J?#=5G3MiS]NU׭}WN4BAPkH_l}uEVPua ME"\ e.Q'>(wFegt5EcddVVLLU#ꢸEZlq̨i ߴE"3b)rLrVwXWv"D{>Ff鯮8鎃H<Ǹ =co}}"ck}zݬ gh BK3,,΅9 g8Q(pp+]3-CLuPI3lS:tVs7O;- [vh Fy->L{t ufF h|zFWiaRwe'=ALWiywa; Fp.,^|իW=e CkL$ر^xsKNjϟs ^5'=Th {;zA!%aVku}}c\5g?a6ya#뙶iٮ{EUj/]?~71xxʉQQ7S$^[\{.'Ƒbm=$zfݙ”)TXw3CL+ODV}> ^!_3\KuQ3},Hz_{8gƇ87(%=SW} GOS"kVT2gVl`jyt(77ON~~~AaRi9kko?54-*Ci=8oz1_WRYx*OQ]0q]:>ؕ=+}; 5xpu̇^;Q9zy[PW44橮>1rg Q3.zQ7;lZ8wFߨ*+Tir5RKw0մFf"} rxu_jUx~V>314T2TϜIPgZhLEbR3mU,<773茛 HoJT3esu}lkK]=FᯪgTnp}huĞ?V `rh?><0} .tf#wb{ixk܄Zk_[ߜ7GY#4Tȶi+4z= :sf[/iQxW7-Dj;KECcEu Jzu.q fM_MۤOUf$Y_|âS;nXuƨ54l}Nh peYnKʬ}ύQ"q&s[##[#=^8YU_q/rab#Ka?UHX>=h3(co!` gJYW]kNHKOz2fTznkn)KX:@Kg?M.mk+(bBTUϴT^}Pz}@R\SU%Gn|uZǿ\"%b6 55T3թ||%NP!]JjG='3+WXM+s; QfTl[w陂[ff"͙~-Љױ¢KBkm#=W%Զׁ:L]^ftlߚ.0ҳ[t;IM9|HCLc+u Wj.\u8.EI xzF1F%FLT~UCCcϯV4|b-?~k='O2PW5zo{TqۃBѲT:FIi0+ ? I]fa/L:z3$ԧ鵼YZݻohEJ_بsٟgGd<X_L6Cй~ 9 wMgq_he,SYcvյcgXS/SKv#vaA/oZmˍwA+8m6~hiZT6.{?x$__8շ54 6t~v\nh#1w5g i?Wk{ޖF\g-`OVRZO,,ꮞs;` ˷f6?̥fzb]{M5da&b!۳H3z[\;jdLs;u5z685$}s@v򚎧,1]Z0egT%|`̜l mF-_8ޜJ}}ˢb\Y>3 cy YHv~/_o2x/>f_5 uѯSYfы?s@G1&khosI.hg\|o=[1_,#ſ]Y^z7_z0j^IU=#9;W^z^xOEחEK{_W_yuvsv3y_{2敷 SvEb^a5˫W Xs$>7خ>/bRAK;SϤy3дՌȜN#F}4̐-\hJG[d_/o]dqɵLV$zZV}Efwhcmy=.p[ysM/ VڦKz"{jSXkчڬuUHnϐ5}v%ZVZ%62l>:&=P&|by>mDgZ+Z3n.4F^:ֆuߵv1ڵhov?Mk;^&LIdzksW3;gioζLsaCtx}Zn3^ψ wۚh[ick`c6*I4m*.} ةXjnˆ6f{|R﷫ܪWuxQp%e9mn\{yN]DܞEt h[ vp=Y ?껖 Ugh(]z[F6>APϨ3*+ӕz ՇcF>b#F\8d9+ןP\ IShTe88~MXe[YRbS=L =v5FHO1_9fgUҫY߯;l0v#GgOz]ވQ' xn/_i9ltiꅣX; 7~m.ޑ7'vņdSEi`1Z֪c,u9@ұW5fsk cF|:buĎ䪮Foc=oV-]|ivщR) z?yȹc .jD+$HSvzyM.6tݪ҇*jB$ IiE{QBj5Ɖ$--I[c b@=>C}6ܩ{bR+kG*$lǞm~е64=sQ{*^ߘ1pr+]SҮN/4-fG~]hƶ3>H^Q,!mmwVA3 c[k쓣gVm-EZO?^R4WavT$ :WVצzzJhzO^_2n0}p$ DAzFщLlif/g?2jZۅNjK4m̌M䙩WSuH1ܧ}z絿D}k}-i!뙼 wmK^} |xȷ '35iv\gCC= HlUH[X$2񡭭֪z5~z}g?=e}onhDAz}eQLu3  <=M3z33׌   3 C}}#kP   LG:3r33  <=oƧPgT6ݔ   OEt %'uKjP   |5kZJ(IA=   ȓ3NlJzFj߂   O^"Jtf?   S33*y˺׬   O^Ϩ)g:wzAAAg;f}F*g AAAgxy*H8xبL.fT~F=   3z=KQ:C=   S3zFMf~M   ϔQUS#b   36^(~F1Fh3  AAA'^VY}Qod:zAAAgTV_:QHC=   ȳg3fMPܑ   O^ȵʦ2zF1c\U AAAQ-SMZ=AAyZzF c33  i\ʥS3E   O^Ϩ, T N$KDg2"1ǥgП@G$66?\=P[=v.3l'd/V(K3pf| z_tߌOC\tO?V߃䣐|`7ʳm3mfC^ٓ~Ǒ΀3 >6BDΘؙpSZJ#eDl CiDrh!k^{vۥ- Mi+ij]x2#Kie)iJ h٥2eSsM+ 2L͐̚"3U^cˆχF gT6ToK{Z9^g3/ecoL61,Ď3֐8$.!\}3TDlTy)䔨>RlabƐFEœ3R FONT9uPZg5E}6>)=8z@8#qWWPF⌕>ٽ\Z[CfOҒgtX b.A3jJt\鶞-%>6N>Ƽqz&x fz'>{_hSrAE8%zrHc_9#"Ǖ=S|y C'P6pj7 ~le,^킢C'>C3P<ôBVv/7&S9Ro]taM *W zf=(W* N d(.(z>ZF%k3*hj"\ @g95vτK!p5@IE;p5Z= 1$8 TH qj0Rn@i&܃* B/y*l!ڋ:=^{J]Zb"W\=)-(y)mSv#Ptr &ܯ,ܑ Ai߅6qS@N 4)BY8VSpm/HLN{ JoB#d_p@hQ/zT(Qi]1=<&|5w7 >b %kP Ҋ|5UBFfI6)p1.((VH974%ڰƮTG@B0w(46VkYA^PsjF-397⠶AoPeyPHNLd#rcQA7kF9 {)@Nr&AlMv?= D!.d%$nSȉijn㡲FJUIT̯l>8 &n !TZBg#?΃%@?q9p=ݪ/c ky(9V1 ]2VZfݗ K!1^J`2M"-qqC"8vx'NHNrS>؛JR59xḠnqfB~PDrp9KroJvhq_&r~'$lqƾgndVP~ˢ)qF<' GB=j>HG ׸sp&YW ӧաKjKA<(8\")D#~3~dBПLv quHZ{(\X[ "ٷxek*.ɥ+EF ES8G*_n!GVs7{ÿIyذqLNٕX;:VG#K$lhJ9\:4PdIj)bq񵀜b:mLv$8 Ȧ6&a0W."-`scc̆_1zעs0sˇt_BB?6ܥkljD s<,q+nv wɡlv:QpsgHI+RITaj( ;NC}ǐ9{>*h- pݞ9Siq!TREЇڹ/y6 c!'MAPtget>wP3pAxoT}gzw0<;S&/D$Kicwi cp[Px.p鑰m2s^"5jhB"ܩ]j j\eui{)k9LZ5$)KZux+=CLt+}aqL.($K86ܑb3>L? 3$!w.U}ZΌbeekԣm5;n-q2[[5B ܑd[?棐[ȑ5B5F5ޒ {wPyTyA3;j" 6}ϊ%1ą4f6Pϝ'1 ;7ӦRgsHU|}ײQIb I k 1a"ᷜ Y;7!ݿN*sʋB ;L 3Ӽ7tS) }.4_$l= `O̅1bo"C'[- \fbExad@v\Nܰo/o!p\ =%Yv,C`yZ_ 쉕M&Nsm!>vۡuZ䢼 hqߴ\x [zi}pNe+RV3ЬZ;)h zgTviiiQ3JFg+~ڮgTό$ ?;ö /9=oe-gsNP';3Upv9 _ CHW7&r+ *􀐍5$fm}ߓ?F\sX&_&B9D!5WDmf.j3dϴ?!$֑`7 z T|C\$eICA2= HqxrNaܷGp 8$ 59M e=SAJR/AArz M>r839 (%7Щ}kO ~@rd_ڹ@Z@6e0d"`5NAnw }Xm,0v{9^EշطfV@#\I&&l3W} gq5zF1Wb36! ށwZ8I !a:dCa.s;.EKLXݽTZ_xzĵ?di~=VM|ͅ~d?*<,9!mn 1pƇ 9W^4m̝GvNV0+(lD{Ъg9uQD¸6CEIejy2͔Sp/jKs!͍Le-Z=b3^pqi33eβ'{ a W$f`9w$«P]#-υ[g !m wSoIJ׮_ђ7$$t}@6fC ,HXA-[_T f rr쀒d_)%)&!S=@,6 w31`ٛp'LDw c%<hiIz3^#toɆCYTu";: ? y ⽉KiC̄f/ 'x0X"[1&{ɑ%Ws`Bv0Z3g\ŏp%=5"A^nTA#31I0&nᱡe(B;KrI+H6d vˡVU8nV5ZK ۨg 3bi:!y*,a"E#OZЮ=7s2 G;0\ 9RpڷYKMXff͎K"'57pģ^( LMi60?;Y@~(N#+eL Uǃ p6>iiYe2!'.$sXVr$ e%`. 3p%{ggnui%p @Ucyy!-KHLp@V<\=x,\= :岄f${ɭsgl !iu7=hdƑ3{hKJJA4瓠Y,[kؒGd/7N؏T).g0g.~#\e40?v+#)#B.@n, .>D&|H&sJo =#B|G cK&mNg{pz.ȿ%9Ҧ.~z{!ݤerwS59p6{lv0$mHz?K˹"uA`26J[!( +3!*HRiO;w\kRɷSޏЏ H& g3*jd]OWHމ2ֈm>^U YzF*̢`̙;̃"h ^ HrEq i 9v `Dx!:{O\e'ȌF$g՗[یg?9T5@H0SV3Ms zKKȑ2xduoJvNY)]HUϰJ&)fkQg| (>E<*8H(qt(oV3P¥'$VKn-[<_>f_|1wDHFRf.ѫcz47ѩ/;^nmAp='> K&9Rñ${^V-pmGuD\GsI[ =7+? Z-+kж"crlު nF1x&䄏Yg YHnkTGQOSp-< Bݘ=v%Ɛ( *#F9i]G[-:WުgͥdT 2Ct1Mk{,-~=RIoϙfO#!gK%=ž7~&~ %w]g q2bs,Ilags⽶bsE0ۚk qh9ZH,peK<=dH -G_Y(0,A@Cv3JK¿JYq=n&1l~z-_5Ӝ\V,pMY\52l_lۈ#Apz#VرDXh2'g>rK M&0e:k1E4Uprw+0SGJKup D:pŒ Lghs dnP-c,J1j7P這Ŝ/S9&{׏~W9I4!H^r'6/8 .b󱴢Vlkڣǃo ,JcI/T`YwBAA[>!#C8P4ED$P# amvv2zul{HR`0v/^9u*$#Is z&i;2֕K5HbaT68 upla$dzeyu[, >"DPahդsxv 9pcnAX5-%¥ rNo/o>CFB$ijwj2l/5^K 8eR<$ *T[nyQdYq1W~r~d $ ezfoT>O1dcJh l(cp6wka-5^6JeJP~.sWW 5 %yDKTjUZ"c}.kj:Da ңKL%&)RmHiMmWB*$!AOuC({$Rz{ j Ӹ;R8ܺ-nN$\_c(KvY +5[ dҕHRpH[ְ>>qp!1\ b.I!/!ǖ e]th~\fpc>,}$Gv.E ? E5xz;u8' uθ2@3xOJ+[!Mǫa)H?sW;c?ܹ$W~04W@jV7Őq]ii~ g~Z&/31 ~"%ES#哓43N ;@RmAb,-$t,85q7:#La$/_ _g.i3Rnۺs-Xg8r鹆sW2Y,H8vwxA $ObnDIlm  WϨ=Dnp>D,{,9ǗؘE =TDm LxH6CQ96 {wpM${ބ".YA8= QQ, f%Z -6ew?= 2Mͮ3^I|lt~7|Fn&wG$-xIA#3tghz̅ˌP}FF|LR}~ko@ PT`ga?i|J ֟?ƛЌ>/u&Q#v343f<||  I<gb#3o7g$>"LHzfghQ>u`$S̟:Û M3•aRgfLi0A?}#35g+iB 3afr! 6\44gfVQ0 < ~SgP7wt33LghzDPg+ -g0sg[`#ghzL 7g#=|2d2>-5# | g3TrkfA@ >@K.[UU21`gh^ቩu(lCg*g`@fgF,_J \ gj(9Հ\>E,2>SRR"͊M\\; Z`+iJBad|U 3hoHkp@sF3Xfxx"E}gLhA># q !=`̠Ngd ڣ~>(-CPD2a6_v~9{ρi\!o"zAAJq] *J?psISL DSQP, 4#|fFx|"g"_YZhhh#YL3P)+۴iETRQJR47b֦QQ4:b}vLwZΦ ,?a>DSު*LmQ3ix~&p+B@Ձg=~| zVG%DSw#.BGo\trNF/<_,ފE}5N(#-k[Mwy{AU̜}ez Nqy'.9}-Q6[+g 0u3; ¶ w9|;w8|Vژ[I A͑OgIveݴBv1a|Z2P9?M3;`4cGe'?!?^0o(:c]ʭWn!Pg3j ^lgr#\%uuu5Q':;1B"nj|txg64Tʲ3sȥ񾬧|񚅾v;Ec{SJn1[.t'꟱%/߳=mک p.{$)oRC&/] 3ȭ)5=Mc3 F2wkXpC 3 3}&R;uա3e$::'w5>S_<|f>oV[~8I2xA׭SJ0zfoQ9ņ)sW;3>u5- ȕf"" 75>SwLmQ0vO3}4*zV|gd:iht =GԪ/x Kō>3xF7DI{Knux#ҳ>pO3ua? ~ 6hn(+|yrݢ{>^vʦGz~ xevzc&2g2q>c* }waQed8vJ8,| ypN}ϥ`YM|q>8剑LO3_+ v``Pk5_gWЭ-Muk e|B$cƼIT7M3FǑi_lVtW|SˆtԪQ{Ĭ|o3g$2S%g<:vaU}|M-$Ervog4n&r[pbh ($;#"]&@nLGvݳ{1$Vg3XfukG9}`iFg"{s~3|eCgbjۏgNHg#}F>m'7F934H7L$^3 -g~o?m'9>@ ~EͰfaKȅv}F L| | M3,FHB`QΠ3fu7|N-h>M& -g0{ >@ >s,߈,H@34`j/xR534`.7QLnj53a7D9||3`2Hb7\>#'3ɜT}ۏggV>@K>_v{>@s >VDfV>dŒd;oX4g05c0Agh>ﻑo>@3DR dgh9>#LT 30~:~}Hogtghzb% @^US M3،j$cPyobA 3r<Z3jЍ8Tf‚)3<1x8}F.(b`|2,`>#A3ۀψJ̈́nTS?Ats :IWJUi-#-Ped$ffWp*P 63.J_ 8h E-gl6Ofe973BMJ'T Z }ԣG%[{/nX]PX۽[ kT':yϘ~ =~=~ds;={,+I8 ;|5"H m13|s,#bF.;Zc_$֙M6b2<i:[~<}ɥŇD+!Rk-1޻|-n(!< ǯۿؿsN:u߽G.й?yw\^S-nTb0zs G|o+dZ|tmvܵe׎oٺ鈕I #.Zh]a>cw I峞+BfBΫ0ӫ(Uk+!³(rNNJS5e橙ZAMU y//@VV!k-,g~v{5D|Dt|>04xic1&Y]/#Q2kzjWɑY&QXU?# VN;ZT>SSł3v҈3CӠg #:|&„4XcZ At /䵄GZUݺuc{DŽϯqEyô*cV[(QGUB/#^5>'|F.1 | qV!K|.㲙I(s w3D2+y )?nY42zې|f=L㪸N!ne>IMEe%I[i*|Yڑf*#33? S4)-3d? QyĴRSlLSnBY >>_\_ JSB Rzz%q cv\B_Q)1EePfQbR]:V1rH=8zeHP};8CJuyjg;%. _~eWpҒ 7 3ipQZ;),>4J.Ҝu 294- 2bSKe.SZ}64%>3hZ@SK{.u#LAVp9[KA̴D).HHͬU +")ٶR5kZ>gz衸\P Z9yCJ.P\TFTFIIQ̘(JXHH6*@KlI33HD?G>C[2Z@hxx79] XCq}muwsʋ^t6T*΢=ǠZwTT ]DΗyU2!>U "H&|j䀕D왓_Lͥ -9#[w-Xy&dNMY16 DZWC~ ܋"35>Fص4q[LYm^o䧒\($ǔ.rL'H 5MYZzzJF.MI_Ò,$.?|4`i=huh'Iq[|"$)2"\S" +e)ލw3R)Y!>f98?4$w~ѿۺDU}FƓ'j{/x̌'vGDRVnzV(W*IQSY|+nx&BPs)6AHlku6B.C|eBq;5Y=S4Z]i2lvg^k񾺎_t}}~!uw[C)?;mZ21)cƧW~[4Ԑ44diH#ҐACW]`7gbKmY2y5 !=UuaF&C^Hc>cp$kb㠡FkH#ȫ$Qe[ Yg#G&0&3&6$W,Wd0ENMq SUAS'6&LO=1~i8h!733X<>UʢACJq͹89%2Nz9X"4BTJO8I←733EEp+%^423摤OOq'ՙ$OɅEl ۯKU !֐&3tQjLpjDDoBjMLuA߫I}V⚅j]_dk|F赓EUӊd4E;KZBG)jJ^º{μ̢3+fKDo?Ch>S3ϔ||g*,"zS6?wṭ%swI6I xWIͯy5WeM~u&ANWX_i>hUꂾ4Jыu^o9o 7ތu/jo|C>pq :rǒeg z=~@t ZHǾFCJe3H?GyW䈅/߶{rzꍻwMAcVikk{K|ׯ?db>YM\iS|ś7,A?X{ _߽툈=z{wiJ-eDE{ʓ(FIl~q(O߲ͅXF6$ `w|}]6H5ε6jg@TDcf/K ~ىc{o W_ YxZZ ^^Vr:gfj(#z"%FKGj"J+vWV4N&AiNۼzۖווZլOsE]<8;Ӽ1ن7͞׺Y"{ȅޟ<߿>eu)&̗j;z4U?i)h)iuwBh˾QO@?nh JMG/멽FJ&{N>m字5O{%/Ӊhjf[{$Jь̴xTs/5qgh]`lxՅk[XZcĜշ])Q~.hFg?usGPoڊ@ԟ囷%͇O|A~ ˉ|u~;~N hrG _yf:i ."+?#(/8eqؙ7FhiofcW;7pEP#£񎾅r64#S3IoAޱ/խ ~M y3=)Um#7ۅ"BC4%KR>hQ{bUDǸ>ڊNF/~ϟ}oYQRR>gřD_l3f>#q93NJ;OaԔ_ !vvpTr5~ 3x߼qGvI߶iv$=+UOwګ .{c"e}r$-Ʈ>lM?2@ a˙Eҥ ({[2 SW.˂C qЊ8duROtETQvVoyF(?ϑIךEAɍͨ,|teO$&(vMh}V2.pS۳[mT6+вte%Qqz}EbsZx]};^]3cn J)kqq]Z\ʶk! +rJƩ87{a7Čw[6P5'Nڪb{Qd#>դ+RT*sNG;~dG*[\q¿,|vU#T;j,BZ)fŗ뛥}JWe~|T: GN+0U'e*+3kkȓPLs-iܾl[{u!|j>mf:iuHlJ4LXyeNu#:*nߍmHwJWySInR^}`>| yUj\nM\E>cB9;.=GAOiҁQ .kR6v:,IٕV֐WOKę =G"6 XXvٵѣV_"oάInuMWx92ryQȶ;م5!.j(*OE2M↽U$T=C&BjQ"&G0cSb3h|<A'ُehIpqGv_J8TN%0:tV!S? ]b-iAhQkzUMgAytY=Ì]_c]pvNP&ۊwҚRߝ;ه=yuTU[~gU>B .S!6oAhJWfytlMTKC q9 j(Ͻs*9:κU5!%?@X`8k#/?7G/ZVqT5 vydsXQs'Ue5WZ$olVaoxᾞ8]>nA|}@Xf*::#ӾcΒIkSx3dFnۻE7\HΓ^lۧ aV ǡ[x>Ri{eX Qe/ٖs;DF|mz=L붳?fבbՇh2C4WKeGAO۲kX)/u"zg\}\%gzd@M<qmTT;z/SԆEDϗ&>O$hM}/>l٣뀭\Wh>9 (Ff桵|i'V ߧc:>+;k.SIQېA4m:uV^y(3I>^3=~_ W~J7S8c4WSdxVJr?AmW}r>JaZ.J|wuUe_ڈ֖\9anNuAƈs3;ZOS:AHvvXaI‰I#mwC и#z̻FuАs t4cǡ3/<&&8 A\AeB\{uMS&3tgo'[z#D= }ƳNO c}hZNj`?_D~ߔA[O|o}_*ʾq_m;UƝb'~wnݦu4'9\fSF-_%|,F wMct[/ѯ7e*>kSTSxU0g6ՔKTIl5+5`ӷ9Yߒ0>fuoonM:ze JGUNyy\*wa+I>cgTZ\cLz(>Ϙ8&ߌܸ4fWb.Vǚ37&0"Y4s_t@hi-ijҰ5Gmep.K)DdҤdd3J8 %1ZT,Vlp@Z;K!>ZA 3!zY?K_oHw3}:h۸zd!s@ /u ^lKLg.5dBQk"2{?yf=tD[+3V3ψg63OPEu>ˌ>C:|33֟ {Z:wչjΣXY?rqyJ(=\tO=3 jkv .'.hclϞY?QnQGw4{FIמv*_ƒӺ"=}ܜ=}tR_L齵ŷӶ۶/[?37NW,?~Wi#%DeSok'|s8mY 9㈈no:9l1*AOix;,:f&k\[MRDverc#:|9p橣NM1ҧ!>`QӺ7K[Tʎ e3l'1yoLxr>N55cSl7dۻfL,azSi32ܐD셫I&'g6zl!3֑JKf6g3 4=!S>Ɲ9%PYdp:- då_]՘i̯s-^~!+|{.jg[|*^ke-WR_?!{.003])疣):_> M/i27jmd1DS-TnH-LvqP4k^\dVF>SNZC|<;9;N梩9l?Uo)϶ދ]um$Q,7g;\ڣ-Zzo n6,YSơ *bz}oj7|ҿg"_Ak<ן|l!1}CL+Qoװ C;H#vŧI(wKt#:4m/ MGl{>󵈵P͔[$TeEMGR^EgF ^z(?[YZ|"lZƎ)e)FCd6v[mHy=X4pxϠh\]a#_͜`2 #.q>Im^aQbo0Ɉ42yhB~L[v9YlR⛅>ن:eNǍDw ;}gK~5@$jO}Ϭg9_:QU>sV}OtN1{ij30tIrI%'go- 4g$mቑL\|f=dʾ@ƦZ69Vʣ}woGhW3_)VhKo}~SYnwxL cxȩa$ym =o:~U? L"të؀o_=!>U:;7z֋Ib47sK cX(+5t|K zq;zY A:􂜊• Q52cݸQ\_qWna®&/_<lT\!v /*܉h]9l ??`Bx3nm3ђr>{>f;A~3`4zdT뮪D늫En`J. e*QѰrXVs ¼Ĭ;lgeA6f+oB|f (y[;)oQޒi֌";*DD_)&f03U [}]T[w#r=ҐT5\1QpW)h3JaBfvk_2lyu9ȣ#)lъ:dx&=ԚwS4gTݻļJ|qЄI3Nm45~>3A>C}6RHP[Z }Eqy_+|[WI{⅓^"s̿VXh8%kǓl3_V#Ypc1O,G[WTM#a^\=5{X\}K\ESb$j@ګj*^OCόc'KLe^ȈΒF|W23g\%[Alg* L Bepvۗtt5??:*>=lqp|l{~%/VXE>ShYhv-gtՇ888<|'5}T컓E;3ZX$IJ3gz+3/bm9."K#t?_۵b"@iPh:x7[u?2:/+tFŻ讞=yhslYrѽ1+$VBS9nl2@tUy<8%:_/E 3*T3œT%=x˩H\Si !㔓39ݱ9:g>kN`t3$O2oYx&gEOki }O8A> uf RpxLV;hݗd7] s镏ۻwև7Opa|OrY鄮xVtx":;,9GA kŧOܩ%ʿ;W>#`W^ 2"/;M7]zF\m1֒GWIΑ0gw h̾Ƶ R Wn8mW=<G枃!^cɢ/H/gD~Hb#s ȿ|:4j`MQvRC l?KRe{ 銯t4ٞTl\&#;Q(8pӟCVu*x u$vc|e|%D]wy(,O(WaW ~d$B<<>y$AS g"zg[ѓgoy.Ux78q!ZɾN}[5 Yb};^I#z酖tkl$-vW=v7vLlѿ&h5$6 ke҅Qt۽ګwWJ5"1<gg0aQ3*1.3y#(4V>=VZ_|Jm?\Y!7S[QZq{|:j6ԥ z(k?SzglgۜڢGD&s42H}_UхKR,j\cT?u8GƸEO(]jR:3YV%\֖?{ jc6r?\c@/ ١#|-=t'6,$w7Z&,fc\;6SY<Ш> zMR\%@As63lЎZER:ߜ_:_N0oCUlSo7y%=mrVڄW?I g݈b^/j4&YV7o|dJgǥ6ec>Sx/(1bU״CksLr&,ܟ<|lfθԧ//ߨ^>(^nn=cXZɄ)_|=}>xyE#?y)H-Q uF4ڿM] Y1kQ-9Ԙ,fS x_3?zx| gsU%T-ɏƧd#92<|Ѓ" f>=3Z&XʎgQ@>g 9,@(=+Tb,]&EϤRi$_a)ʧ)ΣRcX NPY͏DgӲハ_PHBV\/?КSPIͭ(o"zyp=0YSQV+yYRE ( H 2(V\*r32GsrS*y.hWzHlNI6nU+O*2YS5RLMBtY*s#W T%DO3!S`dskRL͕?ǜF%V3 Vrh "" ->~~ mۨ ='̯gbKe =>?^-jТP-1t[[JNJZ/MRXUVM1@6c ZVR`5+^FnMtdc6B/" S@ ?"m4&XE(~♫Ñ3Dw" ^WFg":kq-6t́I^PAǽDb0yʔ릊 Fuz*}F23r2 ~?#1")XO~gg$`=.654 |?vLb.fu 3c(o&7 |fgJ&AgcjϢy}FNi7üG.|s J4kH*|U‡!**Ac!';,ćZQ%PB~st"*/Tn~ yvL/.yr S&?&^fgP(/gsd_*^9eZm+oK>+ڵkҁ)MNއ&[7{!|æm%?f>1pAnsjl7lU*.]XVTs*-j+999ye-.rJ2h9YŬ %,L(,&&Fr .}GͨN{lZvO#73O8h\au5?nP6Is Em{n՗dEz#b:4ހmwHMvi#_mλ|>S;7|F"3rK4gˑ cae֮߸D|1fDv :KIEUs~v~p)X}ZIUŠl9=9߯یtb[weHNOy\_/;Fw|Se{2r4={_8eLߞmm޳WnқYwP ]& *QS1 n Ovd߿KUi$}S!~t3gN?LOAce6uxWw}7ͦ ׵U-t[EIi?_/MIh=]T^tU6ޅޫ{ט6Ϝxݡt;bgy\mڠ~LCM3f=bugl# 3 >(,k UhAPFڥMvB@GU}v?.rCgofna!TX(|'&DR+Ʃ|͊]m'W沲2Ii>.q~}F$_Q2H|tuxf1X<}^A]xgRßwl>G36*(e<4o$8'-VJ[k9J.'/+ LsK-)oi]fK;U&w}-AXφ>3b>R9а3#p_21%b$c5kN?/O|5`3?Aj 7Koٽe)hf|^߾vc,>4`"*Hحunv`' &(- tHww. 2. zg]fL99yۧexi馵Ï_Vu^xh__?6~~~%Ey~ޣAQ.Nj_{rbCN< /$= a\B^TU&6r;]N<#e6Ǿ o}^|e65g H4{~z]~5Vh+v3O+wpHݍi1ucRR=?փO_M>c#?3ݲ406雚]#V>-CfFF7=>e:ncT[m^An3b"}sY޹-DԲzr،.6O?:9ؚZ}R\V4AK.Tx}KވBc;qO- 56J `%($嗑o /lLMG&L“WY|_tZIO\!KwaknbjwyTZA󓟑 {+KS3Gp8Q$ܤhwLLo8=L}J{>SW.iUAVffw|\ gh_|}@nS,הfyikn`ljʶUx>} x~{k|s_=cjjbassP:0aW~ec>~ Gg߿eofj~=9+b=ug 3=8[Y8>|Z3EWd}vjcfjjiJǦذgηw~e<0 3bݟܷ26EKtz*6#%Fz}yBcÞK/FZvL V+sݵ03uxCiUƊH6V7^N*辗MgxSSSC@̧*MW}FPL);3#g<|QxE1u[|9ήV`U 3&G>Cgkxqbk=.d6$?ɔnmn>Fa[-[R_oւ"hevG;MYGV@Y^_AA_YNWnwٌFQhMá*JJJ:G2[^9y^i$/ ]y Q5TWAS7`J_A`^Xx :١45<2Jw"BD=/+Uk7TWVƊöMP}g˳gUB `]Bu'rQU਷_`Ab={Hi΅4} Tuӻ1{,cHm/f/!j:]@ڱ_4'9ډU&bCX}&$g| y$-LA()-xTtÔ7tb~f9dAĜWÿ?${t!O za9/f)&&Z n"y(U'tv`=lTFꜯvG5n¬ @HqˠemkxH|U x&vgB_3[ ?v QF_Jd'k']҇'), ڞϛ}hjfNyDx7|l75dM)u!l)={O~ Y;),*QBn%-LfhK\~K0qeA/89\`U|gK5D[w"]P2I; !m?ե@>]|.;wˮe΂b\2L?o3A`{-{c.D0~@e,Tٙ&?}r4ZkLS^r؍io?}t\+-&/k#'3>S|`9C E}KVX!TjOlaٞ_'`挄εSuuu9ZJQwvoqrttMkyB'ʜ因6WWvOJRB:a18m.A]=Gkta7H|K]||ziZ, F*铏OkGu}GzeUt1{$+wwgJ>=yay~h2T}F-tI,W^29]xw޽,/!>#Dpv4U=u| JHJʑ[ LuhEq(m=Cnޓ0b'轗eѝ 1)aV9xot2({SKV0Jn8m}ǡ[ :@f6Y*wy7~^w-.IS]*%|fnfܸSЊ~=`Ow4v>|~ntWwWp,[w/JuI |ު =vD)h/io؝^zHz~GңH;o|煫;6Ff~'Kh8^>luH >C&c oF!к3(|y<@.=m]zzTi 4ϔENR>;}H I͏0l] &m/>>/e<zP[94Q#l]GߋL@>H ٹe{qd~9z]po2.*480DT]dF~a|FPEp%WO*be6Mf=]n1'(%85(u%jG*2:_7p8OnʼnO1FB]^GGrP@>Sh *잮'/s]a,QqeZD 4"1G5(MN*iZY.3G\u0Edƫ߬'Ds[%-$XxWjۖji=uSh;}p/o1}Bf6lמEmd gǭ/ z6Ag|ejMp85DY~J71]^_m$U}'~z(B:meU9WAFwgPNYdJη`>۪Iu{ЋH|Ԏ–"Ιu:B gJ-h!OȉC;C~䢻rԾGDa39WLkӱ. -:3̰{H-%-T ^EMUG(bM+4MP/.Y))AE$1‚Rˉ gckԞڢȼ8=)޷cV>- Jt[`Ɔr>hv+d@ ¿-9>8XoZ2+NE?f}F\_ϻuYkuu<%oC>CgȓnremZ B嗔jYC$5%d-ӏ7B/xq>9 "֌嬁7K[ƲOGN)߶k- %%9'))>C(9][tOKz;G{祠GPh|vAYWnc -WU1T2]bG&>;z&3CFox~>MWAPm'ʊTWnv0@EPMVG}ss`gn=e?Y@UY_ns*Lt1F+M95aK Sו/ }5圳T0f=7EXR q> |HG2`oZ/ŧ$%qet237+Ygw3WUSSBMMu[EX|}|56qIM/[%OwYKjH-6E},񂲃\)5g JJnIɮ&"o"|'Upe+oUI lg||dm3Se("xALόe<0{`}IDT]OJJ{m&).0boUUe^8 AD? _ngCFUXO/v/ W9ؘ_3@S9 3W8?2n/w|"U2G1<{P:C:Zc.-N0}5eM+߅|V;Qg;|ag%7rnW2\g]9e~Ni#Z}ZS\o=z#r㦥bb[[?w̵3Yˢ-Ƽ:v3XSſc"9ys: b F(`Xʆ2:CSTWj}FF~OUP|fIOq;}oCue\"um rXr"_s}i,_ܵ])F+`khȠ2v["̚Ô4P"ߐC˪=uaC6M m& isaE PDD=?i*HAT\a^DBW9b?~۳Ca6557.zcCc4F̥R4gיsϷyNLpϥgwAjO9JU\2-]'_c h,Ym Y>CK|AQOPryiJZx#G %!p|LOO\?./E*hBU6G=bkng؁Sg)`oĐkv8f !ꪠ >4 nº昷-Az路]ָS$vgN`(ϫ]I>#b'h mZ3d޺]b+ g1/9|uόɪO:{Ocm3ʣOqiO>Dy,VK3:;Աo8ZZZX[[pY;MVU㛛fmT= =JHϨivo{w}ϖ###?#7a[|2}8z^o_vY0X@9\xϘqy$3JSW޾۳㯬 1jck*|_0eQ9?sQtO 9AJ\or#^:[^ٴh 0mW7?Y~3fn+{kVlmmll;1&CT"'aؓD.}m vXhIqz7lZ!ZۡwT2?3z9#}Z,mQO>D&dVT_X4Yϼ7ź?aOtӒ6䍷u~=lzSK|yZԗGNwuWN,a7+Gc4?4E}=lG4nUgdw?>Å?W>4X3m7s1wMvr0$e1qيbc.^^=",y7I؛=PAhfT lR%~D菅,Itbe|}ۊI+ @Q! 5xϩUߘ5]>x_,&Li8Ub_9NFggGk-B\fU{VLEekM޾pLBopr(μRパ7 BFo ,,(,-5o?3ّLG8)&i]{NQGόЄJAƓl0:r|=g#+<󅎭`01jʆro} )*+/BWmXfn^Bٜp{V{gjJ8XZ=Hȯ'&Ө2Ct7;ȏ@n0k+-Ǻk7c*?޻U]`KfC?{#Kh ƺڪΤFYB:e#;3`^TO3)ctk^'?" yΨ/l4{[Dei̞6Wax.L3&#Nw-%yTDoo:1*?9k>3c)4UA6%-fbB93'I&0KGIAO`RE2}yyrԮW3[DaAxx Zg47TAKEg [m~q Ԟv0#NÕmoDg~rߧc:oR/ "3}1gEDokvhdƞ `I/e9$&w7EKT[w!{PX>#8/$uUq7 A-I/.߸Z| hj9r 5&Oě3Ӷ^J ,f^}cE[s^%vb7^^ ߨweQ-t/K.׊4/"MKoUQ &b Qդi:KҘDFfz##䉮B%r#-Go4Z'25Uu:r-5KxivRph$s>Sxf ꮋ YL6Vm0B7(˞*k7W}Wi4T-EDz[K5nQS}Z#EA~Eoxs;J8ݾ |5W]>E'ժک)icw#PAj詭sěiP OH 胏ƲUF $s?ћ-oҟ;HV/M~/8lz˾}Cp7U (Ի3|'a٪EǝCsѫ9ڽ(oq$ Ku.4IW^װX7==&C*ey|Px3iTKPDRzwP˄U$g7 I\&GE5sLSӛ"r|0:e/ʗ-$ =.<ϴ g?kHWЌGmoް14EspSj˨򴋳XL76 ީLo5gc X oܰ9}U޸ԓԝX3+NmK7>|M TT6']j;UbcLJj:2r**rCudw{3/f}"< T԰ rrCuy2*}MiBRw>J+;V0bKb9!tP=VVlu:~;[\KFO&$<+4/ιa8~UFGصS} , /¯ ߝlWjº}VNnn=~r'NJ#[(kFENjɵc^z*s:rjOSjXD*:QülƦx_ ;^؋N ;zgX,F_@B ֗UAAmrT"-xpyL3Zi[Q#|vX|ٹ6hmrb=@&I|ik[맷J@o씕x4jn)daw\ek6?xDE9K8a6]ϓN^o&.~WYZ]3 n}) gCqR vۧw/aͻ2;嫛E?_`+薛jOU퉗359zF؎OM96}ere r+5u6>vgp+{D}Y>;3{#ެe:l6"j%/ܰr|\O<|f̙|Í7[P'z5ى3x̙ē/Q 37mnnDmgwƩM^uV r؉mw녞m2yк}7i{j !8{a vgR3H0Y~D#9[u֎nnOI-J2Tt1= ٷש'q)2PsΕ2SN=,jFuEʀFc-#z((OlZ|4qb=i}NI  CQbZ"8kK"<߶XsͿxJ+!H]xKO9zN}*]/u\`[M'US/b?k}= IO-LܾD֝2ݦٿo.zc9nsz}lh# >z+goQyN~swqUP{GdcS8CZ@}~-D~W%=.‡vK J |}{UDRM[ "0iirF]z;!jw_E>M{gL% jjjj1e<|YiXtghʒuFSqANVVq#gh}eqBLxA/_" 5%Yťm¼/A)?;_c5 hZϿVU&[S3UDdFeFՐt%\ZAY=n̨/ Hc%噑YQYQř MߚK r+Kk٩siy ꂄ47fŇEDfED'ʹc}EviRdf8ZnTnBneICyLsbSJXQ\K~[ʨZV.-F-56"~_Jjyh(͊ M)]+ˋ#" +fv|hھMh87f]Eld\]։QQ?b*x¬DQʯIYەܜ3(ID`HЗrGeEo[9y4ͨ(.q V] _^^-%F&VTqX[RmEnvfFV9guҤ(v1mF-5TggeW}(?6*S\\\RRk [Bix̧I->SYYIQo I3DyM3 :<7g>K b 6\@3\#bLf>C̸IV3}qm_ gL-C:rjgn| .3>CfB ̧ @wLy2yϧ3X3d8|iF}>CN >@LfpM;C, >"Yinf555\33tϴuge8|Lxf4g-)hgCdw&2=->C@q?6o@ ~ϴAƝߌ+.Xg o?Cr gڋ7?5Ά蜁||wgF!?Ct?>gybx?CoF|[|-C3FeAu3u>@wL&m3tpcixěհff|vg Wr2fmgvga= f} |LvAf=>ϡIg;ެg3t]4ϴmvg<: |3D-CDu333tϐ3t:]!ǛgA!g,gj3t3θf6#} |g>g2 O|3-3\)g.i;Ÿ4gF-g >KlL{޽5JTUV0Ηb7>C̡VUxL$h:354?1N[fϞ=眳v-۶a\[5/$g g =Һ{ <ƌ!~93:!z_q1g>C73~!VcL[}gxu>rj>`Ft׀/f >@ 9S3g΀>CLag!gd3~}B( i|n"_3Yex7 >KSϴ! 2l#ތ" Y`ȣQO+ygFi;̣+.g;nYgv "?CB >@w >vyg^%;_3yL"+ 3d7g&5& 3԰]3d3tϐ>F3f>>@ l fx $5nr o!'r&_}vgXspLc Bx9{ gpI}bD ϴ]=|.aoF^{}f\}}: gL|rV>S ?gqupE>F\Y}L6gs< 3 3d+̻|ϐ݄#=~0b&Mo@7 <ȟw>`|i ZLmU3Dhg#g:`0>C~ϴgPifA>@wL|>mE>@ yh Ì;_33B4 nr2>C!:'0 #[ I/ ,+20049YMivP``|jG()"9΄ ?^YTϐЬ#o3x/ A|VEFzzv- eѧdAWsps7o67h7;_1m7VTTTUt,b5eeUkQ3BQ[3Q|g3!ggnK|V-%eee%EU6}z֭[NNǗQ|VD`f/g m7_tW4W^S y?&O5jqfZtړ'ډS'1|;z^ayLg*o^X>cI n|Ra2$ig7]7ړDTJvw`sMv\JѹvWo02?3Ndͦgq#Fw?7۪(!*`g߷7PlR\sm١9X7@iV@?KL_0F/ӟ+NYbUiWJ% ]\2 1&g]ϋ μϳY_3Lz] M 3̺hD\]CӏXצ jV1~lih;{#Z؀IvlVc]mMuMc֕Dw}xRjh2{^Pd2JI luP_6z{Cƫztk/u }`4wXC}]uuMG#Mylg Ϻ::.]GEMP`lO w~3r~odfcc3##2dD~RG졗̱nݺflAevގΎ~cx̮[{^<"{gup-׸2?lݺȩK._3AO[p*vxCq{yO=x%)0<ѽsmw8wMp-W&]KgZFι=;l۹s e4x=|Ȗ-6myLפBr#M###S&&&FVn~ev,3}l~9[?4vlۺo+1<JM=R{1E]sK8[.PGM*o94YCWF,͸~=}q ߧFϢs2pJ'CnIP^CCqMwnGe+N}hܩXuy LZla|sLvj彻S6CKG6o޴yg}:g^ʙ;lٶ뀎 n*Lbex][CӴlgf^z>P{`]v։FnS578~McK;:3pٜX4_|9'vy_tx%I*G\ZӗW6hA;biQ |”/p$-5V/Q^UUU9zy-g]= IA7Lʃ5=aӔC`G1PGiL`69zZW]]i`l/HO5*8'ъ ~J[yIJ!y1|jgϙ:Q,،:Y'RΤVr7Z*INhi kas綶}uBwr ä W(1Du"|W]f~ӤD) 3؇1<ERkFXYL77Iryaҽ=Q׼쳨[Y2h}c_)D}z}'a*2qI}XFKE?P(b(Lb%aĢ)"ؚ3sHg~ac%|qDP\cxiq.틗>}ݾ'cXQy"bZZe,=WĎMKٟCO%i g:34!zfȹκ3 P'픗B~i>[i‡"||CzT_G.㓛&Ep3k-ɍ{8 k a8PU6N-(*trATB?K` @7c⊊Ҽ{&Ң,v㻹>qߌb ^%6R~ՅD' 4?6$l߆1:wZ*JA46۴iyVAqiY[s#"DPacBlC5 O[SR$zԼvcvVAAzwDA9;$AI"*RQUSMJ|ے5Rʉ`f$`eUG(kdra2}A!욋ayeq`>UaKHUR,1%oS fg\Tbj?Vn<)Q?si1]-/#!" GquKt]U aʰQHrݵyMZƷ݈cJ>B =<˫jjJ2=o1M\1Qözi}}Lx1M;s<}xm*_o3IeeEi{NOc{e/'ARvQEEe_N.¾w:}}2,4"/˷^ɫR K/,t:,OSr=OEaUP^^qlRSV][:bMiIi 姪l@ʪ#)i0g3̠toKy^ֳ+Zj:3U,G״ԋq=&9Nl*BjHP] y"4~Q3U G 9١qא!=v{d;wv$O&ia ӗK}Fh߾5F2oBp+]F (v FYʹʈ`V1kI{}w ៾&g=&\HYb>}q 8q20oG?p<),+UZB-Tdi!mPXlTӦrYϚ5wŵ??6Z3ZewJ~&kB ԡNk*K)e&;%2'^fsPU~P F/z_݇H$7A+ȟP5H"f[3TY)-2I!:I0{d0uʊQbgb;t ΌD7[ `ǥ_&{l'ՋB+JzAAjܾԓ O>u ph_V\9Aȑ# Q'F J"gۛ #Ȥm fNȼ+U<=L]tu6W^k0ELDy6=(K<'œL 6Zx y./6/o ۰ vhMb9EeTS[Xgʜv44<;W^=9a*; ء--kޔ%4>ӗ*0F;, Q50x ;`s=TZfþ:^4E19|6:WcIeOUVʢ{m.<+I.3d73ttg33q) oL^8muZQ%2=eGLibݾTA683+֞PE}R5kp}=#Ϛpڲ-qc^T*N@~Ũ.{* 4 rcפc}I#I=0|4G(Aq~9  -3ߚ$D{K uЩ|\k,T:];o#;]Kx[+Rz}ʢl/JB$$6m}![UAo#Z:tQSQq/T!qYeErhNg]%>S_wkΟ[\@gQ4gs7ZRK{KosT&Wjب gJ ߌ{̓ꐭfl=8(qJ`.< 33tggzi3Tg=d>sҽ܍{Pe,f~s\7GA5B2Lg>soіلm&DET;la!ξ[#__^ |^x|"p'Y8NWcnx^k[&i_q#Fsn|DRZ6GĚm 0&{ #|Bh8 z8n5= [lgfmMM#&b29̇ܫnz Sh^D.n^`o;[5z@/L!]J+g 2z/Y32C/Œ((3Z'2H>S f}-qVƊ`_gkI asn$ 3->cNLD(268jt׏D~wm}4. ͬm6jX8C=/Rl y(0@S$ v{?AJs8>du5jo@$.xSЦDҬ#HH5C<4Y7^ѵJzl4sBۊ\|syĘB~򎾩1#,N@+g=i=ןң0ݍ7`YV\/&5k2HQLZ,GqB" Yْ^G|Q|i)zdn"nJ%NJUVjUiOz dh+> > 93wW*C\zLq~DRq8lČbe>!"bE)3Yx75(nš(uvuwwF{uw RÊwIqBB[h>w}B2ݝ̻3MYƫ}LC>æf. qƒ8^}ZR.?}a٧_2'a Yчm{KterbZQ :i)Y) р7v03gOgj7/ݱ#Ws gLU# ݶT`-G62po /ށخ _Ngg>h ?ЛVfeJtEg9H'6:Ѣ_n:o`r66rʆ}lϛm;lJ {Ao?ˠJx|z0mP DoC@Ȧc%^;>r4wV: ~д"Sc]\lbvgjmeK~fKtRRORŎkDh9;MIr>Sp{]*AJˏhŢep³Pвj,CgU4rj WD#H D}o6^o Y+i;Gߐ< (X&Z|aGC0 sp^L 7 {zj:b@@"fc*[8;;14|j!x"em k;9۵E;6VvVFdm̑m3TS{eu ʜf~}i0[Sc}}}}#ZFo^2ЦCЎ;bo`m4,w0vIS5J^o:,>Q.b˫ݦ-:.tw{kkZQJqv7CjnM}K=cchd>w5"ZeI{عJnv,ɃͰr0430X<lmmyNt324r2}Xgg:L'8fnP\pKffz=L0*^]?z8v]* 1aȠ^#: 2&?/7̳004046’Yۻm_jIN63nE)\Vu`Uķg,qgZhwm[kjq9Oe/%U/n״<rHHr$[k1=~ ;qVdb Cϣy9siҫ"͌2.mcϡKh0 g~a4iϴ VNU2wZTWD=].VQYIղ10 %FfrO[p]UVVTtVle啌߭jzEYYȩ3j?VVZVVJ}2%VYA-/++ ӱ^-5ûe%%eo՟GZXUEYiiE32*veL+ן#lgc(A:կBykL0¾1 huLrgUf4SztP%L3B]*S"3l>R{i0V=9>e7 }zfж< gaX3DÚ '>SǠWdU(3fU1sC1KΟXFf"LBzjjjgLӵdO|?# g}F8Lψw*453%}F긴H<gD}Fr7!_Qξ?#L'z>Rtҥ X } :.anq=y+q_\XC!6(^?@q|vI^FjZjvneTf/MWu>#1sF*`8LmPOCCC L@CΪϠg@q4Gj액VVV6=_|'&'~8Gn(ikVQ??9ow_.g1j_o^:g8 }FYz|3gҼ Dis̞gS&Op)tEǻk.!Τ© A嵭 gjDA1$"R}")DCCCV|?@UID2DyVm53}F,tS#:5>Hs1Uf4ZFe44*tt\FUV}aTR+0jY&aVQ*mJ[2 nJAr UC ,JV7Qz[o?Om=31GU]}BXD/#\yFbMM`|~u>bLT\ڬ0:z{+4bḑ?7M |Kqnܽ3F {ЁdZaf OOO]?EPpw餁nܽ7ozDuۥcEߘY!LmEweț'˧KhN[jAb㼗 v zAbfQS.#4ãCn'}1[DDD h{=jә*)<_]7O/V7uU4km!5ִa:z{yzvq3)mc{#BԵN].*NiV"lݤƓ{B A:k]l!(, z}&/kc ])𙦩[3Ͷbc_yER*xf]&#y rB[%?fXa'/;2?6]-W(kIVÌ])ۚ]D9u٥4/n}.vcPzA2 (bwqqTćv Y,`݀@_|!+=5St\߳ڬ}:A=tˊblup7;õqt49 Ta'6R&vSU\ښy2T;!a:2}/'#dOL.o'p{=VT6_fkյ_֢vKp/򙄋[ >g)Lt͙kkg\M :y$2h#w^ַnꡍ"&+xu\WGI s^tȣ6xK,V[[Ca#jnuX^ޱFnpQ|%k#i ̆c4dPLKzCNwlޅiTdӾEz8W@ygdqIu߭ ё2+c7sB䈨۶/yq)N@{&<ڪƬάhF//+)*.M9iKԌAH[XOgۣV8&niпWpA4vzu vv Nf>/JjRour囘ގs󹵦4nkycݯ{svd25) $yMTԐͿggpFl21 mV)^*>F@lcr|[MUALp62:+hhyoj ϼ+-2.:8A~ާHn{>IJSv2E_KOMb8E7gXԳeo^`EDR ]˟1&QO=L`N'@ >?< ED 㯚kP.g }"jۇilǟۨ+*}{Z;q:oD!zK5uv#<`.Q?1 |b94 TM}DFAeS/މ獨Qo>7|F̸+J]] 2 Y"kH[VgfثG 8},;<<֘m&D6О}NZsV=<AI v"nA2j}~Ck6f1cgHijo*wL]ae CB j>ad>qǼ"ʏZ;Jj+|FOF3ͪEhWJq1&R5y;xƖ>?\Ӟ& jQ3\0Q=2! іy#vd5ṱ֝mtCDD1<ޱ>*NQíj /GjArr]zqD}F%ݨ)JڱRW%GV3hWv3!ߚKBDub9²z:[3rQD:|W;/vNbi;g.B  >LA 55>7L@S eB1wA ">sph!ܲed~,օHв9HIR2q<$=+=%/8)y%zPy<<*3G)aVq~%>sfa0(8B,5g;Ȯ<R|F9HphjנfUf-b3~tсLZS6ZA2opmA+>#JI)|wEH8\A5}:r(Y f6^^gӊi b;Zx*oއ9 {Ų}SSD ||&$ּTSK+$M* !w\UaM@nrEʈԓAO<Ϊkϰigk̔VN2S6wlWLf,"VHKL'aܒaz?%Wä&/9GA˶ޫJ]=Hyo܉+5nou%^فL,S/a4fx߈zq5!(j}&ʗ*6}e'%v*^c7cޏT I0\˓):ML(B܃.?]0*'nh;/؊S.2Cج IYgvSWW&mL*kLއ{}mGhX2E>S|6 qp K].*jAANkں\MT/iłR{wh?`Bt|&l%"m,J8=MWW 6ƦfX‹KE[C)+FU3Āg&bXm۶m`"^[6m<拟-?NrK #ZieVC,I]],+]; 3a2L4b̛ hnxyI*ǟg']w~)~9b,;W׌uPLrZE qwhfy !+A/LڿxC{[[}TX&k>?:eTG;A{G)K%ն oL7tem?!S/>Mh-mP/U>Uq9_^oX4֖]{/h+&zx]v0.&͵A666Aw%IJ%;vu/ %+;4kǩ͟6C@u5dYa\l=?llsz5Lf1kz5kjTV**+/..fT30:](R|Ft?gHo&3. )?# ﬧٜ@ lLSo8ѹ40 g]4i|F8_boa0p,`g[|FbXUR57 HEgjGt" wL}Ft=MT_]wY!箽L*{UqR[ӡ3%;3h=MW/_pw]{LzrE +LOt䄤ϟ2~.jӾ`Y}]yq:<מ(iDݨM, n_Vꌅ<g/ȏx87%))%%މe_?\RɀhPo$}D\*?7]Mer*Zz~?+;pe'uv< kč~Mwڶʟ߿GѷfQB!۞ >ySK`Z胶dJ 9ymlLXq6-pr-\҃yvƻ{c-L -l]ūΛ92>lV>bZ3Gߢ]=~TYG&f|F0 U8j#9#P8N>#XFtVLUm{"IFy6k~'ťQKKJ+*oSf(,<.nzEYq nuEQaq5#ѭ+gn>(@w8N XzĪ>kH5VJmJ0p_xU}Y{Mw^KU>d"*uw,.#̦ɳHjnDF:lVmyiiIiYwvGWdUcj<9|gTKxeXZE9,-))VHcIwKTN+)w:z Ы2X^LrK i3 ei}JA$DVx>l'QQtz)WUS"*LNψΜӬF>C|Ǿ II懤^ {G#eB%݌?BJ*Z<`{nA'ވ|xy[MtA}*65yN_KXr=[ֆc*l^ :@muC dJLFI#wuqtĮ]U-2ޡS\{zDxnNa6>}2IJ}zANNNnaƕgcfh+(|[Zw%/';nUS0vNu[{u+ gA}Fz.BCFxU\77ŭC3yuO-  u&^J򓒒rhQ#BBFìH?$T>~ܫst%uC%Ï+wA'J03!,}j V{_ieŝq#vncchܿ3RuDd GPd p iLo+|Bky[Δ2^ uEhR/,*xL,dy짧SY[1FyHR=ui^te222OUޕrsks7&OXPpw_#lu2@"ⳕeHM5 3uɩJn#+΂JiA@P1[cgMFQd  yyh33ڷQ1_yR8[@ ͯl<uyqmP'n .όÑ>,pJWU27ZTu>Í92^e]j@pe9`YUCEAt׋3Wƽ%$!kh++ddM;t_K~أ-6xZj`_WmAj}iifi/YՌH ˑP̽cPSDŽ(*bnCS{(]P$uTu=IGQhn?ZWpU0Vg,}np6x7A /2,/`e[┳ZHNO~3]IuY,^VM^H׼HҏCĽx/=}Ͱ*9[UC-VZx7[x,aE_}F4Jpșx͢>#k!J'l]hʭxP?U/GQg~˫ 6 G'~a1_X:_+qhc}(,J9Ub~{12BP5S!k-Xz}DE PVYTtM P7թy(l$*q"**Z2i_֏4'ˢ哙ND%٧ )[ hSqw>pA#r+cK *ee딴苇1h.+{>kGr ϔg'}!>>A7of5#6\RrK*d9ԍ#1 ǣUDD8yKA Kw>CcYvK|6؞m殌je36єE禔gV&cVI} NUD|@~OSK˿"{kDj"3;r]:xgw1v>b Hxm$2qR +YL8;9*~X  ҧ-ntaBÈZӥ=7mح{kLꚮqEq2Foʰb-N|d?Tׯ>h|g K[3}U~bf_WG{i)ujf}fhxA36&VpnPr w+O)iDN"+h#2F/<^.7Sl_QvM={9i ?Fc?c(YfIt4))y5 aDϾ:=v0>M5s= خӒo3\&_[jWH-:[-=;ѝNZ>2黨V2UcvdˆJ"cxq7"WF 0 2ֆX`#~8r_}۱?\osʻ$%v種||v ȭE>wNTܥtN]] UxU]r=+'g]tI3*'y-ڂ.!e&6276r)5R>P':5a~^8+(Y,,gDW+)#3#C>oT:d@Ԑ4 枌i1o!/4{{c0V.0d ۹t5s?WL4GޠG_ #~%ߨ)ӧ3mڴ>~2o<&>lbC*J?"ln;m!$i)e,2e_&p4 F<Ȗq{LoGw,t2NfjBM:`'_jkSI퐗-TNM2$~/uEDF{!4ށJ$ĩ1o)#dJMODoތSsjp|0gIS5\SO`mqmA7֫ץo]6oe5Qua說!]}\-:z[I4hyьڪup@Ai0^D̝B/(NֽGKg]}][r{NjJ%)x eNhAWt%V>al4HCgꚌ)yZ\HcRcvS k|F3G*?3=%.^$ fjck&>#ԤJ7,yAKTSNͧ'g뤦H"d۹NtɏaABeduu5FJ}8|骊{/Q[|l>5ˆeDkf):_wŹ0PDQE7y6@Wf !؜adT-&=v uz$~$ C4xА~%Zvѵǡ -^£ߟꤡ(G>c]uH$=>C-:QmJ'lO_z3{5 ?]3R&f0wMŏQYYUUVVQTRL2h?>e<:xeV&<Y:a 5?>P􍃹ޑB2fV  3WA:z>z=Wܥ]e=g#&Bh qY+!G#ͬ^M-IuO;3!h,ZI2;qldU~ianťgZ3U%E%4/w6Q39!i$D3dkX}6j=l7MlM=4if ܢ*oLXWׇ1 9/شo߾=\k\(k9l}[Cͪo9N5ԑ׵Y9t\AImguMM{{gDDw骿#q\4% gF$J.ld\UxoI}cP{ T"Kކc%=LiyuZ(րc Ssr-,)~r` "^e.B |g]UR!:љǝ4J̈́F! ^6bw謄 m<7YZ*r!B YJ14, *&\\\No/᪄?5b>^A-[ QD7Ejm"9Oz6mԀw>i2IuiDN+bY'pZ2V#gDWlЫu]S YZڲaO!x;?'Pbf#\\(Pz{b`> W&ɟ};"DQg Sկ YϏN9k9{J|*X(Q&-*aV}*><]r=Y k ˩$}|W*Lsƚ/SW2<ÆW٢}dEK,fҳQ`Eŝۄ xhL"^yv,cDxo *syMkho6/sٿgx\javZzFVV'Q(Aaĕ9Yy 2K, VW<,1k+)8[3Wٞ"ySmGJ8 + CR޴'ʑXߏS6O# g"ψ/gsk"qYnZ 2*wEGMǹM>W}kIE[kjmژxz+P"Y-l2'м(y)ihh()jMTZ>\CYkW) T5ǟ  YࣨyXV#6*c@,ߌQ{qFT .̜;f֟Vjҍ!w>jX8jT4xX)er^A2"DFNFCOPl}UV;8*n[MUt]s|^"RץZ^'`F/ %um-cH$%E_`S2gdYv2nje*NF^RR6M&kHX/8]STwNEL ^Jm%_h=Sħ()T5e{4LUnɑ|ƎYQgn%a' oam|լ[k-T;{tcCS8/θ̳ b1"AL#Ɋ rM* ïε/"( \E?۪x J]A MzMJuY^)>=dI鵏+g\^PPJm.Q!`P]I5ޗޔ |F,d|33򙆥*.[ѩ'qSKj7oh*?VJ}zxyz[)=(ݽzxzxu Xf{xyyy{{v曯jwT|a_]fQI( xxogB.ESv 9.>c}t=`wH6X= ԣʦM6Vŝ |}4^^>a}>K.no}uOH#}{ Yֳ_؊G7 :qC*rWV5&AfG`_İG`Z}ӑNI{5*' D[{V ˯K]gZ#Չa>hJ\v-#-,> " 0b۩LvRd u7֭羻{(g,|R \tZ67b>CS {-:/j~9,~^[,3#Kߺbm?`qQO7;>#D4gx<Č Q87lIpl6 93BC \F8LTi"|>#"g$:dD|T i&gDF~>3?:Lg 3>tR̷Ӕoq2[wl)} *.vǘC(Z؋`b`m [Ο:)>w\|A]bm  _T\CcYΉeTSJʨUN)[LӈedLWTT6#AJ#q[C5C]K?ad)'+K;(WM0Y|M_XwSGpHD/3& }ʢU"02%i˨9>*T z~=nٿg}0fg{e^XM}ϟOLmEqEqE^(m5V#5\J`TSKSJi{d4(/,.N^EYQ.ŢRFK 'Z^A~~AQޗGGʣzCI`ӢJ"-*.g6[ܜbjMH=_?>r8jҢNʘ\#3|р-*V5xC=v hCB/0RTJR%VADz*RaP_+K [G\=۴]מ {x#mS\TO, if֫ޝ:Z[YZwpꮸp?6>c1 nLψ#X[Sg|~T2Y w"Š4n]yG2kv]0|z:"L!sس7,I YQ̺ ;)B$/)-\LR!ͪ魫%URҷ{' 4|e{n= 4꣓ܱ}Z=X9+⨦}Gw5PS""gT~XW7Ʋ<}h I1AuV}'V$Ǿ@1 5u.:XJ_Qȼ@gEEdp2>dSC/Y_ l :FfieM2\7sP9:V$%eyY#>ө,v6 r <].'CRWPWRQsRWƎ0''UHKɳgIWU]"+!37™7-Z#i?yqjV5Q*f]ވ.$z"N!aq8=D ZŇ2{+ո04p8u(D%|0F8O.4?áo}Oݮ$c GɒT)crSoC<|ZUh#l%t^pj~#]Cު^ӄXM86vi*RUB%7I +T&(u}^$D}yxӢJ4`^xqp<6b/v=L@UIZa1q29Ϯ2PBF".O74XqLX_ ^ ܘ"XIѨͮ?#3蟩fjr^VEBeE i: nzlY;M>c/jxF=o Ub.ڢg [o|uvxQ;IQ%S,<Va=&9`ȹoנ4=TDe>N&NH,iA̰`ZDxMon qcDB.ޭeDu{Q]WڵQPPl~ۍ;0H@6ymN#ꌕ`MW1Dio<|gn 32YN]ʵzVmB 9$N.?3|F`HΟ9:l0xiB ^_`ީרPS;vEPUR|&q@s>c+'nF-WF.ͤ4;!XL|U2^sν2mBԋʫo f$B )gPt:x"O^",*mIdjFLGYճ[.M/,nFdTe1=e wz'^;qRq>bXh ĹGϨHK=d̙x_+f]W 9|F]q)f9;Ȩv]Bk,/{5cg7}gF^yUR w%gn")>bDgѴg5uz#᪭\P€5-iʺT.4!f4::gv-gRxbE=A!vX$-/z"1^'a;r‰zlZoItݕ͊2aVKO[q ,5r$%(kzVf]?loo}vv 1hyԔD_7 *(X.gzK.ܲpl[ m6ۖҦBu[wkSJ|8;+ff v.^0-?~ׂ16&Z $YQ-bb>#uwg1~g5v#׎' >]Dcw) md=H1ϔ$r dQU&6,2ytOGN#!R<)4saƖ=3X)).߷y$hʳae9kpE^ךz煱#u]e¢kͨ(}I&!$B$;>:=!k*7KZ3ܬҊg~g`13CHD O{_3N=3>ӊxUUxG(xh1@q8Gf QQLwPꊙ?39H6ͫ1#Xgj()37\0B?MOOȢxu Q~JEYIʇ/{ΑN#lukO!ޚK%O"krqqy\TwAD5֨{v.A^vncL})W5Fc?wrnYĖ?ܽ{N37s}$@hաwG>yK/ٽ{!K?̯_|eƺB9Gd7<=>WR(먯qA|'lA#>%;5ߛ3/3Gϸ3{wynyö'#Ԣ_?O. lzd}sٺzqrNjdUHe}xaޒ~>f@WC֜K߃}X5@`=qODc##V% +NY:n#ovLጠ?J½ DvKo}O/*U(O,r;Ds߾tduGiO3 zf<3673/wv4іXgW3._ͽC9ޠ닥ovǼ}3\ܺu;2 :nUՖU6F20^'8w,L?-}X m8/|+mo-zNhh :wvqqAw7b凿]ܿrh.BqI=,<ĔZv\t1f}pL[k95 ۸E?5{}`b?Kc]AJ=Ki;/D.(]Xh{6ُw@z&krk֦z擜' ,^x]^*щVem T ft0W;P(40ҥ3yF[S~'x.z+n=^yf=Ʒ3gс Q3W>z3o|ypΜexe׉;,ٟ ̕=ꀺ ~}w O<L8yRT:rO|Riќx쇯?oYbڔIǎ;ḛ_x^zN-zx6f#I9\Qx(sK u&ͣ~Z7H=( /f(=j@fIՀy=CG#c7zq&iUC=+g8fU3=K4M ;3}Z kF|3Z0ϟ=gb,f=3Za zgp;3 zYzr s[P҅} K3,=C|?SPq g߿zgz=K3$gna4300ϠgxYz_3,C/ڀtV%t2z s -ih=ÎpƍߟƵk@bA矯\Xȸ|nLZQQݨT*gzOq|e 3T뙛7o޺u3<<] : =#e<-h  ßgπyM+F[)=erLRR*^LQj K1/dRQ|y#!뱮 u&Wɡè%SkKK+eK# BRZRP+^do7kޣ kS"r5`]DӫY&^R{-66i͖IْV2rBq϶{${rBRٶ=hyϘ2By:\-'J H1t6mw>Q2 \ PgmZ2m$n{y[ބ<Đ̡siR`P6LѤ@9QuflLzh$',4m5̏Uꂸ"EyՒf'29Ȃtleлetz)1{7,_VFf֩n_LLJ!>a̝Gjeר*V ˤ+9d\X-Ӑ2†Q|ngjlA%4jYMӨO~zFJeU{O&(tH=# X;ʣ̼WTϐmU&^.">ӥry:&9YUFE]E]Wg 7 yy}Q"w̵48\P%UP33 3Ne@0gvw-)dBy…zZ*'C$r>乴)C"O4*BIdܺ G/O=1ͣ) R%@9xup@|m@/K%Z5JC7kS'm-gsy,=tHFUrU(U*rGJTЎ ]De(2\*7RmkQ)RסJS޿yNϸL l'JQŕ"3{7LO(gW*ezȑVDѥ,Z STHb ]º tLYNߊɇ)3b}?RF*5VVzsSV{:E* BTl r3BYW~g3 :ly?cCJ~cZ& ۋ~xDhܒD/G21+_;=Cj 9Xh?}S tUFhZ5eJ:tioĩQF}+N녆a&`Ws3Xe3ϼ>B=F|l1#ݞQ* `\z`q+Dž{νwNVuЬu5+I=Jd+BR3eiI4goWea : y;u[}>ck@;e$zum|غur19#CZVkm#m8 AHʋs$&&%%e4Ac0|r"LI@.I;k-w 9SVM͞zF~n;}-["NeI*I9_7 d,L15!x2Ee5tze*7=%199̙ Ѳ(>Hx1E\x$՜<=21`eʈ,"XJ1+%.(`"Rʩy !KٲZ%SW%DAxxfQ*j1-iuYQ395r4l͛6ع+>5-M>/poPlbze-mm5Xu{5Ja^V'v4zp-u*% FT)Cn67sg􎢊 =j@rO7v#Vo!%̩qIg3J\ T'էgjj=T&M9#Ur(yk3Ozwlt=C3fY߬Ez@Uٹ]Ir‚}RZg)Tgζw\SRJk2["mt'Ga+ J44Ֆnn?x^Z:;Q~>"uӹ*+?FHkkjj4'֫Xfp=c:pYLjӵ y+CSs6z >]-I#V_VVNcڶJhrciMf#RJ6+gPUWwb]LF6nzF[*{RwFvkgHoUoz LNQZq2C퐔TӳAJk+BVy99XZ:vD]zIy='ޥU+[O+V 5~@cu(4 AU32&##Aנ: `L1O <uoPdj]PCW.:kYpjg.-SRBBwcJ$=4:/.Ŋr^q ]VȕʲpʕqSTZn(J;۠*\gm3c5"IYYTplmBhhfnSd28YsE٠:p(|{*2ELϸNWקmw9ُ^RZ(ł3tLQ4kjN3dMYytv&Z]+ӺYh`d9*rbҞ7D) VsEPw:_%S* #wZ6{<S)*ec;Qw8ԻM^{VQT)a^NbX5\h4!Q!X1k,gm wv4Xpo#^z}'1PL= jݣYo3JJhodtQq$V\sMMmmuIn!K 6Anߵ@s|=]O3ٱ vyio|D!ˋcGE:ZqC Z43>̣#Qr daTeY`b=q֜"q51:v/2rB-Dgb,t,6#)*&4rgJ:?0 СM ؽ/%e_Պa :lZRq=chkwY"<^%kb3̃+[Sjd$4iwei"]WWJ/_SWfei &l='g_Ẍ́/wOTՙ]\o{>;'3+Ծ.[q<#V)gha7h*BLQڀڛwkF*z9Wiɑy({-R虗B l,^vħgP6Eo ,Mm\h3jelP/t@5UA +fwCظc16n))&K?C~oH hYf} e9q}h&C*eڰA'6S.GB yJ2N53'kc$g7e- >f[16heEbi3Em6թU玭54^&p afT{Dkc P 4\rH=H=JcHrR"zi' 64BfVgs*"33K]MhUrpANSK蒔)6Qdcz3.a4'3v:nhSg WLR:pL*OѪDEFl8y _-JMx !JrxH j?b]:V$4m`Y c虗g#=An YyyYbzQfdԽQ=Póګ^zyvD0Mw'bAܛg ESr|j7I- %-N)ϛzE*}-t<qОYόS{<͑y'gIEg:*\?zٱ$cfǒ  r[!#wĥd28!-GvίN?u*\Fm2R##j =,,FljX[餳I:ҳ2>gVL5-,d uqSn&:uPRac Sm_gGkϟA~aMLVWSng]k[[ژv[;yt >W u{6GSxRl7ñlVɕR)H+i T gYu71=q| GC [F]:{>_Q)w-z5Yz Vm;>Y.g1b)v}$}\؍>WdZT%5{{G^RS>2yMi~.Ze+sg Iy~1kfN:1z{ ]S@ϼz&3b3zMz-[[!W*2myiUc<FCE8u֭ g.]v'" Iٕٳ-mjd,=(X +gpx@Y' ߴYɽ5lDCHm 66=VE4-%|v!(Fn<SwrVr4Rv@r(HAUS)3{]dQb{JZ;uz'ǰ*v.Ff{JЇ)"cքbCҔKF*RE8J$tѯkc{x\FA>a+T BZ_,˚g {;P7dmL|th㑹F:ya>q{LM<^BZRP$2􌕍uksțoa }OS嚆b*E]}@VT/ `DTGyf6"] <mL=#s&f{~Xr&m"*Jq‘8,ŨyR2CS=^Mp!-,EE{woΤ ^1Z }lۄ<4_9K:aĉBn>bus-Q;9Y$u7NN{y߂\)Ha+2͊׬VIଽIMEEeSjM*Ay(qӨgu`_/^7# ;7ʭC\ g3 ¡gXMHUer*{CSj%جW ?#VJe͙4ԱMv.K)4LZcЩʤʊ%CG̫R\ ޶Tz8LZ={81qX~aV{1*2rFz3Ȝ-Y )=lPfA1mo`MJ9[:!c{7g"wD֛B&>3 4fizAW#5,8[%lکs"R=#E6]MvzQk>;OVE\?~̚*BiEԔ kae4bJ1!:{QMQX:D9٘Rk?WK^pU$ (r/b}{zYRlAF*WsQkj #C֎>O]m"o6Dr_rZZ|x>=<ˢRl3VmwjoeLnP΋:9R)x肁k/5Czl-j]&_hը; 6(4H(KʯVP,TDb!xS.jbn1z/:Ѩ+ø&#Qydf{m1 xd|3Ijd+o_P'EIR)):oK'yǤ^7۴EhWd}ٲڜ]Zt_Zb.II٠}لHTI-J9L3hK06476<@WQro4p9*ܷĀޣbin۞mNgJN5 FZ0ahlNacmu!Ne=K͌Etc<ő 7&(P[e_dL KRاhD( Ƣ߷RG# *fKp(.0ExV,Rķ\54;_YVytyp2Ȁ۳ޜ"BMR|A NRhuYXضrhd/:2 8?=*Rg(:s<6%gjvLDo2KTDćWGEܹc{ZQu 4,bzR:u)'h#(.5A;d5P(%9{}nۮ2V %lѦp8N1=9VW yIcNPdmj:Ő:EtYSw.GTaGnڰfjZ~iy(SFe9;f,Qn sJ V&ڷn Thkm;~ꢈþVBΚ }Ğ)i+ ܹ͎;T8s ;AWI!>Sbl&01B^[:DggUeX}Ue6y#<}e`fq$ ȁ kנ\j'G-$3xU|f߃gk$1لqI~[VXb?*LNtQɁRXxzq&↖?Jh4jhJ]ⳇZT"+Nz 0R]Rz.rUZDfIhr:uK4\kjR.J^#4r6ȾKg nmI934k1 BU_Ū( ۆe(1CeS =F>uu]Gj4d ]ud2)+z,@3]8["QH$&d =CGjf<ٿ{O ,Hw=p<.UR)r(^7PQ_NgזoXawxqT$*5QV^(esQ|igp2LqqIC\3))))gNA; 'OJxz7}%?g}F7ifIII)O#^( ^OH3MJ f/>wc|}3^3ϧqM' TA |?w<ju5^aɭgkM[Z@ Gjbz nݼy΃'c=Z_uέ?oݾs#?FP<]kg~WSM_Q Js'N{ ԅSG п߀C0i?4׏&NYZ]F.9lp zs}~Ȓa?j6:~/bTZiS5?k֨|Yzxu032P;݈aV ;ujnf{Mviqgg@ 21ĸuY-)zrOВq3;_Us7AHk-ޝ{s$-MvNWy1qNN=_35sŞ5'Fj{7/n=h~5=9ct7{C$WyO7~2e"C/kUo/Wg-Z au~f{UʸwLNaQQOp b+xsOn}{QOn~()zs3uK?=tz&o3MJ'kwgp4j*3y_wKKl|9 Q2X6[IHdr}sga?^R˥2տ7qvy77$2koP[ޯ!_]nj3?yrh_bYG3N m"u;ŇXWR˷8xe(}uj߽'eu!O=Jk,LT}[7Q-J 7q?n6?q\fJOoSCq/X?˾uV̭ǭZU'i]`kkgIazoV:ڴq|#ܪCOoԼuGKhΏ6uR]lC++ SSSV*$jصaO 9svk11[[Y[Z"ʢ:;hcH汍M++^_]kѮ_27E70wX/;XeA$,͑Y6dʪ{R-3s6n ºttGOXw&^khq}:Afn:cjN>\;ڰ%d4B l/ { K<-cZYXۻLڛvNiG'_.fff&&Ν_1;/W0Myf=c0wܿw/Z)QY]dp;dj׮m-lg+~}aWc}9;bOށt,xkUa__'-7ZرcXl\W3);hwDustwU^&ev_8kެZzMZKg9G)bn,jVˈ0i u+kǡ&-YK$U[¯ 'C炀sGg qC?1h1cFp~ B #vڲf!ح>Y~3ЇwEԮ^[kݓ]],d/0W@P9hgчsvGCHhM?T7i]EGʮ6Qt%P/kTʏ5꙳FKWJ.ggz@޹]"枽d Q}qx4x j]iA:Gۿ[- szfE]ד[,sWZqtF=e"rT9η>=L?•/zgqnP i~ŤeCBa7z%m+Pk/X+c}~^hȜh~'ui\;{Tm_;Y<L>xŔb^tE1n^!}L %v>]&zFZk0\Pk5`ax.zϦg[ZvSWVv>JN"ף޻W:zeך<<}_S^\7H 0WKܽ\Ⱦc2OAO,u;/Zk@d6aOMnbmşmG7 b!XUNϫg ]WZ)Ŵ8@`'YX NV"eݢ&mQk#>?2/P >Ĺr_3sZ :4R IgHzdJ3|t,tн}y{{wЀ\ٞ"~ta` +g0 SϰϜ[L+fLoп.+ ͬz5f 9rԨQ˶_9=𸓥P XRAUI.)>I2Wݒ0 iVLnczۀ7z惖˲zZ=>9!(=R ӗ !-k"U62;ek"00=O]=<BK]e,{WbR+/?~Ӣ}nz/'3%|/<~۳~ik!0nx.Û,fWy虹cdYVkz! g_^޽_>s3N9X(2i|hꑶsh3 --H4KP6=ӯCPbvnVfzgj/<=2}:b"i|^oE;Sܹ@@{\ŋ/x 3)Z=ZYҺo[gDy7Nӱeon[U_ؐ?n<\aEnUgMzu? SQ9m0˺^,dn N\H^IQڣ?d =߃ߓ/!C{[G<}Ѩo;pv Xϰϩ_Xtw ro'V_9_Wx _5Zy>\rh߶vr,C*g虄EvҘ&zIl^X䶤G}>=9m > 0v^k~&6F?e̕Gn f*lв)e¾ʁBA=6F``6xhk=ͻɌr7`sA.Bl=߃'W|3_v\?y/Ra"?HAZL=JJfFWj0Ē/Gv7%9OFGGDƥW+~t =x"!j ռ+CBV]_e։'^**,OMvqmVNs]dw]*}t~mtUVa78܂//ex8󟛤G5Y9y/~Y_]ڷɉ y$ eqQQQ功x¤=:+Vy37GV{y1QQQIeu쨈ؘ}YObk~Q%'2k**ޗQ늎NHI?Lg5_CfR0bP'i<$H UͰ5o|Q3hy>P`@0DBtZ?M VSx vB{zâ`2.]_ĮsqA^ݽeBye?^ymOOm_DF| Epk?OF5ll>q9wzyOrKkQyܰl`Gr7ŕ~?3teF2O}z4/W ~%s ۻg~#MH+ǛC,=i@mXz?| 3 >=CQ-Oڵ~b>=1@0]8+8 Ia!w  M-Ϡx0pDPgkr,#U) ByHh9+m[&[vK[8a?x~rF 2jb?'^ k3: F-sz`<;6^xx^1N]E}kx gӹ軡0>-`^wz`͒=2rϿ%s0˄JazewOTia1~>٥ߓ#|}^33t6x͆~>e*;췏aưwc?{6 7}7v9>2Vv)Mz'TհodgJdt. rx8mY> XO<5NӐ&O̹A ++%)rͮʧt~ӢIl[n3`7oz>Tk:!辉~>٧3O멌?L(v1üQ>~va| 5VS5yv϶Ŷ])تOVR6QCxp]-`]}9m1zxF9&!~é=(j6FO4/s߄o,g|=9Ķ-np6f:9 yrR80dz) 5Hv)3@l2Ts43˜8mş `X,xmF9pl18ucƜ3nQ}xfK=~[<&Co3sx?ÞbiU7il=UͶ2Fe>=3=|z==Y6ŧgNJ9BCbϣRi[i 2$[{pC \&L#=#/O3Yp\г5S&H8esY%ƜM{76u= c헳Ok|5"=9_78u9ozmISP͏j6|kU*S2%|\:\ ҳÞMЯkTvbOpN[sބaauf?À"33o_3~ CFvNIivxv_y3f?8g(y7kv?i3 {]#x*tM?![ONzg?e)x|9Ͱˣg⳪|x_WR|/ 4;w<}<=_OǷ֬U~ع`aJ%[YBߚ@m=c$>5+8A~1]lSsm# Z0J/bxΞ}r] {rKr`2^Wzv3ث|I)3p.)p*42m+<8Vh`vDЯ&hI}.*sæʊ2ϳ9slۃo1tJ}`5{T81V9yRsFSof L q*3О{DO| fgr.z 8g> l >K9|oo __>UsY3\\ճwa/Wf"٫#a%32UϏ_s`ogp ڢEP+$N]pN=GX֣gZ1݂|zF.]fУg8Evd=yOd+ѿv|VѱzV:oN|rUGN=ͱ| 3|JsNya CpZ y_ιgq7=~|+5VyMٜkgO۹X|j _?9_*8ꔽ.wO/c\s/'s~R/WNZHv$/f|NzR2;S\RʶE[Re5_t mk|(-0L|t'g|+Rk8eൌ_o aT|ހ}MaKAM?pZH +oh|){YsA57VlZZ{df|[6X,xfyo9 Y3/sUr[ ͞a{j<ׇD0q R5VJmZ;Y!~{V 7.T孯3yF[+2;8;9l?v\E-0*pj ;Jn]):m8NeS}<Lʐ-<֖'ϔ|=3;ADZ$I}& 횿EP*77kUOҨ0i5MG6@\gb؞$3z馗Lz<3x2I+hOJ _3N$i|k♣+Wv,5>Fތ Zmg. 3ѧmt~^0?2 NoߵWލo7p$(ۏ[GoЈbN}P8VuY(+馕21>fn+JlkGȧQ8P=Z]%+6S9'a>Ezo`րsYi%;ܡMޥu Eƛ"du0QUΊy>D9K` while you type, and reports warnings and errors directly in the buffer, or in an optional :ref:`error list `: .. image:: images/flycheck-annotated.png Out of the box Flycheck supports over :ref:`40 different programming languages ` with more than 80 different syntax checking tools, and comes with a :ref:`simple interface ` to define new syntax checkers. Many :ref:`3rd party extensions ` provide new syntax checkers and other features like alternative error displays or mode line indicators. Try out ======= Flycheck needs GNU Emacs |min-emacs|, and works best on Unix systems. **Windows users**, please be aware that Flycheck does not support Windows officially, although it should mostly work fine on Windows. See :ref:`Windows support ` and watch out for `known Windows issues`_! To try Flycheck in your Emacs session install some :ref:`syntax checker tools ` and type the following in your ``*scratch*`` buffer and run ``M-x eval-buffer``: .. code-block:: cl (require 'package) (add-to-list 'package-archives '("MELPA Stable" . "http://stable.melpa.org/packages/") t) (package-initialize) (package-refresh-contents) (package-install 'flycheck) (global-flycheck-mode) *On MacOS* also add the following to :ref:`fix your $PATH environment variable `: .. code-block:: cl (package-install 'exec-path-from-shell) (exec-path-from-shell-initialize) For a permanent installation of Flycheck follow the :ref:`Installation ` instructions. For a gentle introduction into Flycheck features go through :ref:`Quickstart ` guide. .. important:: If Flycheck fails to run properly or gives you any error messages please take a look at the :ref:`troubleshooting section ` which covers some common setup issues and helps you debug and fix problems with Flycheck. .. _`known windows issues`: https://github.com/flycheck/flycheck/labels/arch%3A%20windows%20only .. _flycheck-user-guide: The User Guide ============== The User Guide provides installation and usage help for Flycheck. It starts with installation instructions and a quick start tutorial and then focuses on an in-depth references of all parts of Flycheck. .. toctree:: user/installation user/quickstart user/troubleshooting user/syntax-checks user/syntax-checkers user/error-reports user/error-list user/error-interaction user/flycheck-versus-flymake .. _flycheck-community-guide: The Community Guide =================== The Community Guide provides information about Flycheck’s ecosystem and community. .. toctree:: community/conduct community/extensions community/get-help community/people .. _flycheck-developer-guide: The Developer Guide =================== The Developer Guide shows how extend Flycheck and how to write syntax checkers for Flycheck. .. toctree:: developer/developing .. _flycheck-contributor-guide: The Contributor Guide ===================== The Contributor Guide explains how to contribute to Flycheck. .. toctree:: contributor/contributing contributor/style-guide contributor/maintaining Indices and Tables ================== * :ref:`flycheck-languages` * :doc:`glossary` * :doc:`changes` * :ref:`genindex` * :ref:`search` .. toctree:: :hidden: languages glossary changes Licensing ========= Flycheck is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. Flycheck is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. See :ref:`flycheck-gpl` for a copy of the GNU General Public License. You may copy, distribute and/or modify the Flycheck documentation under the terms of the Creative Commons Attribution-ShareAlike 4.0 International Public License. See :ref:`flycheck-cc-by-sa` for a copy of the license. Permission is granted to copy, distribute and/or modify the Flycheck logo under the terms of the Creative Commons Attribution-ShareAlike 4.0 International Public License. See :ref:`flycheck-cc-by-sa` for a copy of the license. .. toctree:: :hidden: :maxdepth: 2 licenses flycheck-35.0/doc/info.py000066400000000000000000000145711500215546300153140ustar00rootroot00000000000000# Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors # This file is not part of GNU Emacs. # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . import re from string import Template import requests from docutils import nodes from sphinx.roles import XRefRole from sphinx.util import ws_re, logging logger = logging.getLogger(__name__) # Regular expression object to parse the contents of an Info reference # role. INFO_RE = re.compile(r'\A\((?P[^)]+)\)(?P.+)\Z') class InfoNodeXRefRole(XRefRole): """A role to reference a node in an Info manual.""" innernodeclass = nodes.emphasis def process_link(self, env, refnode, has_explicit_title, title, target): """Process the link created by this role. Swap node and manual name, to more closely match the look of references in Texinfo. """ # Normalize whitespace in info node targets target = ws_re.sub(' ', target) refnode['has_explicit_title'] = has_explicit_title if not has_explicit_title: match = INFO_RE.match(target) if match: # Swap title and node to create a title like info does title = '{0}({1})'.format(match.group('node'), match.group('manual')) return title, target def node_encode(char): if char.isalnum(): return char elif char == ' ': return '-' else: return '_00{:02x}'.format(ord(char)) def expand_node_name(node): """Expand ``node`` for use in HTML. ``node`` is the name of a node as string. Return a pair ``(filename, anchor)``, where ``filename`` is the base-name of the corresponding file, sans extension, and ``anchor`` the HTML anchor. See http://www.gnu.org/software/texinfo/manual/texinfo/html_node/HTML-Xref-Node-Name-Expansion.html. """ if node == 'Top': return ('index', 'Top') else: normalized = ws_re.sub(' ', node.strip()) encoded = ''.join(node_encode(c) for c in normalized) prefix = 'g_t' if not node[0].isalpha() else '' return (encoded, prefix + encoded) class HTMLXRefDB(object): """Cross-reference database for Info manuals.""" #: URL of the htmlxref database of GNU Texinfo XREF_URL = 'http://ftpmirror.gnu.org/texinfo/htmlxref.cnf' #: Regular expression to parse entries from an xref DB XREF_RE = re.compile(r""" ^\s* (?: (?P[#].*) | (?P\w+)\s*=\s*(?P\S+) | (?P\w+)\s*(?Pnode|mono)\s*(?P\S+) ) \s*$""", re.VERBOSE) @classmethod def parse(cls, htmlxref): substitutions = {} manuals = {} for line in htmlxref.splitlines(): match = cls.XREF_RE.match(line) if match: if match.group('substname'): url = Template(match.group('substurl')).substitute( substitutions) substitutions[match.group('substname')] = url elif (match.group('manname') and match.group('mantype') == 'node'): url = Template(match.group('manurl')).substitute( substitutions) manuals[match.group('manname')] = url return cls(manuals) def __init__(self, entries): """Initialize the HTMLXrefDB object with the provided entries.""" self.entries = entries def resolve(self, manual, node): manual_url = self.entries.get(manual) if not manual_url: return None else: filename, anchor = expand_node_name(node) return manual_url + filename + '.html#' + anchor def update_htmlxref(app): if not isinstance(getattr(app.env, 'info_htmlxref', None), HTMLXRefDB): logger.info('fetching Texinfo htmlxref database from {0}... '.format( HTMLXRefDB.XREF_URL)) try: app.env.info_htmlxref = HTMLXRefDB.parse( requests.get(HTMLXRefDB.XREF_URL).text) except requests.exceptions.ConnectionError: logger.warning('Failed to load xref DB. ' 'Info references will not be resolved') app.env.info_htmlxref = None def resolve_info_references(app, _env, refnode, contnode): """Resolve Info references. Process all :class:`~sphinx.addnodes.pending_xref` nodes whose ``reftype`` is ``infonode``. Replace the pending reference with a :class:`~docutils.nodes.reference` node, which references the corresponding web URL, as stored in the database referred to by :data:`HTMLXREF_URL`. """ if refnode['reftype'] != 'infonode': return None target = ws_re.sub(' ', refnode['reftarget']) match = INFO_RE.match(target) if not match: logger.warning('Invalid info target: {0}'.format(target), location=(refnode.source, refnode.line)) return contnode manual = match.group('manual') node = match.group('node') xrefdb = app.env.info_htmlxref if xrefdb: uri = xrefdb.resolve(manual, node) if not uri: message = 'Cannot resolve info manual {0}'.format(manual) logger.warning(message, location=(refnode.source, refnode.line)) return contnode else: reference = nodes.reference('', '', internal=False, refuri=uri, reftitle=target) reference += contnode return reference else: # Without an xref DB we're unable to resolve any info references return None def setup(app): app.add_role('infonode', InfoNodeXRefRole()) app.connect(str('builder-inited'), update_htmlxref) app.connect(str('missing-reference'), resolve_info_references) return {'version': '0.1', 'parallel_read_safe': True} flycheck-35.0/doc/languages.rst000066400000000000000000001405671500215546300165140ustar00rootroot00000000000000.. _flycheck-languages: ===================== Supported Languages ===================== This document lists all programming and markup languages which Flycheck supports. .. note:: Extensions may provide support for additional languages or add deeper integration with existing languages. Take a look at the :ref:`list of extensions ` to see what the community can offer to you. Each language has one or more syntax checkers whose names follow a convention of :samp:`{language}-{tool}`. All syntax checkers are listed in the order they would be applied to a buffer, with all available options. For more information about a syntax checker open Emacs and use :command:`flycheck-describe-checker` to view the docstring of the syntax checker. Likewise, you may use :command:`describe-variable` to read the complete docstring of any option. .. supported-language:: Ada .. syntax-checker:: ada-gnat Check ADA syntax and types with `GNAT`_. .. _GNAT: https://www.adacore.com/community/ .. defcustom:: flycheck-gnat-args A list of additional options. .. defcustom:: flycheck-gnat-include-path A list of include directories. Relative paths are relative to the path of the buffer being checked. .. defcustom:: flycheck-gnat-language-standard The language standard to use as string. .. defcustom:: flycheck-gnat-warnings A list of additional warnings to enable. Each item is the name of a warning category to enable. .. supported-language:: AsciiDoc .. syntax-checker:: asciidoctor Check AsciiDoc with the default Asciidoctor_ backend. .. _Asciidoctor: http://asciidoctor.org .. syntax-checker:: asciidoc Check AsciiDoc_ with the standard AsciiDoc processor. .. _AsciiDoc: http://www.methods.co.nz/asciidoc .. supported-language:: Awk .. syntax-checker:: awk-gawk Check Awk with gawk_. .. _gawk: https://www.gnu.org/software/gawk/manual .. supported-language:: Bazel .. syntax-checker:: bazel-build-buildifier bazel-module-buildifier bazel-starlark-buildifier bazel-workspace-buildifier Check Bazel with buildifier_. .. _buildifier: https://github.com/bazelbuild/buildtools .. supported-language:: C/C++ :index_as: C C++ Flycheck checks C and C++ with either `c/c++-clang` or `c/c++-gcc`, and then with `c/c++-cppcheck`. .. syntax-checker:: c/c++-clang c/c++-gcc Check C/C++ for syntax and type errors with Clang_ or GCC_ respectively. .. note:: `c/c++-gcc` requires GCC 4.4 or newer. .. _Clang: http://clang.llvm.org/ .. _GCC: https://gcc.gnu.org/ .. defcustom:: flycheck-clang-args flycheck-gcc-args A list of additional arguments for `c/c++-clang` and `c/c++-gcc` respectively. .. defcustom:: flycheck-clang-blocks Whether to enable blocks in `c/c++-clang`. .. defcustom:: flycheck-clang-definitions flycheck-gcc-definitions A list of additional preprocessor definitions for `c/c++-clang` and `c/c++-gcc` respectively. .. defcustom:: flycheck-clang-include-path flycheck-gcc-include-path A list of include directories for `c/c++-clang` and `c/c++-gcc` respectively, relative to the file being checked. .. defcustom:: flycheck-clang-includes flycheck-gcc-includes A list of additional include files for `c/c++-clang` and `c/c++-gcc` respectively, relative to the file being checked. .. defcustom:: flycheck-clang-language-standard flycheck-gcc-language-standard The language standard to use in `c/c++-clang` and `c/c++-gcc` respectively as string, via the ``-std`` option. .. defcustom:: flycheck-clang-ms-extensions Whether to enable Microsoft extensions to C/C++ in `c/c++-clang`. .. defcustom:: flycheck-clang-no-exceptions flycheck-gcc-no-exceptions Whether to disable exceptions in `c/c++-clang` and `c/c++-gcc` respectively. .. defcustom:: flycheck-clang-no-rtti flycheck-gcc-no-rtti Whether to disable RTTI in `c/c++-clang` and `c/c++-gcc` respectively, via ``-fno-rtti``. .. defcustom:: flycheck-clang-standard-library The name of the standard library to use for `c/c++-clang`, as string. .. defcustom:: flycheck-gcc-openmp Whether to enable OpenMP in `c/c++-gcc`. .. defcustom:: flycheck-clang-pedantic flycheck-gcc-pedantic Whether to warn about language extensions in `c/c++-clang` and `c/c++-gcc` respectively. .. defcustom:: flycheck-clang-pedantic-errors flycheck-gcc-pedantic-errors Whether to error on language extensions in `c/c++-clang` and `c/c++-gcc` respectively. .. defcustom:: flycheck-clang-warnings flycheck-gcc-warnings A list of additional warnings to enable in `c/c++-clang` and `c/c++-gcc` respectively. Each item is the name of a warning or warning category for ``-W``. .. syntax-checker:: c/c++-cppcheck Check C/C++ for semantic and stylistic issues with cppcheck_. .. _cppcheck: http://cppcheck.sourceforge.net/ .. defcustom:: flycheck-cppcheck-args A list of additional arguments. .. defcustom:: flycheck-cppcheck-checks A list of enabled checks. Each item is the name of a check for the ``--enable`` option. .. defcustom:: flycheck-cppcheck-inconclusive Whether to enable inconclusive checks. These checks may yield more false positives than normal checks. .. note:: This option requires cppcheck 1.54 or newer. .. defcustom:: flycheck-cppcheck-include-path A list of include directories. Relative paths are relative to the file being checked. .. defcustom:: flycheck-cppcheck-standards The C, C++ and/or POSIX standards to use via one or more ``--std=`` arguments. .. defcustom:: flycheck-cppcheck-suppressions The cppcheck suppressions list to use via one or more ``--suppress=`` arguments. .. defcustom:: flycheck-cppcheck-suppressions-file The cppcheck suppressions file to use via the ``--suppressions-list=`` argument. .. supported-language:: CFEngine .. syntax-checker:: cfengine Check syntax with `CFEngine `_. .. supported-language:: Coffeescript Flycheck checks Coffeescript syntax with `coffee` and then lints with `coffee-coffeelint`. .. syntax-checker:: coffee Check syntax with the `Coffeescript `_ compiler. .. syntax-checker:: coffee-coffeelint Lint with `Coffeelint `_. .. syntax-checker-config-file:: flycheck-coffeelintrc .. supported-language:: CSS .. syntax-checker:: css-csslint Check syntax and style with `CSSLint`_. .. _CSSLint: https://github.com/CSSLint/csslint .. syntax-checker:: css-stylelint Syntax-check and lint CSS with stylelint_. .. _stylelint: https://stylelint.io .. syntax-checker-config-file:: flycheck-stylelintrc .. defcustom:: flycheck-stylelint-quiet Whether to run stylelint in quiet mode via ``--quiet``. .. supported-language:: CUDA C/C++ :index_as: CUDA .. syntax-checker:: cuda-nvcc Checks syntax for CUDA C/C++ using the nvcc `nvcc `_ compiler bundled in the NVIDIA Toolkit. CUDA C/C++ uses whichever system compiler you have configured, gcc/clang etc, but will sanitise error messages into a standardised format that can be picked up via flycheck. Corner cases may cause some odd behavior. .. defcustom:: flycheck-cuda-language-standard The C or C++ Language standard that you want the CUDA compiler to enforce. .. defcustom:: flycheck-cuda-gencodes A list of include real and virtual GPU architectures for nvcc. .. defcustom:: flycheck-cuda-includes A list of cuda includes. .. defcustom:: flycheck-cuda-include-path A list of include directories for nvcc. .. defcustom:: flycheck-cuda-definitions Additional preprocessor definitions for nvcc. Is passed unaltered to both GPU compiler and underlying C/C++ compiler. .. defcustom:: flycheck-cuda-relaxed-constexpr Enable calling host constexpr from device function for nvcc. .. defcustom:: flycheck-cuda-extended-lambda Allows for ``__host__ __device__`` lambdas as described (`here `_). .. defcustom:: flycheck-cuda-compiler-options Specify options directly to the compiler/preprocessor. .. supported-language:: CWL .. syntax-checker:: cwl Syntax check with (`Schema Salad `_). .. defcustom:: flycheck-cwl-schema-path A path for the schema file for Common Workflow Language. .. supported-language:: D .. syntax-checker:: d-dmd Check syntax and types with (`DMD `_). .. note:: This syntax checker requires DMD 2.066 or newer. .. defcustom:: flycheck-dmd-include-path A list of include directories. .. defcustom:: flycheck-dmd-args A list of additional arguments. .. seealso:: :flyc:`flycheck-d-unittest` Flycheck extension which provides a syntax checker to run D unittests on the fly and report the results with Flycheck. .. supported-language:: Dockerfile .. syntax-checker:: dockerfile-hadolint Check syntax and code style with hadolint_ .. _hadolint: https://github.com/hadolint/hadolint .. supported-language:: Elixir .. syntax-checker:: elixir-credo Check code style with `credo `_ .. defcustom:: flycheck-elixir-credo-strict When non-nil, run credo in strict mode, via ``--strict``. .. supported-language:: Emacs Lisp Flycheck checks Emacs Lisp with `emacs-lisp` and then with `emacs-lisp-checkdoc`. .. syntax-checker:: emacs-lisp Check syntax with the built-in byte compiler. .. defcustom:: flycheck-emacs-lisp-load-path The load path as list of strings. Relative directories are expanded against the `default-directory` of the buffer being checked. .. defcustom:: flycheck-emacs-lisp-initialize-packages Whether to initialize Emacs' package manager with `package-initialize` before checking the buffer. If set to :elisp:`auto` (the default), only initialize the package managers when checking files under `user-emacs-directory`. .. defcustom:: flycheck-emacs-lisp-package-user-dir The package directory as string. Has no effect if `flycheck-emacs-lisp-initialize-packages` is nil. .. defcustom:: flycheck-emacs-lisp-check-declare If non-nil, also check `declare-function` forms using `check-declare-file`. .. syntax-checker:: emacs-lisp-checkdoc Check Emacs Lisp documentation conventions with ``checkdoc``. .. seealso:: :infonode:`(elisp)Documentation Tips` Information about documentation conventions for Emacs Lisp. :gh:`purcell/flycheck-package` Flycheck extension which adds a syntax checker to check for violation of Emacs Lisp library headers and packaging conventions. :infonode:`(elisp)Library Headers` Information about library headers for Emacs Lisp files. .. supported-language:: Ember Templates .. syntax-checker:: ember-template Check your Ember templates with `ember-template-lint `_ .. syntax-checker-config-file:: flycheck-ember-template-lintrc .. supported-language:: Erlang Flycheck checks Erlang with `erlang-rebar3` in rebar projects and `erlang` otherwise. .. syntax-checker:: erlang Check Erlang with the standard `Erlang `_ compiler. .. defcustom:: flycheck-erlang-include-path A list of include directories. .. defcustom:: flycheck-erlang-library-path A list of library directories. .. syntax-checker:: erlang-rebar3 Check Erlang with the `rebar3 `_ build tool. .. defcustom:: flycheck-erlang-rebar3-profile The profile to use when compiling, e.g. "default" or "test". The default value is nil which will use the test profile in test directories, the eqc profile in eqc directories and the default profile otherwise. .. supported-language:: ERuby .. syntax-checker:: eruby-erubis Check ERuby with `erubis `_. .. syntax-checker:: eruby-ruumba Check syntax and lint with `Ruumba `_. .. note:: This syntax checker requires Ruumba 0.1.7 or newer. .. defcustom:: flycheck-ruumba-lint-only Whether to suppress warnings about style issues, via the ``--lint`` option. .. syntax-checker-config-file:: flycheck-ruumbarc .. supported-language:: Fortran .. syntax-checker:: fortran-gfortran Check Fortran syntax and type with GFortran_. .. _GFortran: https://gcc.gnu.org/onlinedocs/gfortran/ .. defcustom:: flycheck-gfortran-args A list of additional arguments. .. defcustom:: flycheck-gfortran-include-path A list of include directories. Relative paths are relative to the file being checked. .. defcustom:: flycheck-gfortran-language-standard The language standard to use via the ``-std`` option. .. defcustom:: flycheck-gfortran-layout The source code layout to use. Set to :elisp:`free` or :elisp:`fixed` for free or fixed layout respectively, or nil (the default) to let GFortran automatically determine the layout. .. defcustom:: flycheck-gfortran-warnings A list of warnings enabled via the ``-W`` option. .. supported-language:: Go Flycheck checks Go with the following checkers: 1. `go-gofmt` 2. `go-vet` 3. `go-build` or `go-test` 4. `go-errcheck` 5. `go-unconvert` 6. `go-staticcheck` .. syntax-checker:: go-gofmt Check Go syntax with `gofmt `_. .. syntax-checker:: go-vet Check Go for suspicious code with vet_. .. defcustom:: flycheck-go-vet-print-functions A list of print-like functions to check calls for format string problems. .. defcustom:: flycheck-go-build-tags A list of build tags. .. _vet: https://golang.org/cmd/vet/ .. syntax-checker:: go-build Check syntax and type with the `Go compiler`_. .. note:: This syntax checker requires Go 1.6 or newer. .. _Go compiler: https://golang.org/cmd/go .. defcustom:: flycheck-go-build-install-deps Whether to install dependencies while checking with `go-build` or `go-test` .. defcustom:: flycheck-go-build-tags :noindex: See `flycheck-go-build-tags` .. syntax-checker:: go-test Check syntax and types of Go tests with the `Go compiler`_. .. note:: This syntax checker requires Go 1.6 or newer. .. defcustom:: flycheck-go-build-install-deps :noindex: See `flycheck-go-build-install-deps`. .. defcustom:: flycheck-go-build-tags :noindex: See `flycheck-go-build-tags` .. syntax-checker:: go-errcheck Check for unhandled error returns in Go with errcheck_. .. note:: This syntax checker requires errcheck build from commit 8515d34 (Aug 28th, 2015) or newer. .. _errcheck: https://github.com/kisielk/errcheck .. defcustom:: flycheck-go-build-tags :noindex: See `flycheck-go-build-tags` .. syntax-checker:: go-unconvert Check for unnecessary type conversions with unconvert_. .. _unconvert: https://github.com/mdempsky/unconvert .. syntax-checker:: go-staticcheck Perform static analysis and code linting with staticcheck_, the successor to megacheck. .. defcustom:: flycheck-go-version staticcheck_ explicitly supports the last two releases of Go, but supports targeting older versions. Go versions should be specified like, "1.6", or, "1.11.4". .. _staticcheck: https://staticcheck.io/ .. supported-language:: Groovy .. syntax-checker:: groovy Check syntax using the `Groovy `_ compiler. .. supported-language:: Haml .. syntax-checker:: haml Check syntax with the `Haml `_ compiler. .. syntax-checker:: haml-lint Check style and syntax with the `HAML-Lint `_ linter. .. supported-language:: Handlebars .. syntax-checker:: handlebars Check syntax with the `Handlebars `_ compiler. .. supported-language:: Haskell Flycheck checks Haskell with `haskell-stack-ghc` (in Stack projects) or `haskell-ghc`, and then with `haskell-hlint`. .. seealso:: :flyc:`flycheck-haskell` Flycheck extension to configure Flycheck's Haskell checkers from the metadata, with support for Cabal sandboxes. :flyc:`flycheck-hdevtools` Flycheck extension which adds an alternative syntax checker for GHC using `hdevtools `_. .. syntax-checker:: haskell-stack-ghc haskell-ghc Check syntax and type GHC_. In Stack_ projects invoke GHC through Stack to bring package dependencies from Stack in. .. _GHC: https://www.haskell.org/ghc/ .. _Stack: https://github.com/commercialhaskell/stack .. defcustom:: flycheck-ghc-args A list of additional arguments. .. defcustom:: flycheck-ghc-no-user-package-database Whether to disable the user package database (only for `haskell-ghc`). .. defcustom:: flycheck-ghc-stack-use-nix Whether to enable Nix support for Stack (only for `haskell-stack-ghc`). .. defcustom:: flycheck-ghc-stack-project-file Allows to override the default ``stack.yaml`` file for Stack, via ``--stack-yaml`` (only for `haskell-stack-ghc`). .. defcustom:: flycheck-ghc-package-databases A list of additional package databases for GHC (only for `haskell-ghc`). Each item points to a directory containing a package directory, via ``-package-db``. .. defcustom:: flycheck-ghc-search-path A list of module directories, via ``-i``. .. defcustom:: flycheck-ghc-language-extensions A list of language extensions, via ``-X``. .. syntax-checker:: haskell-hlint Lint with `hlint `_. .. defcustom:: flycheck-hlint-args A list of additional arguments. .. defcustom:: flycheck-hlint-language-extensions A list of language extensions to enable. .. defcustom:: flycheck-hlint-ignore-rules A list of rules to ignore. .. defcustom:: flycheck-hlint-hint-packages A list of additional hint packages to include. .. syntax-checker-config-file:: flycheck-hlintrc .. supported-language:: HTML .. syntax-checker:: html-tidy Check HTML syntax and style with `Tidy HTML5`_. .. _Tidy HTML5: https://github.com/htacg/tidy-html5 .. syntax-checker-config-file:: flycheck-tidyrc .. supported-language:: Javascript Flycheck checks Javascript with one of `javascript-eslint` or `javascript-jshint`. Alternatively `javascript-standard` is used instead all of the former ones. .. syntax-checker:: javascript-eslint Check syntax and lint with `ESLint `_. .. note:: Flycheck automatically :ref:`disables ` this syntax checker if eslint cannot find a valid configuration file for the current buffer. .. defcustom:: flycheck-eslint-args A list of additional arguments that are passed to eslint. .. defcustom:: flycheck-eslint-rules-directories A list of directories with custom rules. .. syntax-checker:: javascript-jshint Check syntax and lint with `JSHint `_. .. defcustom:: flycheck-jshint-extract-javascript Whether to extract Javascript from HTML before linting. .. syntax-checker-config-file:: flycheck-jshintrc .. syntax-checker:: javascript-standard Check syntax and code style with Standard_ or Semistandard_. .. _Standard: https://github.com/standard/standard .. _Semistandard: https://github.com/Flet/semistandard .. supported-language:: JSON Flycheck checks JSON with `json-jsonlint`, `json-python-json`, or `json-jq`. .. syntax-checker:: json-jsonlint Check JSON with `jsonlint `_. .. syntax-checker:: json-python-json Check JSON with Python's built-in :py:mod:`json` module. .. syntax-checker:: json-jq Check JSON with jq_. This checker accepts multiple consecutive JSON values in a single input, which is useful for jsonlines data. .. _jq: https://stedolan.github.io/jq/ .. supported-language:: Jsonnet .. syntax-checker:: jsonnet Checks `Jsonnet `_ with the `jsonnet` binary published at `https://github.com/google/go-jsonnet`_. .. defcustom:: flycheck-jsonnet-command-args A list of additional arguments that are passed to `jsonnet`. .. defcustom:: flycheck-jsonnet-include-paths A list of include directories. These are passed to the `jsonnet` binary via ``-J``. Relative paths are resolved relative to the path of the buffer being checked. .. supported-language:: Less .. syntax-checker:: less Check syntax with the `Less `_ compiler. .. note:: This syntax checker requires lessc 1.4 or newer. .. syntax-checker:: less-stylelint Syntax-check and lint Less with stylelint_. .. _stylelint: https://stylelint.io .. syntax-checker-config-file:: flycheck-stylelintrc .. defcustom:: flycheck-stylelint-quiet Whether to run stylelint in quiet mode via ``--quiet``. .. supported-language:: LLVM .. syntax-checker:: llvm-llc Check syntax with `llc `_. .. supported-language:: Lua Flycheck checks Lua with `lua-luacheck`, falling back to `lua`. .. syntax-checker:: lua-luacheck Check syntax and lint with Luacheck_. .. syntax-checker-config-file:: flycheck-luacheckrc .. defcustom:: flycheck-luacheck-standards The luacheck standards to use via one or more ``--std`` arguments. .. _Luacheck: https://github.com/mpeterv/luacheck .. syntax-checker:: lua Check syntax with the `Lua compiler `_. .. supported-language:: Markdown Flycheck checks Markdown with `markdownlint-cli`, `markdownlint-cli2`, `mdl` (that's the binary of the Ruby project `markdownlint`) or `pymarkdown`. `markdownlint-cli` and `markdownlint-cli2` are different command-line interfaces for the same `markdownlint` library (written in JavaScript). .. syntax-checker:: markdown-markdownlint-cli Check Markdown with markdownlint-cli_. .. _markdownlint-cli: https://github.com/igorshubovych/markdownlint-cli .. syntax-checker-config-file:: flycheck-markdown-markdownlint-cli-config .. defcustom:: flycheck-markdown-markdownlint-cli-disable-rules A list of disabled rules. .. defcustom:: flycheck-markdown-markdownlint-cli-enable-rules A list of enabled rules. .. syntax-checker:: markdown-markdownlint-cli2 Check Markdown with markdownlint-cli2_. .. _markdownlint-cli2: https://github.com/DavidAnson/markdownlint-cli2 .. syntax-checker-config-file:: flycheck-markdown-markdownlint-cli2-config .. syntax-checker:: markdown-mdl Check Markdown with markdownlint_ (a.k.a. ``mdl``). .. _markdownlint: https://github.com/markdownlint/markdownlint/ .. defcustom:: flycheck-markdown-mdl-rules A list of enabled rules. .. defcustom:: flycheck-markdown-mdl-tags A list of enabled rule tags. .. syntax-checker-config-file:: flycheck-markdown-mdl-style .. syntax-checker:: markdown-pymarkdown Check Markdown with PyMarkdown_. .. _PyMarkdown: https://pypi.org/project/pymarkdownlnt/ .. syntax-checker-config-file:: flycheck-markdown-pymarkdown-config .. supported-language:: Nix .. syntax-checker:: nix Check Nix with nix-instantiate_. .. _nix-instantiate: https://nixos.org/nix/manual/#sec-nix-instantiate .. syntax-checker:: nix-linter Check Nix with nix-linter_. .. _nix-linter: https://github.com/Synthetica9/nix-linter .. syntax-checker:: statix Check Nix with statix_. .. _statix: https://github.com/nerdypepper/statix .. supported-language:: Opam .. syntax-checker:: opam Check Opam configuration files with `opam lint`_. .. _opam lint: https://opam.ocaml.org/doc/man/opam-lint.html .. supported-language:: Perl Flycheck checks Perl with `perl`, `perl-perlcritic`, and `perl-perlimports`. .. syntax-checker:: perl Check syntax with the `Perl `_ interpreter. .. defcustom:: flycheck-perl-include-path A list of include directories, relative to the file being checked. .. defcustom:: flycheck-perl-module-list A list of module names to implicitly use. .. syntax-checker:: perl-perlcritic Lint and check style with `Perl::Critic`_. .. _Perl::Critic: https://metacpan.org/pod/Perl::Critic .. defcustom:: flycheck-perlcritic-severity The severity level as integer for the ``--severity``. .. defcustom:: flycheck-perlcritic-theme The theme expression, passed as the ``--theme`` to ``perlcritic``. .. syntax-checker-config-file:: flycheck-perlcriticrc .. syntax-checker:: perl-perlimports Clean up Perl import statements with `perlimports`_. .. _perlimports: https://metacpan.org/dist/App-perlimports/view/script/perlimports .. supported-language:: PHP Flycheck checks PHP with `php`, `php-phpmd`, `php-phpcs` and `php-phpcs-changed`. .. syntax-checker:: php Check syntax with `PHP CLI`_ .. _PHP CLI: http://php.net/manual/en/features.commandline.php .. syntax-checker:: php-phpmd Lint with `PHP Mess Detector `_. .. defcustom:: flycheck-phpmd-rulesets A list of rule sets. Each item is either the name of a default rule set, or the path to a custom rule set file. .. syntax-checker:: php-phpcs Check style with `PHP Code Sniffer`_. .. note:: This syntax checker requires PHP Code Sniffer 2.6 or newer. .. _PHP Code Sniffer: http://pear.php.net/package/PHP_CodeSniffer .. defcustom:: flycheck-phpcs-standard The coding standard, either as name of a built-in standard, or as path to a standard specification. .. syntax-checker:: php-phpcs-changed Check style with `PHPCS Changed`_. .. note:: This syntax checker requires PHP Code Sniffer 2.6 or newer. .. _PHP Code Sniffer: http://pear.php.net/package/PHP_CodeSniffer .. _PHPCS Changed: https://github.com/sirbrillig/phpcs-changed .. defcustom:: flycheck-phpcs-standard The coding standard, either as name of a built-in standard, or as path to a standard specification. .. supported-language:: Processing .. syntax-checker:: processing Check syntax using the `Processing `_ compiler. .. supported-language:: Protobuf .. syntax-checker:: protobuf-protoc Check syntax using the protoc_ compiler. .. _protoc: https://developers.google.com/protocol-buffers/ .. defcustom:: flycheck-protoc-import-path A list of directories to resolve import directives. Relative paths are relative to the path of the buffer being checked. .. syntax-checker:: protobuf-prototool Lint with `prototool `_. .. supported-language:: Pug .. syntax-checker:: pug Check syntax using the `Pug `_ compiler. .. supported-language:: Puppet Flycheck checks Puppet with `puppet-parser` and lints with `puppet-lint`. .. syntax-checker:: puppet-parser Check syntax with the `Puppet `_ compiler. .. syntax-checker:: puppet-lint Link with `Puppet Lint `_. .. defcustom:: flycheck-puppet-lint-disabled-checks A list of checks to disable. .. syntax-checker-config-file:: flycheck-puppet-lint-rc .. supported-language:: Python Flycheck checks Python with `python-flake8` or `python-pylint`, and falls back to `python-pycompile` if neither of those is available. All Python checkers are invoked indirectly using ``python -c ...`` (rather than a direct call to ``flake8`` or ``pylint``) to make it easier to switch between Python 2 and 3. For example, you can use ``(setq flycheck-python-pylint-executable "python3")`` to run ``pylint`` using Python 3, or ``(defvaralias 'flycheck-python-flake8-executable 'python-shell-interpreter)`` to run ``flake8`` through the executable pointed to by ``python-shell-interpreter``. .. note:: If Flycheck complains about a missing Python checker, make sure that the checker is reachable from ``sys.path``, using e.g. ``python -m pylint``: often, the issue is that the checker is installed globally but not in the current virtualenv. Alternatively, you can invoke the checker script directly, with ``(setq flycheck-python-pylint-executable "pylint")``. .. seealso:: :gh:`flycheck-pyflakes ` Flycheck extension which adds a syntax checker using `Pyflakes `_. :gh:`msherry/flycheck-pycheckers` Flycheck extension which can use multiple checkers simultaneously -- including pyflakes, pep8, flake8, pylint, and mypy 2/3. .. syntax-checker:: python-flake8 Check syntax and lint with `flake8 `_. .. note:: This syntax checker requires flake8 3.0 or newer. .. defcustom:: flycheck-flake8-error-level-alist An alist mapping Flake8 error IDs to Flycheck error levels. .. defcustom:: flycheck-flake8-maximum-complexity The maximum McCabe complexity allowed for methods. .. defcustom:: flycheck-flake8-maximum-line-length The maximum length of lines. .. syntax-checker-config-file:: flycheck-flake8rc .. syntax-checker:: python-ruff Lint with `ruff `_. .. syntax-checker-config-file:: flycheck-python-ruff-config .. syntax-checker:: python-pyright Type check python with `pyright `_. .. note:: This syntax checker requires pyright. .. syntax-checker:: python-mypy Type check python with `mypy `_. .. note:: This syntax checker requires mypy 0.730 or newer. .. syntax-checker-config-file:: flycheck-python-mypy-config .. defcustom:: flycheck-python-mypy-cache-dir Directory used to write ``.mypy_cache`` directories. Set to ``null-device`` to disable writing cache directories entirely. .. defcustom:: flycheck-python-mypy-python-executable Python executable to collect the type information from PEP 561 compliant packages. .. syntax-checker:: python-pylint Check syntax and lint with `Pylint `_. .. note:: This syntax checker requires Pylint 1.0 or newer. .. defcustom:: flycheck-pylint-use-symbolic-id Whether to report symbolic (e.g. ``no-name-in-module``) or numeric (e.g. ``E0611``) message identifiers. .. syntax-checker-config-file:: flycheck-pylintrc .. syntax-checker:: python-pycompile Check syntax with Python's byte compiler (see :py:mod:`py_compile`). .. supported-language:: R .. syntax-checker:: r-lintr Check syntax and lint with `lintr `_. .. defcustom:: flycheck-lintr-caching Whether to enable caching in lintr. On by default; it is not recommended to disable caching unless it causes actual problems. .. defcustom:: flycheck-lintr-linters Linters to use as a string with an R expression which selects the linters to use. .. syntax-checker:: r Check syntax with R's builtin ``parse`` function. .. supported-language:: Racket .. syntax-checker:: racket Check syntax with `raco expand`_ from the ``compiler-lib`` package. .. note:: This syntax checker needs the ``compiler-lib`` package. .. _raco expand: http://docs.racket-lang.org/raco/expand.html .. supported-language:: RPM Spec .. syntax-checker:: rpm-rpmlint Lint with `rpmlint `_. .. supported-language:: reStructuredText Flycheck checks reStructuredText with `rst-sphinx` in Sphinx_ projects and with `rst` otherwise. .. _Sphinx: http://sphinx-doc.org/ .. syntax-checker:: rst-sphinx Check documents with Sphinx_. .. note:: This syntax checker requires Sphinx 1.2 or newer. .. defcustom:: flycheck-sphinx-warn-on-missing-references Whether to emit warnings for all missing references. .. syntax-checker:: rst Check documents with `docutils `_. .. supported-language:: Ruby Flycheck checks Ruby with `ruby-rubocop` and `ruby-reek`, falling back to `ruby` or `ruby-jruby` for basic syntax checking if those are not available. There's also `ruby-chef-cookstyle`, which is only used for Chef cookbooks. .. syntax-checker:: ruby-rubocop Check syntax and lint with `RuboCop `_. .. note:: This syntax checker requires Rubocop 0.34 or newer. .. defcustom:: flycheck-rubocop-lint-only Whether to suppress warnings about style issues, via the ``--lint`` option. .. syntax-checker-config-file:: flycheck-rubocoprc .. syntax-checker:: ruby-standard Check syntax and lint with `Ruby Standard `_. .. note:: This syntax checker and ruby-rubocop are mutually exclusive, since Standard employs an opinionated rubocop config. .. defcustom:: flycheck-rubocop-lint-only :noindex: See `flycheck-rubocop-lint-only`. .. syntax-checker-config-file:: flycheck-ruby-standardrc .. syntax-checker:: ruby-reek Check syntax and lint with reek_. .. _Reek: https://github.com/troessner/reek .. syntax-checker-config-file:: flycheck-reekrc .. note:: ``flycheck-reekrc`` defaults to ``nil``, because Reek can find its own configuration. .. syntax-checker:: ruby Check syntax with the `Ruby `_ interpreter. .. syntax-checker:: ruby-jruby Check syntax with the `JRuby `_ interpreter. .. syntax-checker:: ruby-chef-cookstyle Check syntax and lint with `Cookstyle `_. .. note:: Cookstyle is just a wrapper around RuboCop, so this checker is almost the same as ``ruby-rubocop``. .. defcustom:: flycheck-rubocop-lint-only Whether to suppress warnings about style issues, via the ``--lint`` option. .. syntax-checker-config-file:: flycheck-rubocoprc .. supported-language:: Rust Flycheck checks Rust_ with `rust-cargo` in Cargo projects, or `rust` otherwise. For Cargo projects, you can also use the clippy_ linter with `rust-clippy`. .. _Rust: https://www.rust-lang.org/ .. _clippy: https://github.com/rust-lang-nursery/rust-clippy .. syntax-checker:: rust-cargo rust rust-clippy Check syntax and types with the Rust_ compiler. In a Cargo_ project the compiler is invoked through ``cargo check`` to take Cargo dependencies into account. `rust-clippy` has no configurable options. .. note:: `rust-cargo` requires Rust 1.17 or newer. `rust` requires Rust 1.18 or newer. `rust-clippy` requires the nightly version of Rust. .. _Cargo: http://doc.crates.io/index.html .. seealso:: :flyc:`flycheck-rust` Flycheck extension to configure Rust syntax checkers according to the current Cargo_ project. .. defcustom:: flycheck-rust-args A list of additional arguments that are passed to rustc. This option is ignored by `rust-cargo`. .. defcustom:: flycheck-cargo-check-args A list of additional arguments passed to the ``cargo check`` subcommand. .. defcustom:: flycheck-rust-check-tests Whether to check test code in Rust. .. defcustom:: flycheck-rust-crate-root A path to the crate root for the current buffer, or nil if the current buffer is a crate by itself. `rust-cargo` ignores this option as the crate root is given by Cargo. .. defcustom:: flycheck-rust-crate-type For `rust-cargo`, the target type as a string, one of ``lib``, ``bin``, ``example``, ``test`` or ``bench``. Can also be nil for projects with a single target. For `rust`, the type of the crate to check, as a string for the ``--crate-type`` option. .. defcustom:: flycheck-rust-binary-name The name of the binary to pass to ``cargo check --TARGET-TYPE``, as a string. For `rust-cargo`, always required unless `flycheck-rust-crate-type` is ``lib`` or nil, in which case it is ignored. Ignored by `rust`. .. defcustom:: flycheck-rust-features List of features to activate during build or check. The value of this variable is a list of strings denoting features that will be activated to build the target to check. Features will be passed to ``cargo check --features=FEATURES``. Empty by default. Ignored by `rust`. .. defcustom:: flycheck-rust-library-path A list of additional library directories. Relative paths are relative to the buffer being checked. .. supported-language:: SaltStack .. syntax-checker:: salt-lint Flycheck checks SaltStack YAML files with SALT-Lint_. .. _SALT-Lint: https://salt-lint.readthedocs.io/en/latest/ .. supported-language:: Sass/SCSS Flycheck checks SASS with `sass/scss-sass-lint` or `sass-stylelint`, falling back to `sass`, and SCSS with `scss-lint` or `scss-stylelint` falling back to `sass/scss-sass-lint` first and then `scss` if neither is available. .. syntax-checker:: scss-lint Syntax-check and lint SCSS with SCSS-Lint_. .. note:: This syntax checker requires SCSS-Lint 0.43.2 or newer. .. _SCSS-Lint: https://github.com/brigade/scss-lint .. syntax-checker-config-file:: flycheck-scss-lintrc .. syntax-checker:: sass/scss-sass-lint Syntax-check and lint Sass/SCSS with SASS-Lint_. .. _SASS-Lint: https://github.com/sasstools/sass-lint .. syntax-checker-config-file:: flycheck-sass-lintrc .. syntax-checker:: sass-stylelint Syntax-check and lint Sass with stylelint_. .. _stylelint: https://stylelint.io .. syntax-checker-config-file:: flycheck-stylelintrc .. defcustom:: flycheck-stylelint-quiet Whether to run stylelint in quiet mode via ``--quiet``. .. syntax-checker:: scss-stylelint Syntax-check and lint SCSS with stylelint_. .. _stylelint: https://stylelint.io .. syntax-checker-config-file:: flycheck-stylelintrc .. defcustom:: flycheck-stylelint-quiet Whether to run stylelint in quiet mode via ``--quiet``. .. syntax-checker:: sass scss Check SASS and SCSS respectively with the `SCSS compiler `_. .. defcustom:: flycheck-sass-compass flycheck-scss-compass Whether to enable the Compass CSS framework with ``--compass``. .. supported-language:: Scala Flycheck checks Scala with `scala` and `scala-scalastyle`. .. syntax-checker:: scala Check syntax and types with the `Scala `_ compiler. .. note:: This syntax checker is fairly primitive. For a better Scala experience we recommend Ensime_. .. _Ensime: http://ensime.github.io/ .. syntax-checker:: scala-scalastyle Check style with `Scalastyle `_. .. syntax-checker-config-file:: flycheck-scalastylerc .. important:: A configuration file is mandatory for this syntax checker. If `flycheck-scalastylerc` is not set or the configuration file not found this syntax checker will not be applied. .. supported-language:: Scheme Flycheck checks CHICKEN Scheme files with ``csc``. .. syntax-checker:: scheme-chicken Check syntax with ``csc``, the `CHICKEN Scheme `_ compiler. .. defcustom:: flycheck-scheme-chicken-args A list of additional options. .. important:: `Geiser `_ must be installed and active for this checker to work. .. supported-language:: Shell scripting languages Flycheck checks various shell scripting languages: * Bash with `sh-bash` and `sh-shellcheck` * POSIX shell (i.e. :file:`/bin/sh`) with `sh-posix-dash` or `sh-posix-bash` * Zsh with `sh-zsh` .. syntax-checker:: sh-bash Check Bash_ syntax. .. _Bash: http://www.gnu.org/software/bash/ .. defcustom:: flycheck-sh-bash-args A list of additional arguments that are passed to bash. .. syntax-checker:: sh-posix-dash Check POSIX shell syntax with Dash_. .. _Dash: http://gondor.apana.org.au/~herbert/dash/ .. syntax-checker:: sh-posix-bash Check POSIX shell syntax with Bash_. .. syntax-checker:: sh-zsh Check `Zsh `_ syntax. .. syntax-checker:: sh-shellcheck Lint Bash and POSIX shell with ShellCheck_. .. _ShellCheck: https://github.com/koalaman/shellcheck/ .. defcustom:: flycheck-shellcheck-excluded-warnings A list of excluded warnings. .. defcustom:: flycheck-shellcheck-follow-sources Allow shellcheck to read sourced files. .. supported-language:: Slim .. syntax-checker:: slim Check Slim using the `Slim `_ compiler. .. syntax-checker:: slim-lint Check Slim best practices using the `slim-lint `_ linter. .. supported-language:: SQL .. syntax-checker:: sql-sqlint Check SQL syntax with `Sqlint `_. .. supported-language:: systemd Unit Configuration .. syntax-checker:: systemd-analyze Check systemd unit configuration file syntax with `systemd-analyze`_. .. _systemd-analyze: https://www.freedesktop.org/software/systemd/man/systemd-analyze.html .. supported-language:: Tcl .. syntax-checker:: tcl-nagelfar Check Tcl syntax with `Nagelfar `_. .. supported-language:: Terraform .. syntax-checker:: terraform Check Terraform syntax with `terraform fmt`_ .. _terraform fmt: https://www.terraform.io/docs/commands/fmt.html .. syntax-checker:: terraform-tflint Check Terraform with `tflint `_ .. defcustom:: flycheck-tflint-variable-files A list of files to resolve terraform variables. Relative paths are relative to the path of the buffer being checked. .. supported-language:: Text .. syntax-checker:: proselint Check English prose with `Proselint `_. .. syntax-checker:: textlint Check prose with `textlint `_. .. syntax-checker-config-file:: flycheck-textlint-config .. defcustom:: flycheck-textlint-plugin-alist An alist mapping major modes to textlint plugins. Flycheck currently supports the following textlint plugins on NPM: * textlint-plugin-rst * textlint-plugin-html * textlint-plugin-latex * textlint-plugin-asciidoctor (as well as other AsciiDoc plugins) .. note:: textlint plugins need to be installed separately. .. supported-language:: TeX/LaTeX Flycheck checks TeX and LaTeX with either `tex-chktex` or `tex-lacheck`. .. syntax-checker:: tex-chktex Check style with `ChkTeX `_. .. syntax-checker-config-file:: flycheck-chktexrc .. defcustom:: flycheck-chktex-extra-flags A list of extra arguments to give to chktex. .. syntax-checker:: tex-lacheck Check style with `Lacheck `_. .. supported-language:: Texinfo .. syntax-checker:: texinfo Check syntax with :program:`makeinfo` from Texinfo_. .. _Texinfo: http://www.gnu.org/software/texinfo/ .. supported-language:: TypeScript .. syntax-checker:: javascript-eslint :noindex: See `javascript-eslint`. .. syntax-checker:: typescript-tslint Check syntax and style with `TSLint `_. This checker is deprecated. .. syntax-checker-config-file:: flycheck-typescript-tslint-config .. defcustom:: flycheck-typescript-tslint-rulesdir Additional rules directory, for user created rules. .. defcustom:: flycheck-tslint-args A list of additional arguments that are passed to tslint. .. supported-language:: Verilog .. syntax-checker:: verilog-verilator Check syntax with `Verilator `_. .. defcustom:: flycheck-verilator-include-path A list of include directories. Relative paths are relative to the file being checked. .. supported-language:: VHDL .. syntax-checker:: vhdl-ghdl Check syntax with `GHDL `_. .. defcustom:: flycheck-ghdl-language-standard The language standard to use as string. .. defcustom:: flycheck-ghdl-workdir The directory to use for the file library. .. defcustom:: flycheck-ghdl-ieee-library The standard to use for the IEEE library. .. supported-language:: XML Flycheck checks XML with `xml-xmlstarlet` or `xml-xmllint`. .. syntax-checker:: xml-xmlstarlet Check syntax with `XMLStarlet `_. .. defcustom:: flycheck-xml-xmlstarlet-xsd-path flycheck-xml-xmllint-xsd-path Location of XSD schema to validate against for `xml-xmlstarlet` and `xml-xmllint` respectively. .. syntax-checker:: xml-xmllint Check syntax with :program:`xmllint` from Libxml2_. .. defcustom:: flycheck-xml-xmllint-xsd-path flycheck-xml-xmllint-relaxng-path .. _Libxml2: https://gitlab.gnome.org/GNOME/libxml2/-/wikis/home .. supported-language:: YAML Flycheck checks YAML with `yaml-actionlint`, `yaml-jsyaml`, `yaml-ruby` or `yaml-yamllint`. .. syntax-checker:: yaml-actionlint Check syntax with `actionlint `_. .. syntax-checker:: yaml-jsyaml Check syntax with `js-yaml `_. .. syntax-checker:: yaml-ruby Check syntax with Ruby's YAML parser. .. syntax-checker:: yaml-yamllint Check syntax with :program:`yamllint`. .. syntax-checker-config-file:: flycheck-yamllintrc flycheck-35.0/doc/licenses.rst000066400000000000000000000005341500215546300163400ustar00rootroot00000000000000=================== Flycheck licenses =================== .. _flycheck-gpl: GNU General Public License 3 ============================ .. literalinclude:: ../COPYING .. _flycheck-cc-by-sa: Creative Commons Attribution-ShareAlike 4.0 International ========================================================= .. literalinclude:: COPYING.cc-by-sa flycheck-35.0/doc/requirements.txt000066400000000000000000000002701500215546300172620ustar00rootroot00000000000000# Sphinx Sphinx~=5.3 # Automatically build documentation on changes sphinx-autobuild # Sphinx theme alabaster>=0.7.8 # Syntax highlighting Pygments>=2.1 # Network access requests>=2.9 flycheck-35.0/doc/user/000077500000000000000000000000001500215546300147555ustar00rootroot00000000000000flycheck-35.0/doc/user/error-interaction.rst000066400000000000000000000207361500215546300211650ustar00rootroot00000000000000====================== Interact with errors ====================== There are a couple of things that you can do with Flycheck errors in a buffer: * You can navigate to errors, and go to the next or previous error. * You can display errors to read their error messages. * You can put error messages and IDs into the kill ring. This section documents the corresponding commands and their customisation options. Navigate errors =============== By default Flycheck hooks into Emacs’ standard error navigation on :kbd:`M-g n` (`next-error`) and :kbd:`M-g p` (`previous-error`). When :mode:`flycheck` is enabled these commands will jump to the next and previous Flycheck error respectively. See :infonode:`(emacs)Compilation Mode` for more information about these commands. This way you don’t need to learn special keybindings to navigate Flycheck errors; navigation should just work out of the box. .. note:: Visible compilation buffers such as buffers from ``M-x compile``, ``M-x grep``, etc. still take *precedence* over Flycheck’s errors. The exact behaviour of these error navigation features is very context-dependent and can be very confusing at times so you can disable this integration: .. defcustom:: flycheck-standard-error-navigation Whether to integrate Flycheck errors into Emacs’ standard error navigation. Defaults to ``t``, set to ``nil`` to disable. .. important:: When changing the value you must disable :mode:`flycheck` and enable it again for the change to take effect in any buffers where :mode:`flycheck` is enabled. Flycheck provides an independent set of navigation commands which will always navigate Flycheck errors in the current buffer, regardless of visible compilation buffers and `flycheck-standard-error-navigation`: .. define-key:: C-c ! n M-x flycheck-next-error Jump to the next error. With prefix argument jump forwards by as many errors as specified by the prefix argument, e.g. :kbd:`M-3 C-c ! n` will move to the 3rd error from the current point. With negative prefix argument move to previous errors instead. Signal an error if there are no more Flycheck errors. .. define-key:: C-c ! p M-x flycheck-previous-error Jump to the previous Flycheck error. With prefix argument jump backwards by as many errors as specified by the prefix argument, e.g. :kbd:`M-3 C-c ! p` will move to the 3rd error before the current point. With negative prefix argument move to next errors instead. Signal an error if there are no more Flycheck errors. .. define-key:: M-x flycheck-first-error Jump to the first Flycheck error. With prefix argument, jump forwards to by as many errors as specified by the prefix argument, e.g. :kbd:`M-3 M-x flycheck-first-error` moves to the 3rd error from the beginning of the buffer. With negative prefix argument move to the last error instead. By default error navigation jumps to all errors but you can choose to skip over errors with low levels: .. defcustom:: flycheck-navigation-minimum-level The minimum levels of errors to consider for navigation. If set to an error level only navigate to errors whose level is as least as severe as this one. If ``nil`` navigate to all errors. Display errors ============== Whenever you move point to an error location Flycheck automatically displays all Flycheck errors at point after a short delay which you can customise: .. defcustom:: flycheck-display-errors-delay The number of seconds to wait before displaying the error at point. Floating point numbers can express fractions of seconds. You can also disable Flycheck from automatically displaying errors at point by customising: .. defcustom:: flycheck-auto-display-errors-after-checking Whether to automatically display errors at the current point after checking. When being set to `nil`, it will prevent Flycheck from automatically displaying error messages. This setting is useful when Flycheck is used together with `flycheck-posframe`, to prevent `flycheck-posframe` from repeatedly displaying errors at point. By default Flycheck shows the error messages in the minibuffer or in a separate buffer if the minibuffer is too small to hold the whole error message but this behaviour is entirely customisable: .. defcustom:: flycheck-display-errors-function A function to display errors. The function is given the list of Flycheck errors to display as sole argument and shall display these errors to the user in some way. Flycheck provides two built-in functions for this option: .. defun:: flycheck-display-error-messages errors flycheck-display-error-messages-unless-error-list errors Show error messages and IDs in the echo area or in a separate buffer if the echo area is too small (using `display-message-or-buffer` which see). The latter only displays errors when the :ref:`error list ` is not visible. To enable it add the following to your :term:`init file`: .. code-block:: elisp (setq flycheck-display-errors-function #'flycheck-display-error-messages-unless-error-list) Along the same vein, Flycheck provides a way to customise how a error message is cleared, this is especially useful if you use a Flycheck extension to display error messages differently from the default. .. defcustom:: flycheck-clear-displayed-errors-function Function to hide error message displayed by `flycheck-display-errors-function`. If set to a function, it will be called with no arguments to clear all displayed errors at point. By default, Flycheck only provides `flycheck-clear-displayed-error-messages` to clear the last Flycheck error message from the minibuffer: .. defun:: flycheck-clear-displayed-error-messages Clear error messages displayed by `flycheck-display-error-messages`. .. seealso:: :flyc:`flycheck-pos-tip` A Flycheck extension to display errors in a GUI popup. Additionally Flycheck shows errors in a GUI tooltip whenever you hover an error location with the mouse pointer. By default the tooltip contains the messages and IDs of all errors under the pointer, but the contents are customisable: .. defcustom:: flycheck-help-echo-function A function to create the contents of the tooltip. The function is given a list of Flycheck errors to display as sole argument and shall return a single string to use as the contents of the tooltip. Errors from other files ======================= Some checkers may return errors from files other than the current buffer (e.g., `gcc` may complain about errors in included files). These errors appear in the error list, and are also added on the first line of the current buffer. You can jump to the incriminating files with `flycheck-previous-error`. By default, warnings and info messages from other files are ignored, but you can customize the minimum level: .. defcustom:: flycheck-relevant-error-other-file-minimum-level The minimum level errors from other files to consider for inclusion in the current buffer. If set to an error level, only display errors from other files whose error level is at least as severe as this one. If ``nil``, display all errors from other files. To never show any errors from other files, set `flycheck-relevant-error-other-file-show` to ``nil``. .. defcustom:: flycheck-relevant-error-other-file-show Whether to show errors from other files. Explain errors ============== Flycheck also has the ability to display explanations for errors, provided the error checker is capable of producing these explanations. While several checkers produce explanations, the majority do not. Those that do are: * `css-stylelint` * `javascript-eslint` * `markdown-markdownlint-cli` * `markdown-markdownlint-cli2` * `nix-linter` * `perl-perlcritic` * `python-pylint` * `rpm-rpmlint` * `rust` * `rust-cargo` * `rust-clippy` * `sh-shellcheck` .. define-key:: C-c ! e M-x flycheck-explain-error-at-point Display an explanation for the first explainable error at point. Kill errors =========== You can put errors into the kill ring with `C-c ! w`: .. define-key:: C-c ! C-w M-x flycheck-copy-errors-as-kill Copy all messages of the errors at point into the kill ring. .. define-key:: C-u C-c ! C-w C-u M-x flycheck-copy-errors-as-kill Like `C-c ! w` but with error IDs. .. define-key:: M-0 C-c ! C-w M-0 M-x flycheck-copy-errors-as-kill Like `C-c ! w` but do not copy the error messages but only the error IDs. flycheck-35.0/doc/user/error-list.rst000066400000000000000000000064431500215546300176200ustar00rootroot00000000000000.. _flycheck-error-list: ================= List all errors ================= You can see all errors in the current buffer in Flycheck’s error list: .. image:: /images/flycheck-error-list.png :align: center The key `C-c ! l` pops up the error list: .. define-key:: C-c ! l M-x flycheck-list-errors M-x list-flycheck-errors Pop up a list of errors in the current buffer. The error list automatically updates itself after every syntax check and follows the current buffer: If you switch to different buffer or window it automatically shows the errors of the now current buffer. The buffer whose errors are shown in the error list is the *source buffer*. Whenever the point is on an error in the *source buffer* the error list highlights these errors—the green line in the screenshot above. Within the error list the following key bindings are available: ========== ==== :kbd:`RET` Go to the current error in the source buffer :kbd:`n` Jump to the next error :kbd:`p` Jump to the previous error :kbd:`e` Explain the error :kbd:`f` Filter the error list by level :kbd:`F` Remove the filter :kbd:`S` Sort the error list by the column at point :kbd:`g` Check the source buffer and update the error list :kbd:`q` Quit the error list and hide its window ========== ==== Filter the list =============== By the default the error list shows all errors but sometimes you'd like to hide warnings to focus only on real errors. The error list lets you hide all errors below a certain level with :kbd:`f`. This key prompts for an error level and will remove all errors of lower levels from the list. The filter is permanent as long as the error list buffer stays alive or the filter is reset with :kbd:`F`. Sort the list ============= You can press :kbd:`S` or click on the column headings to sort the error list by any of the following columns: * Line * Level * ID * Message and checker Click twice or press :kbd:`S` repeatedly to flip the sort order from ascending to descending or vice versa. Tune error list display ======================= By default the error list buffer pops up like any other buffer. Flycheck does not enforce special rules on how it's displayed and where it's located in the frame so essentially the error list pops up at arbitrary places wherever Emacs can find a window for it. However you can tell Emacs to obey certain rules when displaying buffers by customizing the built-in option `display-buffer-alist`. You can use this option to make the error list display like similar lists in contemporary IDEs like VisualStudio, Eclipse, etc. with the following code in your :term:`init file`: .. code-block:: elisp (add-to-list 'display-buffer-alist `(,(rx bos "*Flycheck errors*" eos) (display-buffer-reuse-window display-buffer-in-side-window) (side . bottom) (reusable-frames . visible) (window-height . 0.33))) This display rule tells Emacs to always display the error list at the bottom side of the frame, occupying a third of the entire height of the frame. .. seealso:: Shackle_ An Emacs package which provides an alternative way to control buffer display .. _shackle: https://github.com/wasamasa/shackle flycheck-35.0/doc/user/error-reports.rst000066400000000000000000000316271500215546300203450ustar00rootroot00000000000000======================= See errors in buffers ======================= When a syntax check in the current buffer has finished Flycheck reports the results of the check in the current buffer in two ways: * Highlight errors, warnings, etc. directly in the buffer according to `flycheck-highlighting-mode` and `flycheck-highlighting-style`. * Indicate errors, warnings, etc. in the fringe according to `flycheck-indication-mode`. Additionally Flycheck indicates its current state and the number of errors and warnings in the mode line. The following screenshot illustrates how this looks like in the default Emacs color theme. It shows an info, a warning and an error annotation, from top to bottom. Please also note the fringe indicators on the left side and the emphasized mode line indicator in the bottom right corner: .. image:: /images/flycheck-error-reports.png :alt: Flycheck showing info, warning and error annotations :align: center .. note:: The colours of fringe icons and the whole appearance of the error highlights depend on the active color theme. Although red, orange and green or blue seem to be somewhat standard colours for Flycheck’s annotations across many popular themes, please take a closer look at your color theme if you’re in doubt about the meaning of a Flycheck highlight. Error levels ============ All errors that syntax checkers report have a *level* which tells you the severity of the error. Flycheck has three built-in levels: ``error`` Severe errors like syntax or type errors. ``warning`` Potential but not fatal mistakes which you should likely fix nonetheless. ``info`` Purely informational messages which inform about notable things in the current buffer, or provide additional help to fix errors or warnings. Each error level has a distinct highlighting and colour which helps you to identify the severity of each error right in the buffer. Error highlights ================ Flycheck highlights errors directly in the buffer according to `flycheck-highlighting-mode` and `flycheck-highlighting-style`. Most checkers report a single error position, not a range, so Flycheck typically needs to guess how far to extend the highlighting: by default, it highlights the whole symbol at the location reported by the checker, as in the screenshot above, but you can change that range (or even disable highlighting completely) using `flycheck-highlighting-mode`. .. defcustom:: flycheck-highlighting-mode How Flycheck chooses which buffer region to highlight: ``nil`` Do not highlight anything at all. ``lines`` Highlight the whole line and discard any information about the column. ``columns`` Highlight the column of the error if any, otherwise like ``lines``. ``symbols`` Highlight the entire symbol around the error column if any, otherwise like ``columns``. This is this default. ``sexps`` Highlight the entire expression around the error column if any, otherwise like ``columns``. .. warning:: In some major modes ``sexps`` is *very* slow, because discovering expression boundaries is costly. The built-in ``python-mode`` is known to suffer from this issue. Be careful when enabling this mode. Conversely, when a checker reports a range, Flycheck uses that. The style of the highlighting is determined by the value of `flycheck-highlighting-style`. By default, Flycheck highlights error text with a face indicating the severity of the error (typically, this face applies a coloured wavy underline). Instead of faces, however, Flycheck can also indicate erroneous text by inserting delimiters around it (checkers sometimes report errors that span a large region of the buffer, making underlines distracting, so in fact Flycheck only applies a face if the error spans less than 5 lines; this is achieved using the ``conditional`` style described below). .. defcustom:: flycheck-highlighting-style How Flycheck highlights error regions. ``nil`` Do not indicate error regions. ``level-face`` Apply a face to erroneous text. ``(delimiters BEFORE AFTER)`` Bracket the error text between ``BEFORE`` and ``AFTER``, which can be strings, images, etc. Chars are handled specially: they are repeated twice to form double brackets. ``(conditional NLINES S1 S2)`` Chose between styles ``S1`` and ``S2``: ``S1`` if the error covers up to ``NLINES``, and ``S2`` otherwise. To change the style of the underline or use different colours in the ``level-face`` style, customize the following faces, which are used depending on the error level: .. defface:: flycheck-error flycheck-warning flycheck-info The highlighting face for ``error``, ``warning`` and ``info`` levels respectively. Delimiters use the same faces as the fringe icons described below, in addition to the `flycheck-error-delimiter` face; delimited text has the `flycheck-delimited-error` face, which is empty by default. .. defface:: flycheck-error-delimiter The face applied to ``BEFORE`` and ``AFTER`` delimiters. .. defface:: flycheck-delimited-error The face applied to error text in ``delimiters`` style. Fringe and margin icons ======================= In GUI frames, Flycheck also adds indicators to the fringe—the left or right border of an Emacs window—to help you identify erroneous lines quickly. These indicators consist of a rightward-pointing double arrow shape coloured in the colour of the corresponding error level. By default the arrow is 8 pixels wide, but a 16 pixels version is used if the fringe is `wide enough `_. .. note:: Flycheck extensions can define custom error levels with different fringe indicators. Furthermore some Emacs distributions like Spacemacs redefine Flycheck’s error levels to use different indicators. If you're using such a distribution please take a look at its documentation if you're unsure about the appearance of Flycheck's indicators. You can customise the location of these indicators (left or right fringe) with `flycheck-indication-mode`, which also lets you turn off these indicators completely; additionally, you can move these indicators into the margins instead of the fringes: .. defcustom:: flycheck-indication-mode How Flycheck indicates errors and warnings in the buffer fringes: ``left-fringe`` or ``right-fringe`` Use the left or right fringe respectively. Fringes can only contain monochrome bitmaps, so Flycheck draws small pixel-art arrows. ``left-margin`` or ``right-margin`` Use the left or right margin respectively. Margins can support all of Emacs' rendering facilities, so Flycheck uses the ``»`` character, which scales with the font size. ``nil`` Do not indicate errors and warnings in the fringe or in the margin. By default, Emacs displays fringes, but not margins. With ``left-margin`` and ``right-margin`` indication modes, you will need to enable margins in your ``.emacs``. For example: .. code-block:: elisp (setq-default left-fringe-width 1 right-fringe-width 8 left-margin-width 1 right-margin-width 0) If you intend to use margins only with Flycheck, consider using ``flycheck-set-indication-mode`` in a hook instead; this function adjusts margins and fringes for the current buffer. .. code-block:: elisp (setq-default flycheck-indication-mode 'left-margin) (add-hook 'flycheck-mode-hook #'flycheck-set-indication-mode) That function sets fringes and margins to reasonable (but opinionated) defaults, according to ``flycheck-indication-mode``. To set your own margin and fringe widths, use a hook and call ``flycheck-refresh-fringes-and-margins``, like this: .. code-block:: elisp ;; Show indicators in the left margin (setq flycheck-indication-mode 'left-margin) ;; Adjust margins and fringe widths… (defun my/set-flycheck-margins () (setq left-fringe-width 8 right-fringe-width 8 left-margin-width 1 right-margin-width 0) (flycheck-refresh-fringes-and-margins)) ;; …every time Flycheck is activated in a new buffer (add-hook 'flycheck-mode-hook #'my/set-flycheck-margins) The following faces control the colours of fringe and margin indicators. .. defface:: flycheck-fringe-error flycheck-fringe-warning flycheck-fringe-info The icon faces for ``error``, ``warning`` and ``info`` levels respectively. When an error spans multiple lines, Flycheck displays a hatch pattern in the fringes or vertical dots in the margins to indicate the extent of the error. To change the fringe bitmap or the symbol used in the margins, use the function ``flycheck-redefine-standard-error-levels``. Mode line ========= Like all minor modes Flycheck also has a mode line indicator. You can see it in the bottom right corner of the above screenshot. By default the indicator shows Flycheck’s current state via one of the following texts: +-------------+----------------------------------------------------------------+ |``FlyC`` |Current buffer has not been checked. | +-------------+----------------------------------------------------------------+ |``FlyC*`` |Flycheck is checking the buffer currently. | +-------------+----------------------------------------------------------------+ |``FlyC:0`` |Last check resulted in no errors and no warnings. | +-------------+----------------------------------------------------------------+ |``FlyC:3/5`` |There are three errors and five warnings in the current buffer. | +-------------+----------------------------------------------------------------+ |``FlyC-`` |Flycheck did not find a syntax checker for the current buffer. | | |Take a look at the :ref:`list of supported languages | | |` and type `C-c ! v` to see what checkers | | |are available for the current buffer. | +-------------+----------------------------------------------------------------+ |``FlyC!`` |The last syntax check failed. Inspect the ``*Messages*`` buffer| | |look for error messages, and consider :ref:`reporting a bug | | |`. | +-------------+----------------------------------------------------------------+ |``FlyC.`` |The last syntax check was manually interrupted. | +-------------+----------------------------------------------------------------+ |``FlyC?`` |The last syntax check had a dubious result. The definition of a| | |syntax checker may have a bug. Inspect the ``*Messages*`` | | |buffer and consider :ref:`reporting a bug | | |`. | +-------------+----------------------------------------------------------------+ You can entirely customise the mode line indicator with `flycheck-mode-line`: .. defcustom:: flycheck-mode-line A “mode line construct” for Flycheck’s mode line indicator. You can also customize the indicator for a successful run (no errors/warnings found) with `flycheck-mode-success-indicator`: .. defcustom:: flycheck-mode-success-indicator Success indicator appended to `flycheck-mode-line-prefix'. Set to ":0" by default. .. seealso:: :infonode:`(elisp)Mode Line Data` Documentation of mode line constructs. flycheck-status-emoji_ A Flycheck extension which puts emojis into Flycheck's mode line indicator. :flyc:`flycheck-color-mode-line` A Flycheck extension which colours the entire mode line according to Flycheck's status. .. _flycheck-status-emoji: https://github.com/liblit/flycheck-status-emoji Error thresholds ================ To avoid flooding a buffers with excessive highlighting, cluttering the appearance and slowing down Emacs, Flycheck takes precautions against syntax checkers that report a large number of errors exceeding `flycheck-checker-error-threshold`: .. defcustom:: flycheck-checker-error-threshold The maximum number of errors a syntax checker is allowed to report. If a syntax checker reports more errors the error information is **discarded**. To not run into the same issue again on the next syntax check the syntax checker is automatically added to `flycheck-disabled-checkers` in this case to disable it for the next syntax check. Clear results ============= You can explicitly remove all highlighting and indication and all error information from a buffer: .. define-key:: C-c ! C M-x flycheck-clear Clear all reported errors, all highlighting and all indication icons from the current buffer. .. define-key:: C-u C-c ! C C-u M-x flycheck-clear Like `C-c ! C` but also interrupt any syntax check currently running. Use this command if you think that Flycheck is stuck. flycheck-35.0/doc/user/flycheck-versus-flymake.rst000066400000000000000000000355531500215546300222650ustar00rootroot00000000000000.. _flycheck-versus-flymake: ========================= Flycheck versus Flymake ========================= This article compares Flycheck to the *built-in* Flymake mode. It does not consider third-party extensions such as flymake-easy_, but references them at appropriate places. We aim for this comparison to be fair and comprehensive, but it may contain stale information. Please report any inaccuracy you might find, and feel free to `edit this page`_ and improve it. .. note:: This comparison is being updated periodically and reflects the major overhaul of Flymake in Emacs 26.1. As Flycheck and Flymake are moving targets we can't guarantee that the data here will always reflect the current state of both projects. If you notice that something is incorrect, please let our team know. If you are using Emacs 25.3 or below, you can still access the comparison between Flycheck and the legacy Flymake `here`_. .. _flymake-easy: https://github.com/purcell/flymake-easy .. _edit this page: https://github.com/flycheck/flycheck/edit/master/doc/user/flycheck-versus-flymake.rst .. _here: /en/31/ Overview ======== This table gives an overview of the differences and similarities between Flycheck and Flymake. The rest of this page describes each point in more detail. +---------------------------+-----------------------+-----------------------+ | |Flycheck |Flymake | +===========================+=======================+=======================+ |Supports Emacs versions ||min-emacs| |26.1+ | +---------------------------+-----------------------+-----------------------+ |Built-in |no |yes | +---------------------------+-----------------------+-----------------------+ |`Supported languages`_ |100+ built-in, |10 built-in, | | |200+ w/ 3rd-party |50+ w/ 3rd party | +---------------------------+-----------------------+-----------------------+ |`Automatic syntax |built-in |manual | |checking`_ | | | +---------------------------+-----------------------+-----------------------+ |Check triggers |save, newline, change, |save, newline, change | | |buffer switch | | +---------------------------+-----------------------+-----------------------+ |Asynchronous checking |yes, always |yes, for some modes | +---------------------------+-----------------------+-----------------------+ |`Automatic syntax checker |by major mode and |no | |selection `_ | | | +---------------------------+-----------------------+-----------------------+ |`Multiple syntax checkers |yes (configurable |yes (all at once) | |per buffer`_ |chain) | | +---------------------------+-----------------------+-----------------------+ |`Definition of new |single declarative |arbitrary function | |syntax checkers`_ |macro |[#]_ | +---------------------------+-----------------------+-----------------------+ |Configuration debugging |built-in (C-c ! v) |none | +---------------------------+-----------------------+-----------------------+ |`Error identifiers`_ |yes |no | +---------------------------+-----------------------+-----------------------+ |`Error explanations`_ |yes |no | +---------------------------+-----------------------+-----------------------+ |`Error parsing helpers |for regexp, JSON and |none | |`_ |XML | | +---------------------------+-----------------------+-----------------------+ |Fringe icons for errors |yes |yes | +---------------------------+-----------------------+-----------------------+ |Error highlighting |faces, brackets, mixed |faces only | +---------------------------+-----------------------+-----------------------+ |`Error indicators |fringes (incl HiDPI), |fringes only | |`_ |margins | | +---------------------------+-----------------------+-----------------------+ |`Error message display`_ |tooltip, echo area, |tooltip, echo area | | |fully customizable | | | |(e.g. tooltip, popup | | | |w/ 3rd party packages) | | +---------------------------+-----------------------+-----------------------+ |List of all errors |yes; filterable by |yes | | |error level | | +---------------------------+-----------------------+-----------------------+ |`Supported by Eglot`_ |no, but a compatibility|yes | | |package exists | | | |(``flycheck-eglot``) | | +---------------------------+-----------------------+-----------------------+ |`Supported by lsp-mode`_ |yes |yes | +---------------------------+-----------------------+-----------------------+ Detailed review =============== Relation to Emacs ----------------- **Flymake** has been part of GNU Emacs since GNU Emacs 22. As such, contributions to Flymake are subject to the FSF policies on GNU projects. Most notably, contributors are required to assign their copyright to the FSF. **Flycheck** is not part of GNU Emacs. However, it is free software as well, and publicly developed on the well-known code hosting platform :gh:`Github `. Contributing to Flycheck does not require a copyright assignment, only an explicit agreement that your contributions will be licensed under the GPL. Automatic syntax checking ------------------------- **Flymake** is not enabled automatically for supported languages. It must be enabled for each mode individually, or by, e.g., adding to a hook that enables it for all ``prog-mode`` buffers. If no backends for the major mode are available, Flymake will non-intrusively tell you in the modeline. **Flycheck** provides a global mode `global-flycheck-mode` which enables syntax checking in every supported language, where it is safe to do so (remote and encrypted buffers are excluded by default). Syntax checkers --------------- Supported languages ~~~~~~~~~~~~~~~~~~~ **Flymake** comes with support for Emacs Lisp, Ruby (``ruby`` for syntax check and ``rubocop`` for lints), Python and Perl. In addition, backends written for the legacy Flymake are compatible with the new implementation. **Flycheck** provides support for `over 50 languages ` with over 100 syntax checkers, most of them contributed by the community. Definition of new syntax checkers ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ **Flymake** backends are single functions which report diagnostics to a callback function given as argument. **Flycheck** provides a single function `flycheck-define-checker` to define a new syntax checker. This function uses a declarative syntax which is easy to understand even for users unfamiliar with Emacs Lisp. In fact, most syntax checkers in Flycheck were contributed by the community. For example, the Perl checker in Flycheck is defined as follows: .. code-block:: elisp (flycheck-define-checker perl "A Perl syntax checker using the Perl interpreter. See URL `http://www.perl.org'." :command ("perl" "-w" "-c" source) :error-patterns ((error line-start (minimal-match (message)) " at " (file-name) " line " line (or "." (and ", " (zero-or-more not-newline))) line-end)) :modes (perl-mode cperl-mode)) The whole process is described in :ref:`adding-a-checker`. Customization of syntax checkers ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ **Flymake** does not provide built-in means to customize syntax checkers. Instead, when defining a new syntax checker the user needs to declare customization variables explicitly and check their value in the init function. **Flycheck** provides built-in functions to add customization variables to syntax checkers and splice the value of these variables into the argument list of a syntax checking tool. Many syntax checkers in Flycheck provide customization variables. For instance, you can customize the enabled warnings for C with `flycheck-clang-warnings`. Flycheck also tries to automatically find configuration files for syntax checkers. Executables of syntax checkers ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ **Flymake** does not provide built-in means to change the executable of a syntax checker. **Flycheck** defines a variable to set the path of a syntax checker tool for each defined syntax checker and provides the interactive command `flycheck-set-checker-executable` to change the executable used in a buffer. The process used to locate checker configuration files can also be customized using `flycheck-locate-config-file-functions`, allowing you to store your personal checker configuration files in your ``.emacs.d`` folder. Syntax checker selection ------------------------ **Flymake** runs all functions added to the `flymake-diagnostic-functions` hook. **Flycheck** uses the major mode and checker-specific predicates to automatically select a syntax checker. Custom predicates ~~~~~~~~~~~~~~~~~ **Flymake** may allow for backends to implement custom logic to decide whether to run the check or not. There are no easily-defined predicate functions. **Flycheck** supports custom predicate functions. For instance, Emacs uses a single major mode for various shell script types (e.g. Bash, Zsh, POSIX Shell, etc.), so Flycheck additionally uses a custom predicate to look at the value of the variable `sh-shell` in Sh Mode buffers to determine which shell to use for syntax checking. Manual selection ~~~~~~~~~~~~~~~~ **Flymake** users may manually select a specific backend by overriding the value of the backends list. **Flycheck** provides the local variable `flycheck-checker` to explicitly use a specific syntax checker for a buffer and the command `flycheck-select-checker` to set this variable interactively. Multiple syntax checkers per buffer ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ **Flymake** will use all the backends added to the `flymake-diagnostic-functions` hook to check a buffer; all backends are started at the same time, but errors are reported in the buffer as soon as a backend returns them. Backends can also be written to first report errors for the visible region of the buffer, and collect errors for hidden regions later. **Flycheck** can also apply multiple syntax checkers per buffer, but checkers run in sequence rather than concurrently. For instance, Flycheck will check PHP files with PHP CLI first to find syntax errors, then with PHP MessDetector to additionally find idiomatic and semantic errors, and eventually with PHP CheckStyle to find stylistic errors. The user will see all errors reported by all of these tools in the buffer. These checker-chains are configurable (see :ref:`flycheck-checker-chains`), so it's possible to run an advanced style checker only if a basic syntax checker returned no errors (this avoids accumulating too many false positives and improves performance). Errors ------ Error identifiers ~~~~~~~~~~~~~~~~~ **Flymake** does not include special treatment for error identifiers. **Flycheck** supports identifiers for different kinds of errors, if a syntax checker provides these. The identifiers appear in the error list and in error display, and can be copied independently, for instance for use in an inline suppression comment or to search the web for a particular kind of error. Error explanations ~~~~~~~~~~~~~~~~~~ Some **Flycheck** checkers can use error identifiers to provide error explanations in an help buffer (see `flycheck-explain-error-at-point`). .. _margins: Error indicators ~~~~~~~~~~~~~~~~ Both **Flymake** and **Flycheck** indicate errors in the buffer (using overlays) and in the fringes. Flycheck includes fringe bitmaps for HiDPI screens, and also supports displaying indicators in the margins instead of the fringes (this behavior can be customized using `flycheck-indication-mode`, and `flycheck-highlighting-mode`). Error parsing ~~~~~~~~~~~~~ **Flymake** lets backend parse error messages from tools. There are no built-in helpers for defining error patterns, or for parsing JSON or XML formats. **Flycheck** checkers can use regular expressions as well as custom parsing functions. The preferred way to define a checker is to use the `rx` syntax, extended with custom forms for readable error patterns. Flycheck includes some ready-to-use parsing functions for common output formats, such as Checkstyle XML, or JSON interleaved with plain text. Error message display ~~~~~~~~~~~~~~~~~~~~~ **Flymake** shows error messages in a tool tip if the user hovers the mouse over an error location, or in the echo area if the user navigates to the error with `flymake-goto-next-error`. **Flycheck** shows error message in tool tips as well, and also displays error messages in the echo area if the point is at an error location. This feature is fully customizable via `flycheck-display-errors-function`, and several `extensions ` already provide alternative way to display errors. Supported by Eglot ~~~~~~~~~~~~~~~~~~ `Eglot `_ is the built-in LSP package in Emacs, starting with version 29. It uses internally Flymake to render diagnostics received by the LSP server (by providing a Flymake backend). It seems that many people were forced to move to Flymake, because they wanted to use Eglot and its maintainer (who's also the maintainer of Flymake) didn't want to provide Flycheck integration (backend) for it. (see the relevant `discussion `_)) .. note: `flycheck-eglot `_ is the best workaround for this unfortunate situation that exists today. Supported by lsp-mode ~~~~~~~~~~~~~~~~~~~~~ `lsp-mode `_ is a popular alternative to Eglot that supports both Flycheck and Flymake. As you might imagine we encourage Flycheck to use ``lsp-mode`` until we find some solution for the existing limitations in Eglot. .. rubric:: Footnotes .. [#] `flymake-easy`_ provides a function to define a new syntax checker, which sets all required variables at once. flycheck-35.0/doc/user/installation.rst000066400000000000000000000123171500215546300202140ustar00rootroot00000000000000.. _flycheck-installation: ============== Installation ============== This document gives you detailed instructions and information about installing Flycheck. Prerequisites ============= Flycheck needs GNU Emacs |min-emacs| and works best on Unix-like systems like Linux or macOS. It does not support older releases of GNU Emacs or other flavours of Emacs (e.g. XEmacs, Aquamacs, etc.). .. _flycheck-windows-support: Windows support --------------- **Flycheck does not explicitly support Windows**, but tries to maintain Windows compatibility and should generally work fine on Windows, too. However, we can neither answer questions about Windows nor fix bugs that only occur on Windows without the help of active Windows users. Please watch out for `known Windows issues`_. .. _known Windows issues: https://github.com/flycheck/flycheck/labels/arch%3A%20windows%20only Syntax checking tools --------------------- Flycheck does not check buffers itself but relies on *external* programs to check buffers. These programs must be installed separately. Please take a look at the :ref:`list of supported languages ` to find out what tools are required for a particular language. Many of these programs are available in the package repositories of Linux distributions or in Homebrew_ for macOS. Others can be installed with standard package managers such as Rubygems, NPM, Cabal, etc. .. important:: For a GUI Emacs on MacOS we recommend to install and configure exec-path-from-shell_ to make Emacs use the proper ``$PATH`` and avoid a :ref:`common setup issue on MacOS `. .. _Homebrew: https://brew.sh .. _exec-path-from-shell: https://github.com/purcell/exec-path-from-shell .. _flycheck-package-installation: Package installation ==================== We recommend to install Flycheck with Emacs' built-in package manager. Flycheck is available in the popular `MELPA`_ archive which serves up to date snapshots of Flycheck's development state. We recommend to read through the :doc:`changelog ` before every upgrade to check for any breaking changes that might affect you. .. note:: The sibling repository `MELPA Stable`_ provides packages for Flycheck releases. If you prefer to follow the most recent changes use MELPA instead, but be aware that, while we try to be careful about the stability of the development snapshots, we may make breaking changes anytime without prior announcement. Unfortunately the MELPA repositories are not available in Emacs by default. You must explicitly add them to `package-archives` with the following code in your :term:`init file`: .. code-block:: elisp (require 'package) (add-to-list 'package-archives '("MELPA Stable" . "https://stable.melpa.org/packages/") t) (package-initialize) This adds MELPA Stable; for MELPA replace ``https://stable.melpa.org`` with ``https://melpa.org`` and change the name accordingly. If you do not know where your init file is inspect the value of `user-init-file` with :kbd:`C-h v user-init-file`. Once the repository is set up you can install Flycheck from Emacs' package menu at :kbd:`M-x list-packages`, or directly with :kbd:`M-x package-install RET flycheck`. use-package ----------- You may want to take a look at `use-package`_ which provides simple syntax to declare and configure packages in your init file. Specifically it allows to automatically install missing packages from package archive when Emacs starts. Add the following form to your init file to setup Flycheck with `use-package`_: .. code-block:: elisp (use-package flycheck :ensure t :init (global-flycheck-mode)) Then press :kbd:`C-M-x` with point somewhere in this form to install and enable Flycheck for the current Emacs session. .. _flycheck-distribution-packages: Distribution packages --------------------- Alternatively some distributions provide binary packages of Flycheck. We officially support the following distributions: * Debian 9 and newer: ``apt-get install elpa-flycheck flycheck-doc`` (the latter for our manual). The `Debian Emacs addon team`_ provides these packages. .. _Debian Emacs addon team: https://pkg-emacsen.alioth.debian.org/ .. _flycheck-legacy-installation-methods: Legacy installation methods =========================== Some users prefer to install Flycheck with legacy methods such as el-get, Git submodules, etc that were common before Emacs included a package manager. There are also many 3rd party packages provided by various package managers. We do neither support nor endorse any of these: .. warning:: If you install Flycheck in any way other than :ref:`our official packages ` you do so **at your own risk**. Please beware of breakage, and understand that while we do not actively work against alternative installation methods we will not make compromises to support alternative installation methods. We will close issues reported for alternative installation if we fail to reproduce them with a proper installation of Flycheck. .. _MELPA: https://melpa.org .. _MELPA Stable: https://stable.melpa.org .. _Getting Started: https://melpa.org/#/getting-started .. _use-package: https://github.com/jwiegley/use-package flycheck-35.0/doc/user/quickstart.rst000066400000000000000000000053341500215546300177060ustar00rootroot00000000000000.. _flycheck-quickstart: ============ Quickstart ============ This page gives a quick introduction into Flycheck and an overview of its most important features. Before you start here please make sure that Flycheck is :ref:`installed `. Enable Flycheck =============== Now add the following code to your :term:`init file` to permanently enable syntax checking with Flycheck: .. code-block:: elisp (add-hook 'after-init-hook #'global-flycheck-mode) Install syntax checker programs =============================== Now you need to install syntax checking programs for the languages you'd like to use Flycheck with. The :ref:`list of supported languages ` tells you which languages Flycheck supports and what programs it uses. For instance, you can install Pylint_ for Python and ESLint_ for Javascript: .. code-block:: shell $ pip install pylint $ npm install eslint .. _Pylint: https://pylint.org .. _ESLint: https://eslint.org Check syntax in a buffer ======================== Now you are ready to use Flycheck in a Python or Javascript buffer. Visit a Python or Javascript file and check whether your Flycheck setup is complete with `C-c ! v`. If everything is green, Flycheck will now start to check the buffer on the fly while you are editing. Whenever you make a mistake that eslint or Pylint can catch, Flycheck will highlight the corresponding place in the buffer with an error underline whose color reflects the severity of the issue. Additionally, Flycheck will put a symbol into the fringe for affected lines and show the total number of errors and warnings in the buffer in the mode line. Navigate and list errors ======================== With `C-c ! n` and `C-c ! p` you can now jump back and forth between erroneous places. If you keep on such a place for a little while Flycheck will show the corresponding error message in the each area. Likewise, if you hover such a place with the mouse cursor Flycheck will show the error message in a tooltip. Press `C-c ! l` to pop up a list of all errors in the current buffer. This list automatically updates itself when you fix errors or introduce new ones, and follows the currently selected buffer. If the error list is selected you can type :kbd:`n` and :kbd:`p` to move up and down between errors and jump to their corresponding location in the buffer. More features ============= All Flycheck commands are available in the Emacs Menu at :menuselection:`Tools ---> Syntax checking`: .. figure:: /images/flycheck-menu.png The menu of Flycheck, showing all available Flycheck commands The same menu also pops up when you click on the mode line lighter: .. figure:: /images/flycheck-mode-line-menu.png The mode line menu of Flycheck flycheck-35.0/doc/user/syntax-checkers.rst000066400000000000000000000314361500215546300206310ustar00rootroot00000000000000================= Syntax checkers ================= Flycheck does not check buffers on its own. Instead it delegates this task to external *syntax checkers* which are external programs or services that receive the contents of the current buffer and return a list of errors in the buffer, together with metadata that tells Flycheck how to run the program, how to pass buffer contents to it, and how to extract errors. .. seealso:: :ref:`flycheck-languages` A complete list of all syntax checkers included in Flycheck Like everything else in Emacs syntax checkers have online documentation which you can access with `C-c ! ?`: .. define-key:: C-c ! ? M-x flycheck-describe-checker Prompt for the name of a syntax checker and pop up a Help buffer with its documentation. The documentation includes the name of the program or service used, a list of major modes the checker supports and a list of all options for this syntax checker. .. _flycheck-automatic-selection: Select syntax checkers automatically ==================================== Normally Flycheck automatically selects the best syntax checkers for the current buffer from `flycheck-checkers` whenever it needs to check the buffer: .. defcustom:: flycheck-checkers A list of all syntax checkers available for syntax checking. A syntax checker in this list is a :term:`registered syntax checker`. Flycheck picks the first syntax checker from this list which exists and supports the current major mode, and runs it over the current buffer. When the checker has finished, Flycheck looks for the next syntax checker to run, and if there is one, Flycheck runs the next syntax checker, and so on, until there is no more syntax checker for the current buffer. This process repeats whenever Flycheck needs to check the buffer according to `flycheck-check-syntax-automatically`. .. important:: Under some circumstances—for instance if the syntax checker is not installed— Flycheck automatically :ref:`disables syntax checkers ` in the current buffer and will thus not even consider them in any future checks in the current buffer. In the `verification buffer ` these syntax checkers are marked as “disabled” just as if you had disabled them manually with `C-c ! x`, and likewise you can re-enable automatically disabled syntax checkers with `C-u C-c ! x`. For instance, the first syntax checker for Emacs Lisp is `emacs-lisp` which checks Emacs Lisp with Emacs' own byte compiler. This syntax checker asks for `emacs-lisp-checkdoc` to run next, which checks for stylistic issues in Emacs Lisp docstrings. Thus Flycheck will first run the byte compiler and then checkdoc in an Emacs Lisp buffer. .. _flycheck-manual-selection: Select syntax checkers manually =============================== Alternatively you can tell Flycheck explicitly which syntax checker to start with in the current buffer: .. define-key:: C-c ! s M-x flycheck-select-checker Prompt for a syntax checker and use this syntax checker as the first syntax checker for the current buffer. Flycheck may still run further syntax checkers from `flycheck-checkers` if the selected syntax checker asks for it. Flycheck will use the selected syntax checker as “entry point” for syntax checks in the current buffer, just as if it had selected this syntax checker automatically. It will automatically run further syntax checkers from `flycheck-checkers` if the selected syntax checker asks for it. Under the hood `C-c ! s` sets `flycheck-checker`: .. defvar:: flycheck-checker The name of a syntax checker to use for the current buffer. If ``nil`` (the default) let Flycheck :ref:`automatically select ` the best syntax checker from `flycheck-checkers`. If set to a syntax checker Flycheck will use this syntax checker as the first one in the current buffer, and run subsequent syntax checkers just as if it had selected this one automatically. If the syntax checker in this variable does not work in the current buffer signal an error. This variable is buffer-local. We recommend to set `flycheck-checker` via directory local variables to enforce a specific syntax checker for a project. For instance, Flycheck usually prefers `javascript-eslint` for Javascript buffers, but if your project uses `javascript-jshint` instead you can tell Flycheck to use `javascript-jshint` for all Javascript buffers of your project with the following command in the top-level directory of your project: :kbd:`M-x add-dir-local-variable RET js-mode RET flycheck-checker RET javascript-jshint`. A new buffer pops up that shows the newly created entry in the directory variables. Save this buffer and kill it. From now on Flycheck will check all Javascript files of this project with JSHint. .. seealso:: :infonode:`(emacs)Locals` General information about local variables. :infonode:`(emacs)Directory Variables` Information about directory variables. To go back to automatic selection either set `flycheck-checker` to ``nil`` or type `C-u C-c ! s`: .. define-key:: C-u C-c ! s C-u M-x flycheck-select-checker Remove any selected syntax checker and let Flycheck again :ref:`select a syntax checker automatically `. .. _flycheck-disable-checkers: Disable syntax checkers ======================= Even if you :ref:`select a checker manually ` Flycheck may still use a syntax checker that you’d not like to use. To completely opt out from a specific syntax checker disable it: .. define-key:: C-c ! x M-x flycheck-disable-checker Prompt for a syntax checker to disable in the current buffer. For instance if you do not care for documentation conventions of Emacs Lisp you can opt out from `emacs-lisp-checkdoc` which checks your code against these conventions with :kbd:`C-c ! x emacs-lisp-checkdoc`. After the next check all checkdoc warnings will be gone from the buffer. Internally this command changes the buffer-local `flycheck-disabled-checkers`: .. defcustom:: flycheck-disabled-checkers A list of disabled syntax checkers. Flycheck will *never* use disabled syntax checkers to check a buffer. This option is buffer-local. You can customise this variable with :kbd:`M-x customize-variable RET flycheck-disabled-checkers` or set the default value in your :term:`init file` to permanently disable specific syntax checkers. For instance: .. code-block:: elisp (setq-default flycheck-disabled-checkers '(c/c++-clang)) will permanently disable `c/c++-clang` in all buffers. You can also disable syntax checkers per project with directory local variables. For instance type :kbd:`M-x add-dir-local-variable RET emacs-lisp-mode RET flycheck-disabled-checkers RET (emacs-lisp-checkdoc)` in your :term:`user emacs directory` to disable `emacs-lisp-checkdoc` for all Emacs Lisp files in your personal configuration. .. seealso:: :infonode:`(emacs)Locals` General information about local variables. :infonode:`(emacs)Directory Variables` Information about directory variables. To enable a disabled checker again, remove it from `flycheck-disabled-checkers` or use `C-u C-c ! x`: .. define-key:: C-u C-c ! x C-u M-x flycheck-disable-checker Prompt for a disabled syntax checker to enable again in the current buffer. .. _flycheck-checker-options: Configure syntax checkers ========================= Many syntax checkers provide command line flags to change their behaviour. Flycheck wraps important flags as regular Emacs user options. The :ref:`list of supported languages ` includes all options for each syntax checker. You can change these options in the Customize interface under :menuselection:`programming --> tools --> flycheck --> flycheck-options`, however we recommend to use Directory Variables to configure syntax checkers per project. .. seealso:: :infonode:`(emacs)Directory Variables` Information about directory variables. .. _flycheck-checker-config-files: Configuration files ------------------- Some syntax checkers can additionally read configuration from files. Flycheck can find configuration files of syntax checkers and use them when invoking the syntax checker program: .. defcustom:: flycheck-local-config-file-functions Functions to call to find a configuration file for a syntax checker. Each function gets the name of a configuration file and shall return the absolute path to a file if one exists. The default value leads to the following steps: 1. If the name is an absolute path, use it. 2. If the name exists in any ancestor directory, use the nearest one. 3. If the name exists in ``$HOME``, use it. This option is an abnormal hook, see :infonode:`(elisp)Hooks`. Flycheck takes the names of configuration files from user options defined for syntax checkers that support configuration files. Like above the :ref:`list of languages ` also lists all supported configuration file options. You can also change these in Customize, under :menuselection:`programming --> tools --> flycheck --> flycheck-config-files`, but again we recommend to use Directory Variables. We also recommend to prefer configuration files over options as you can usually commit the configuration files to your source control repository to share them with other contributors so that all contributors can use the same configuration for syntax checking and linting. .. _flycheck-checker-executables: Change syntax checker executables ================================= Flycheck normally tries to run syntax checker tools by their standard name from `exec-path`. Sometimes, though, you need to use a different version of a tool, or probably don't even have a tool available globally—this frequently occurs in Javascript project where dependencies including linter tools are typically installed into a local ``node_modules`` directory: .. define-key:: M-x flycheck-set-checker-executable Prompt for a syntax checker and an executable file and make Flycheck use the executable file for the syntax checker in the current buffer. Internally this command sets a variable named :samp:`flycheck-{checker}-executable` where :samp:`{checker}` is the name of the syntax checker entered on the prompt, e.g. `c/c++-clang`. Flycheck defines these :term:`executable options` for every syntax checker that runs an external command. You can change these variables with directory variables or set them in custom Emacs Lisp code such as mode hooks. .. seealso:: :infonode:`(emacs)Directory Variables` Information about directory variables. .. _flycheck-checker-chains: Configuring checker chains ========================== In any given buffer where Flycheck is enabled, only one checker may be run at a time. However, any number of checkers can be run in sequence. In such a sequence, after the first checker has finished running and its errors have been reported, the next checker of the sequence runs and its errors are reported, etc. until there are no more checkers in the sequence. This sequence is called a *checker chain*. Some checkers chains are already setup by default in Flycheck: e.g., `emacs-lisp` will be followed by `emacs-lisp-checkdoc`, and `python-mypy` will be followed by `python-flake8`. When defining a checker, you can specify which checkers may run after it by setting the ``:next-checkers`` property (see the docstring of `flycheck-define-generic-checker`). For a given checker, several next checkers may be specified. Flycheck will run the first (in order of declaration) whose error level matches (see below) and which can be used in the current buffer. You can also customize the next checker property by calling `flycheck-add-next-checker` in your Emacs configuration file. .. defun:: flycheck-add-next-checker checker next &optional append Set *next* to run after *checker*. Both arguments are syntax checker symbols. For example, the following will make `python-pylint` run after `python-flake8`: .. code-block:: elisp (flycheck-add-next-checker 'python-flake8 'python-pylint) *Next* may also be a cons cell ``(level . next-checker)``, where *next-checker* is a symbol denoting the syntax checker to run after *checker*, and *level* is an error level. The *next-checker* will then only be run if there is no current error whose level is more severe than *level*. If *level* is ``t``, then *next-checker* is run regardless of the current errors. For instance, if you wanted to run `python-pylint` only if `python-flake8` produced no errors (only warnings and info diagnostics), then you would rather use: .. code-block:: elisp (flycheck-add-next-checker 'python-flake8 '(warning . python-pylint)) flycheck-35.0/doc/user/syntax-checks.rst000066400000000000000000000110731500215546300202750ustar00rootroot00000000000000.. _flycheck-syntax-checks: =============== Check buffers =============== Flycheck provides two Emacs minor modes for automatic syntax checking: :mode:`flycheck` to enable syntax checking in the current buffer, and :mode:`global-flycheck` to enable syntax checking in all buffers whenever possible. .. minor-mode:: flycheck-mode Enable :ref:`automatic syntax checking ` in the current buffer. .. minor-mode:: global-flycheck-mode Enable :mode:`flycheck` in all buffers where syntax checking is possible. .. note:: This mode does not enable :mode:`flycheck` in remote files (via TRAMP) and encrypted files. Checking remote files may be very slow depending on the network connections, and checking encrypted files would leak confidential data to temporary files and subprocesses. You can manually enable :mode:`flycheck` in these buffers nonetheless, but we do *not* recommend this for said reasons. Add the following to your :term:`init file` to enable syntax checking permanently: .. code-block:: elisp (add-hook 'after-init-hook #'global-flycheck-mode) You can exclude specific major modes from syntax checking with `flycheck-global-modes`: .. defcustom:: flycheck-global-modes Major modes for which :mode:`global-flycheck` turns on :mode:`flycheck`: ``t`` (the default) Turn :mode:`flycheck` on for all major modes. :samp:`({foo-mode} …)` Turn :mode:`flycheck` on for all major modes in this list, i.e. whenever the value of ``major-mode`` is contained in this list. :samp:`(not {foo-mode} …)` Turn :mode:`flycheck` on for all major nodes *not* in this list, i.e. whenever the value of ``major-mode`` is *not* contained in this list. .. note:: :mode:`global-flycheck` never turns on :mode:`flycheck` in major modes whose ``mode-class`` property is ``special``, regardless of the value of this option. Syntax checking simply makes no sense in special buffers which are typically intended for non-interactive display rather than editing. .. seealso:: :infonode:`(elisp)Major Mode Conventions` Information about major modes, and modes marked as special. .. _flycheck-automatic-checks: Check automatically =================== By default :mode:`flycheck` automatically checks a buffer whenever * it is enabled, * the buffer is saved, * a new line is inserted, * or a short time after the last change was made in a buffer. You can customise this behaviour with `flycheck-check-syntax-automatically`: .. defcustom:: flycheck-check-syntax-automatically A list of events which trigger a syntax check in the current buffer: ``save`` Check the buffer immediately after it was saved. ``new-line`` Check the buffer immediately after a new line was inserted. ``idle-change`` Check the buffer a short time after the last change. The delay is customisable with `flycheck-idle-change-delay`: .. defcustom:: flycheck-idle-change-delay Seconds to wait after the last change to the buffer before starting a syntax check. ``idle-buffer-switch`` Check the buffer a short time after switching to it from another buffer. The delay is customisable with `flycheck-idle-buffer-switch-delay`: .. defcustom:: flycheck-idle-buffer-switch-delay Seconds to wait after switching to a buffer before starting a syntax check. If you switch to several buffers in rapid succession, the behavior depends on `flycheck-buffer-switch-check-intermediate-buffers`: .. defcustom:: flycheck-buffer-switch-check-intermediate-buffers If non-nil, then a buffer you switch to will have a syntax check run even if you switch to another buffer before it starts. If nil, then only the current buffer can have a syntax check run. Note that syntax checks can still be run in other buffers due to changes to their contents. ``mode-enabled`` Check the buffer immediately after :mode:`flycheck` was enabled. For instance with the following setting :mode:`flycheck` will only check the buffer when it was saved: .. code-block:: elisp (setq flycheck-check-syntax-automatically '(mode-enabled save)) .. _flycheck-manual-checks: Check manually ============== You can also start a syntax check explicitly with `C-c ! c`: .. define-key:: C-c ! c M-x flycheck-buffer Check syntax in the current buffer. flycheck-35.0/doc/user/troubleshooting.rst000066400000000000000000000125461500215546300207460ustar00rootroot00000000000000.. _flycheck-troubleshooting: ================= Troubleshooting ================= If syntax checking does not work as expected there are a number of steps that you can follow to isolate and maybe fix the problem. .. _flycheck-common-issues: Common issues ============= First check whether your issue is one of the common setup issues and problems. .. _flycheck-macos-exec-path-from-shell: Flycheck can’t find any programs in GUI Emacs on MacOS ------------------------------------------------------ Try to install and configure exec-path-from-shell_ to make a GUI Emacs inherit the ``$PATH`` environment variable from your shell configuration. The issue is that due to the special way MacOS starts GUI programs a GUI Emacs does not inherit the environment variables from the shell configuration so Emacs will lack some important entries in ``$PATH``, most notably ``/usr/local/bin/`` where Homebrew, NPM and many other package managers put binaries in. The `exec-path-from-shell`_ works around this issue by extracting environment variables from a shell session and inject them into the environment of the running Emacs instance. .. _exec-path-from-shell: https://github.com/purcell/exec-path-from-shell Flycheck warns about “non-zero exit code, but no errors” -------------------------------------------------------- Make sure that you have the latest version of the syntax checker installed, particularly if the message started appearing after you updated Flycheck. Newer releases of Flycheck may require newer versions of syntax checking tools. For instance Flycheck might now pass a command line flag that older versions do not understand, or attempt to parse an updated output format. In these cases the syntax checker will show an error message about an unknown flag, or emit output that Flycheck does not understand, which prompts Flycheck to warn that even though the syntax checker appeared to not have successfully checked the buffer content there are no errors to be found. If you *are* using the latest version then this message most likely indicates a flaw in the syntax checker definition. In this case please :ref:`report a bug ` to us so that we can fix the issue. Please don’t forget to say that you are using the latest version! Verify your setup ================= If your issue is none of the aforementioned :ref:`common issues ` the first step is to let Flycheck check your setup: .. define-key:: C-c ! v M-x flycheck-verify-setup Show a :term:`verification buffer` with information about your :mode:`flycheck` setup for the current buffer. The buffer contains all syntax checkers available for the current buffer and tells you whether Flycheck would use each one and what reasons would prevent Flycheck from using a checker. It also includes information about your Flycheck and Emacs version and your operating system. The following image shows a :term:`verification buffer`: .. image:: /images/flycheck-verify-buffer.png The buffer shows all syntax checkers for the current buffer. Note that you can click on the syntax checker names to show the docstring for a syntax checker. * *Green* items indicate *good* configuration. In the screenshot both `python-flake8` and `python-pycompile` exist. * *Orange* items indicate a *potential* misconfiguration. The screenshot shows that no configuration file was found for `python-flake8` which is perfectly fine if there’s no flake8 configuration file in the project, but not so good if you’d like Flycheck to use a configuration file for flake8. The section :ref:`flycheck-checker-config-files` has more information about configuration files. Likewise the buffer warns you that a ``demo`` syntax checker (which is not part of Flycheck of course) isn’t registered in `flycheck-checkers`. If you’d like Flycheck to automatically use this syntax checker you should fix this issue by adding it to `flycheck-checkers` but otherwise it’s safe to ignore this warning. * *Red* items indicate *bad* configuration. `python-pylint` wasn’t found in the screenshot, so you’ll not be able to use pylint in the current buffer. Debug syntax checkers ===================== If a syntax checker fails although it successfully verified you need to take a closer look. Flycheck provides you with a command that lets you run a single syntax checker just the way Flycheck would run it: .. define-key:: C-c ! C-c M-x flycheck-compile Prompt for a syntax checker and run in as a shell command, showing the whole output in a separate buffer. .. important:: The current implementation this command suffers from a couple of issues, so we’d like to have a replacement in GH-854_ and we could use your help! If you’d like to help out with this task please join the discussion in that issue. .. _GH-854: https://github.com/flycheck/flycheck/issues/854 The output of this command can provide you helpful clues about what’s going on. It also helps to compare the output of the command in Emacs with what happens if you run the same command in a terminal. If all else fails… ================== …please do :ref:`ask for help `. We have many different channels, from Twitter to a chat room to StackOverflow, whatever suits you best, and we try to help you as fast and as well as possible. flycheck-35.0/flycheck-buttercup.el000066400000000000000000000124001500215546300173540ustar00rootroot00000000000000;;; flycheck-buttercup.el --- Flycheck: Extensions to Buttercup -*- lexical-binding: t; -*- ;; Copyright (C) 2017-2025 Flycheck contributors ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; Maintainer: Clément Pit-Claudel ;; fmdkdd ;; Keywords: lisp, tools ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Extensions to Buttercup to write BDD tests for Flycheck. ;; ;; Buttercup is a BDD testing framework for Emacs, see URL ;; `https://github.com/jorgenschaefer/emacs-buttercup/'. Flycheck uses ;; Buttercup extensively for new tests. ;; ;; This library provides extensions to Buttercup to write Specs for Flycheck. ;; ;; * Custom matchers ;; ;; (expect 'foo :to-be-local) - Is `foo' a local variable in the current buffer? ;;; Code: (require 'buttercup) (require 'flycheck) (require 'seq) ;;; Buttercup helpers (defun flycheck-buttercup-format-error-list (errors) "Format ERRORS into a human-readable string." (mapconcat (lambda (e) (flycheck-error-format e 'with-file-name)) errors "\n")) ;;; Data matchers (buttercup-define-matcher :to-be-empty-string (s) (let ((s (funcall s))) (if (equal s "") (cons t (format "Expected %S not be an empty string" s)) (cons nil (format "Expected %S to be an empty string" s))))) (buttercup-define-matcher :to-match-with-group (re s index match) (let* ((re (funcall re)) (s (funcall s)) (index (funcall index)) (match (funcall match)) (matches? (string-match re s)) (result (and matches? (match-string index s)))) (if (and matches? (equal result match)) (cons t (format "Expected %S not to match %S with %S in group %s" re s match index)) (cons nil (format "Expected %S to match %S with %S in group %s, %s" re s match index (if matches? (format "but got %S" result) "but did not match")))))) ;;; Emacs feature matchers (buttercup-define-matcher :to-be-live (buffer) (let ((buffer (get-buffer (funcall buffer)))) (if (buffer-live-p buffer) (cons t (format "Expected %S not to be a live buffer, but it is" buffer)) (cons nil (format "Expected %S to be a live buffer, but it is not" buffer))))) (buttercup-define-matcher :to-be-visible (buffer) (let ((buffer (get-buffer (funcall buffer)))) (cond ((and buffer (get-buffer-window buffer)) (cons t (format "Expected %S not to be a visible buffer, but it is" buffer))) ((not (bufferp buffer)) (cons nil (format "Expected %S to be a visible buffer, but it is not a buffer" buffer))) (t (cons nil (format "Expected %S to be a visible buffer, but it is not visible" buffer)))))) (buttercup-define-matcher :to-be-local (symbol) (let ((symbol (funcall symbol))) (if (local-variable-p symbol) (cons t (format "Expected %S not to be a local variable, but it is" symbol)) (cons nil (format "Expected %S to be a local variable, but it is not" symbol))))) (buttercup-define-matcher :to-contain-match (buffer re) (let ((buffer (funcall buffer)) (re (funcall re))) (if (not (get-buffer buffer)) (cons nil (format "Expected %S to contain a match of %s, \ but is not a buffer" buffer re)) (with-current-buffer buffer (save-excursion (goto-char (point-min)) (if (re-search-forward re nil 'noerror) (cons t (format "Expected %S to contain a match \ for %s, but it did not" buffer re)) (cons nil (format "Expected %S not to contain a match for \ %s but it did not." buffer re)))))))) ;;; Flycheck matchers (buttercup-define-matcher :to-be-equal-flycheck-errors (a b) (let* ((a (funcall a)) (b (funcall b)) (a-formatted (flycheck-buttercup-format-error-list a)) (b-formatted (flycheck-buttercup-format-error-list b))) (if (equal a b) (cons t (format "Expected %s not to be equal to %s" a-formatted b-formatted)) (cons nil (format "Expected %s to be equal to %s" a-formatted b-formatted))))) (provide 'flycheck-buttercup) ;; Disable byte compilation for this library, to prevent package.el choking on a ;; missing `buttercup' library. See ;; https://github.com/flycheck/flycheck/issues/860 ;; Local Variables: ;; no-byte-compile: t ;; End: ;;; flycheck-buttercup.el ends here flycheck-35.0/flycheck-ert.el000066400000000000000000000427231500215546300161440ustar00rootroot00000000000000;;; flycheck-ert.el --- Flycheck: ERT extensions -*- lexical-binding: t; -*- ;; Copyright (C) 2017-2018 Flycheck contributors ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; Maintainer: Clément Pit-Claudel ;; fmdkdd ;; URL: https://github.com/flycheck/flycheck ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Unit testing library for Flycheck, the modern on-the-fly syntax checking ;; extension for GNU Emacs. ;; Provide various utility functions and unit test helpers to test Flycheck and ;; Flycheck extensions. ;;; Code: (require 'flycheck) (require 'ert) (require 'macroexp) ; For macro utilities ;;; Internal variables (defvar flycheck-ert--resource-directory nil "The directory to get resources from in this test suite.") ;;; Resource management macros (defmacro flycheck-ert-with-temp-buffer (&rest body) "Eval BODY within a temporary buffer. Like `with-temp-buffer', but resets the modification state of the temporary buffer to make sure that it is properly killed even if it has a backing file and is modified." (declare (indent 0) (debug t)) `(with-temp-buffer (unwind-protect ,(macroexp-progn body) ;; Reset modification state of the buffer, and unlink it from its backing ;; file, if any, because Emacs refuses to kill modified buffers with ;; backing files, even if they are temporary. (set-buffer-modified-p nil) (set-visited-file-name nil 'no-query)))) (defmacro flycheck-ert-with-file-buffer (file-name &rest body) "Create a buffer from FILE-NAME and eval BODY. BODY is evaluated with `current-buffer' being a buffer with the contents FILE-NAME." (declare (indent 1) (debug t)) `(let ((file-name ,file-name)) (unless (file-exists-p file-name) (error "%s does not exist" file-name)) (flycheck-ert-with-temp-buffer (insert-file-contents file-name 'visit) (set-visited-file-name file-name 'no-query) (cd (file-name-directory file-name)) ;; Mark the buffer as not modified, because we just loaded the file up to ;; now. (set-buffer-modified-p nil) ,@body))) (defmacro flycheck-ert-with-help-buffer (&rest body) "Execute BODY and kill the help buffer afterwards. Use this macro to test functions that create a Help buffer." (declare (indent 0)) `(unwind-protect ,(macroexp-progn body) (when (buffer-live-p (get-buffer (help-buffer))) (kill-buffer (help-buffer))))) (defmacro flycheck-ert-with-global-mode (&rest body) "Execute BODY with Global Flycheck Mode enabled. After BODY, restore the old state of Global Flycheck Mode." (declare (indent 0)) `(let ((old-state global-flycheck-mode)) (unwind-protect (progn (global-flycheck-mode 1) ,@body) (global-flycheck-mode (if old-state 1 -1))))) (defmacro flycheck-ert-with-env (env &rest body) "Add ENV to `process-environment' in BODY. Execute BODY with a `process-environment' which contains all variables from ENV added. ENV is an alist, where each cons cell `(VAR . VALUE)' is a environment variable VAR to be added to `process-environment' with VALUE." (declare (indent 1)) `(let ((process-environment (copy-sequence process-environment))) (pcase-dolist (`(,var . ,value) ,env) (setenv var value)) ,@body)) ;;; Test resources (defun flycheck-ert-resource-filename (resource-file) "Determine the absolute file name of a RESOURCE-FILE. Relative file names are expanded against `flycheck-ert--resource-directory'." (expand-file-name resource-file flycheck-ert--resource-directory)) (defmacro flycheck-ert-with-resource-buffer (resource-file &rest body) "Create a temp buffer from a RESOURCE-FILE and execute BODY. The absolute file name of RESOURCE-FILE is determined with `flycheck-ert-resource-filename'." (declare (indent 1)) `(flycheck-ert-with-file-buffer (flycheck-ert-resource-filename ,resource-file) ,@body)) ;;; Test suite initialization (defun flycheck-ert-initialize (resource-dir) "Initialize a test suite with RESOURCE-DIR. RESOURCE-DIR is the directory, `flycheck-ert-resource-filename' should use to lookup resource files." (when flycheck-ert--resource-directory (error "Test suite already initialized")) (let ((tests (ert-select-tests t t))) ;; Select all tests (unless tests (error "No tests defined. \ Call `flycheck-ert-initialize' after defining all tests!")) (setq flycheck-ert--resource-directory resource-dir))) ;;; Test case definitions (defmacro flycheck-ert-def-checker-test (checker language name &rest keys-and-body) "Define a test case for a syntax CHECKER for LANGUAGE. CHECKER is a symbol or a list of symbols denoting syntax checkers being tested by the test. The test case is skipped, if any of these checkers cannot be used. LANGUAGE is a symbol or a list of symbols denoting the programming languages supported by the syntax checkers. This is currently only used for tagging the test appropriately. NAME is a symbol denoting the local name of the test. The test itself is ultimately named `flycheck-define-checker/CHECKER/NAME'. If CHECKER is a list, the first checker in the list is used for naming the test. Optionally, the keyword arguments `:tags' and `:expected-result' may be given. They have the same meaning as in `ert-deftest.', and are added to the tags and result expectations set up by this macro. The remaining forms KEYS-AND-BODY denote the body of the test case, including assertions and setup code." (declare (indent 3)) (unless checker (error "No syntax checkers specified")) (unless language (error "No languages specified")) (let* ((checkers (if (symbolp checker) (list checker) checker)) (checker (car checkers)) (languages (if (symbolp language) (list language) language)) (language-tags (mapcar (lambda (l) (intern (format "language-%s" l))) languages)) (checker-tags (mapcar (lambda (c) (intern (format "checker-%s" c))) checkers)) (local-name (or name 'default)) (full-name (intern (format "flycheck-define-checker/%s/%s" checker local-name))) (keys-and-body (ert--parse-keys-and-body keys-and-body)) (body (cadr keys-and-body)) (keys (car keys-and-body)) (default-tags '(syntax-checker external-tool))) `(ert-deftest ,full-name () :expected-result ,(or (plist-get keys :expected-result) :passed) :tags (append ',(append default-tags language-tags checker-tags) ,(plist-get keys :tags)) ,@(mapcar (lambda (c) `(skip-unless ;; Ignore non-command checkers (or (not (flycheck-checker-get ',c 'command)) (executable-find (flycheck-checker-executable ',c))))) checkers) ,@body))) ;;; Test case results (defun flycheck-ert-syntax-check-timed-out-p (result) "Whether RESULT denotes a timed-out test. RESULT is an ERT test result object." (and (ert-test-failed-p result) (eq (car (ert-test-failed-condition result)) 'flycheck-ert-syntax-check-timed-out))) ;;; Syntax checking in tests (defvar-local flycheck-ert-syntax-checker-finished nil "Non-nil if the current checker has finished.") (add-hook 'flycheck-after-syntax-check-hook (lambda () (setq flycheck-ert-syntax-checker-finished t))) (defconst flycheck-ert-checker-wait-time 10 "Time to wait until a checker is finished in seconds. After this time has elapsed, the checker is considered to have failed, and the test aborted with failure.") (define-error 'flycheck-ert-syntax-check-timed-out "Syntax check timed out.") (defun flycheck-ert-wait-for-syntax-checker () "Wait until the syntax check in the current buffer is finished." (let ((starttime (float-time))) (while (and (not flycheck-ert-syntax-checker-finished) (< (- (float-time) starttime) flycheck-ert-checker-wait-time)) (accept-process-output nil 0.02)) (unless (< (- (float-time) starttime) flycheck-ert-checker-wait-time) (flycheck-stop) (signal 'flycheck-ert-syntax-check-timed-out nil))) (setq flycheck-ert-syntax-checker-finished nil)) (defun flycheck-ert-buffer-sync () "Like `flycheck-buffer', but synchronously." (setq flycheck-ert-syntax-checker-finished nil) (should (not (flycheck-running-p))) (flycheck-mode) ;; This will only start a deferred check, (should (flycheck-get-checker-for-buffer)) (flycheck-buffer) ;; …so we need an explicit manual check ;; After starting the check, the checker should either be running now, or ;; already be finished (if it was fast). (should (or flycheck-current-syntax-check flycheck-ert-syntax-checker-finished)) ;; Also there should be no deferred check pending anymore (should-not (flycheck-deferred-check-p)) (flycheck-ert-wait-for-syntax-checker)) (defun flycheck-ert-ensure-clear () "Clear the current buffer. Raise an assertion error if the buffer is not clear afterwards." (flycheck-clear) (should (not flycheck-current-errors)) (should (not (seq-find (lambda (ov) (overlay-get ov 'flycheck-overlay)) (overlays-in (point-min) (point-max)))))) ;;; Test assertions (defun flycheck-error-without-group (err) "Return a copy ERR with the `group' property set to nil." (let ((copy (copy-flycheck-error err))) (setf (flycheck-error-group copy) nil) copy)) (defun flycheck-ert-should-overlay (error) "Test that ERROR has a proper overlay in the current buffer. ERROR is a Flycheck error object." (let* ((overlay (seq-find (lambda (ov) (equal (flycheck-error-without-group (overlay-get ov 'flycheck-error)) (flycheck-error-without-group error))) (flycheck-overlays-in 0 (+ 1 (buffer-size))))) (region ;; Overlays of errors from other files are on the first line (if (flycheck-relevant-error-other-file-p error) (cons (point-min) (save-excursion (goto-char (point-min)) (line-end-position))) (flycheck-error-region-for-mode error 'symbols))) (level (flycheck-error-level error)) (category (flycheck-error-level-overlay-category level)) (face (get category 'face)) (fringe-bitmap (flycheck-error-level-fringe-bitmap level)) (fringe-face (flycheck-error-level-fringe-face level)) (fringe-icon (list 'left-fringe fringe-bitmap fringe-face))) (should overlay) (should (overlay-get overlay 'flycheck-overlay)) (should (= (overlay-start overlay) (car region))) (should (= (overlay-end overlay) (cdr region))) (should (eq (overlay-get overlay 'face) face)) (should (equal (get-char-property 0 'display (overlay-get overlay 'before-string)) fringe-icon)) (should (eq (overlay-get overlay 'category) category)) (should (equal (flycheck-error-without-group (overlay-get overlay 'flycheck-error)) (flycheck-error-without-group error))))) (defun flycheck-ert-sort-errors (errors) "Sort ERRORS by `flycheck-error-<'." (seq-sort #'flycheck-error-< errors)) (defun flycheck-ert-should-errors (&rest errors) "Test that the current buffers has ERRORS. ERRORS is a list of errors expected to be present in the current buffer. Each error is given as a list of arguments to `flycheck-error-new-at'. If ERRORS are omitted, test that there are no errors at all in the current buffer. With ERRORS, test that each error in ERRORS is present in the current buffer, and that the number of errors in the current buffer is equal to the number of given ERRORS. In other words, check that the buffer has all ERRORS, and no other errors." (let ((expected (flycheck-ert-sort-errors (mapcar (apply-partially #'apply #'flycheck-error-new-at) errors))) (current (flycheck-ert-sort-errors flycheck-current-errors))) (should (equal (mapcar #'flycheck-error-without-group expected) (mapcar #'flycheck-error-without-group current))) ;; Check that related errors are the same (cl-mapcar (lambda (err1 err2) (should (equal (flycheck-ert-sort-errors (mapcar #'flycheck-error-without-group (flycheck-related-errors err1 expected))) (flycheck-ert-sort-errors (mapcar #'flycheck-error-without-group (flycheck-related-errors err2)))))) expected current) (mapc #'flycheck-ert-should-overlay expected)) (should (= (length errors) (length (flycheck-overlays-in (point-min) (point-max)))))) (define-error 'flycheck-ert-suspicious-checker "Suspicious state from checker") (defun flycheck-ert-should-syntax-check-in-buffer (&rest errors) "Test a syntax check in BUFFER, expecting ERRORS. This is like `flycheck-ert-should-syntax-check', but with a buffer in the right mode instead of a file." ;; Load safe file-local variables because some tests depend on them (let ((enable-local-variables :safe) ;; Disable all hooks at this place, to prevent 3rd party packages ;; from interfering (hack-local-variables-hook)) (hack-local-variables)) ;; Configure config file locating for unit tests (let ((process-hook-called 0) (suspicious nil)) (add-hook 'flycheck-process-error-functions (lambda (_err) (setq process-hook-called (1+ process-hook-called)) nil) nil :local) (add-hook 'flycheck-status-changed-functions (lambda (status) (when (eq status 'suspicious) (setq suspicious t))) nil :local) (flycheck-ert-buffer-sync) (when suspicious (signal 'flycheck-ert-suspicious-checker nil)) (apply #'flycheck-ert-should-errors errors) (should (= process-hook-called (length errors)))) (flycheck-ert-ensure-clear)) (defun flycheck-ert-should-syntax-check (resource-file modes &rest errors) "Test a syntax check in RESOURCE-FILE with MODES. RESOURCE-FILE is the file to check. MODES is a single major mode symbol or a list thereof, specifying the major modes to syntax check with. If more than one major mode is specified, the test is run for each mode separately, so if you give three major modes, the entire test will run three times. ERRORS is the list of expected errors, as in `flycheck-ert-should-errors'. If omitted, the syntax check must not emit any errors. The errors are cleared after each test. The syntax checker is selected via standard syntax checker selection. To test a specific checker, you need to set `flycheck-checker' or `flycheck-disabled-checkers' accordingly before using this predicate, depending on whether you want to use manual or automatic checker selection. During the syntax check, configuration files of syntax checkers are also searched in the `config-files' sub-directory of the resource directory." (when (symbolp modes) (setq modes (list modes))) (dolist (mode modes) (unless (fboundp mode) (ert-skip (format "%S missing" mode))) (flycheck-ert-with-resource-buffer resource-file (funcall mode) (apply #'flycheck-ert-should-syntax-check-in-buffer errors)))) (defun flycheck-ert-at-nth-error (n) "Determine whether point is at the N'th Flycheck error. Return non-nil if the point is at the N'th Flycheck error in the current buffer. Otherwise return nil." (let* ((error (nth (1- n) flycheck-current-errors)) (mode flycheck-highlighting-mode) (region (flycheck-error-region-for-mode error mode))) (and (member error (flycheck-overlay-errors-at (point))) (= (point) (car region))))) (defun flycheck-ert-explain--at-nth-error (n) "Explain a failed at-nth-error predicate at N." (let ((errors (flycheck-overlay-errors-at (point)))) (if (null errors) (format "Expected to be at error %s, but no error at point %s" n (point)) (let ((pos (cl-position (car errors) flycheck-current-errors))) (format "Expected to be at point %s and error %s, \ but point %s is at error %s" (car (flycheck-error-region-for-mode (nth (1- n) flycheck-current-errors) flycheck-highlighting-mode)) n (point) (1+ pos)))))) (put 'flycheck-ert-at-nth-error 'ert-explainer 'flycheck-ert-explain--at-nth-error) (provide 'flycheck-ert) ;;; flycheck-ert.el ends here flycheck-35.0/flycheck.el000066400000000000000000017606231500215546300153630ustar00rootroot00000000000000;;; flycheck.el --- On-the-fly syntax checking -*- lexical-binding: t; -*- ;; Copyright (C) 2017-2025 Flycheck contributors ;; Copyright (C) 2012-2016 Sebastian Wiesner and Flycheck contributors ;; Copyright (C) 2013, 2014 Free Software Foundation, Inc. ;; ;; Author: Sebastian Wiesner ;; Maintainer: Clément Pit-Claudel ;; fmdkdd ;; Bozhidar Batsov ;; URL: https://www.flycheck.org ;; Keywords: convenience, languages, tools ;; Version: 35.0 ;; Package-Requires: ((emacs "27.1")) ;; This file is not part of GNU Emacs. ;; This program is free software: you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; On-the-fly syntax checking for GNU Emacs. ;; ;; Flycheck is a modern on-the-fly syntax checking extension for GNU Emacs, ;; intended as replacement for the older Flymake extension which is part of GNU ;; Emacs. ;; ;; Flycheck automatically checks buffers for errors while you type, and reports ;; warnings and errors directly in the buffer and in an optional IDE-like error ;; list. ;; ;; It comes with a rich interface for custom syntax checkers and other ;; extensions, and has already many 3rd party extensions adding new features. ;; ;; Please read the online manual at https://www.flycheck.org for more ;; information. You can open the manual directly from Emacs with `M-x ;; flycheck-manual'. ;; ;; # Setup ;; ;; Flycheck works best on Unix systems. It does not officially support Windows, ;; but tries to maintain Windows compatibility and should generally work fine on ;; Windows, too. ;; ;; To enable Flycheck add the following to your init file: ;; ;; (add-hook 'after-init-hook #'global-flycheck-mode) ;; ;; Flycheck will then automatically check buffers in supported languages, as ;; long as all necessary tools are present. Use `flycheck-verify-setup' to ;; troubleshoot your Flycheck setup. ;;; Code: (eval-when-compile (require 'let-alist) ; `let-alist' (require 'compile) ; Compile Mode integration (require 'jka-compr) ; To inhibit compression of temp files (require 'pcase) ; `pcase-dolist' (`pcase' itself is autoloaded) ) (require 'seq) ; Sequence functions (require 'subr-x) ; Additional utilities (require 'cl-lib) ; `cl-defstruct' and CL utilities (require 'tabulated-list) ; To list errors (require 'easymenu) ; Flycheck Mode menu definition (require 'rx) ; Regexp fanciness in `flycheck-define-checker' (require 'help-mode) ; `define-button-type' (require 'find-func) ; `find-function-regexp-alist' (require 'json) ; `flycheck-parse-json' (require 'ansi-color) ; `flycheck-parse-with-patterns-without-color' ;; Declare a bunch of dynamic variables that we need from other modes (defvar sh-shell) ; For shell script checker predicates (defvar ess-language) ; For r-lintr predicate (defvar markdown-hide-markup) ; (defvar markdown-fontify-code-block-default-mode) ; For rust-error-explainer (defvar markdown-fontify-code-blocks-natively) ; ;; Tell the byte compiler about autoloaded functions from packages (declare-function pkg-info-version-info "pkg-info" (package)) ;;; Customization (defgroup flycheck nil "Modern on-the-fly syntax checking for GNU Emacs." :prefix "flycheck-" :group 'tools :link '(url-link :tag "Website" "https://www.flycheck.org") :link '(url-link :tag "Github" "https://github.com/flycheck/flycheck")) (defgroup flycheck-config-files nil "Configuration files for on-the-fly syntax checkers." :prefix "flycheck-" :group 'flycheck) (defgroup flycheck-options nil "Options for on-the-fly syntax checkers." :prefix "flycheck-" :group 'flycheck) (defgroup flycheck-executables nil "Executables of syntax checkers." :prefix "flycheck-" :group 'flycheck) (defgroup flycheck-faces nil "Faces used by on-the-fly syntax checking." :prefix "flycheck-" :group 'flycheck) (defcustom flycheck-checkers '(ada-gnat asciidoctor asciidoc awk-gawk bazel-build-buildifier bazel-module-buildifier bazel-starlark-buildifier bazel-workspace-buildifier c/c++-clang c/c++-gcc c/c++-cppcheck cfengine coffee coffee-coffeelint css-csslint css-stylelint cuda-nvcc cwl d-dmd dockerfile-hadolint elixir-credo emacs-lisp emacs-lisp-checkdoc ember-template erlang-rebar3 erlang eruby-erubis eruby-ruumba fortran-gfortran go-gofmt go-vet go-build go-test go-errcheck go-unconvert go-staticcheck groovy haml haml-lint handlebars haskell-stack-ghc haskell-ghc haskell-hlint html-tidy javascript-eslint javascript-jshint javascript-standard json-jsonlint json-python-json json-jq jsonnet less less-stylelint llvm-llc lua-luacheck lua markdown-markdownlint-cli markdown-markdownlint-cli2 markdown-mdl markdown-pymarkdown nix nix-linter opam perl perl-perlcritic perl-perlimports php php-phpmd php-phpcs php-phpcs-changed processing proselint protobuf-protoc protobuf-prototool pug puppet-parser puppet-lint python-flake8 python-ruff python-pylint python-pycompile python-pyright python-mypy r-lintr r racket rpm-rpmlint rst-sphinx rst ruby-rubocop ruby-chef-cookstyle ruby-standard ruby-reek ruby ruby-jruby rust-cargo rust rust-clippy salt-lint scala scala-scalastyle scheme-chicken scss-lint sass-stylelint scss-stylelint sass/scss-sass-lint sass scss sh-bash sh-posix-dash sh-posix-bash sh-zsh sh-shellcheck slim slim-lint sql-sqlint statix systemd-analyze tcl-nagelfar terraform terraform-tflint tex-chktex tex-lacheck texinfo textlint typescript-tslint verilog-verilator vhdl-ghdl xml-xmlstarlet xml-xmllint yaml-actionlint yaml-jsyaml yaml-ruby yaml-yamllint) "Syntax checkers available for automatic selection. A list of Flycheck syntax checkers to choose from when syntax checking a buffer. Flycheck will automatically select a suitable syntax checker from this list, unless `flycheck-checker' is set, either directly or with `flycheck-select-checker'. You should not need to change this variable normally. In order to disable syntax checkers, please use `flycheck-disabled-checkers'. This variable is intended for 3rd party extensions to tell Flycheck about new syntax checkers. Syntax checkers in this list must be defined with `flycheck-define-checker'." :group 'flycheck :type '(repeat (symbol :tag "Checker")) :risky t) (defcustom flycheck-disabled-checkers nil "Syntax checkers excluded from automatic selection. A list of Flycheck syntax checkers to exclude from automatic selection. Flycheck will never automatically select a syntax checker in this list, regardless of the value of `flycheck-checkers'. However, syntax checkers in this list are still available for manual selection with `flycheck-select-checker'. Use this variable to disable syntax checkers, instead of removing the syntax checkers from `flycheck-checkers'. You may also use this option as a file or directory local variable to disable specific checkers in individual files and directories respectively." :group 'flycheck :type '(repeat (symbol :tag "Checker")) :package-version '(flycheck . "0.16") :safe #'flycheck-symbol-list-p) (make-variable-buffer-local 'flycheck-disabled-checkers) (defvar-local flycheck--automatically-disabled-checkers nil "List of syntax checkers automatically disabled for this buffer. A checker can be automatically disabled in two cases: 1. Its `:enabled' predicate returned false. 2. It returned too many errors (see `flycheck-checker-error-threshold'). To trigger a reverification from Emacs Lisp code, do not modify this variable: use `flycheck-reset-enabled-checker'.") (defvar-local flycheck-checker nil "Syntax checker to use for the current buffer. If unset or nil, automatically select a suitable syntax checker from `flycheck-checkers' on every syntax check. If set to a syntax checker only use this syntax checker and never select one from `flycheck-checkers' automatically. The syntax checker is used regardless of whether it is contained in `flycheck-checkers' or `flycheck-disabled-checkers'. If the syntax checker is unusable in the current buffer an error is signaled. A syntax checker assigned to this variable must be defined with `flycheck-define-checker'. Use the command `flycheck-select-checker' to select a syntax checker for the current buffer, or set this variable as file local variable to always use a specific syntax checker for a file. See Info Node `(Emacs)Specifying File Variables' for more information about file variables.") (put 'flycheck-checker 'safe-local-variable 'flycheck-registered-checker-p) (defcustom flycheck-locate-config-file-functions nil "Functions to locate syntax checker configuration files. Each function in this hook must accept two arguments: The value of the configuration file variable, and the syntax checker symbol. It must return either a string with an absolute path to the configuration file, or nil, if it cannot locate the configuration file. The functions in this hook are called in order of appearance, until a function returns non-nil. The configuration file returned by that function is then given to the syntax checker if it exists. This variable is an abnormal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t) (defcustom flycheck-checker-error-threshold 400 "Maximum errors allowed per syntax checker. The value of this variable is either an integer denoting the maximum number of errors per syntax checker and buffer, or nil to not limit the errors reported from a syntax checker. If this variable is a number and a syntax checker reports more errors than the value of this variable, its errors are not discarded, and not highlighted in the buffer or available in the error list. The affected syntax checker is also disabled for future syntax checks of the buffer." :group 'flycheck :type '(choice (const :tag "Do not limit reported errors" nil) (integer :tag "Maximum number of errors")) :risky t :package-version '(flycheck . "0.22")) (defcustom flycheck-process-error-functions nil "Functions to process errors. Each function in this hook must accept a single argument: A Flycheck error to process. All functions in this hook are called in order of appearance, until a function returns non-nil. Thus, a function in this hook may return nil, to allow for further processing of the error, or any non-nil value, to indicate that the error was fully processed and inhibit any further processing. The functions are called for each newly parsed error immediately after the corresponding syntax checker finished. At this stage, the overlays from the previous syntax checks are still present, and there may be further syntax checkers in the chain. This variable is an abnormal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :package-version '(flycheck . "0.13") :risky t) (defcustom flycheck-auto-display-errors-after-checking t "Whether to automatically display errors at the current point after checking. When being set to `nil', it will prevent Flycheck from automatically displaying error messages. This setting is useful when Flycheck is used together with `flycheck-posframe', to prevent `flycheck-posframe' from repeatedly displaying errors at point." :group 'flycheck :type 'boolean :package-version '(flycheck . "35") :safe #'booleanp) (defcustom flycheck-display-errors-delay 0.9 "Delay in seconds before displaying errors at point. Use floating point numbers to express fractions of seconds." :group 'flycheck :type 'number :package-version '(flycheck . "0.15") :safe #'numberp) (defcustom flycheck-display-errors-function #'flycheck-display-error-messages "Function to display error messages. If set to a function, call the function with the list of errors to display as single argument. Each error is an instance of the `flycheck-error' struct. If set to nil, do not display errors at all." :group 'flycheck :type '(choice (const :tag "Display error messages" flycheck-display-error-messages) (const :tag "Display error messages only if no error list" flycheck-display-error-messages-unless-error-list) (function :tag "Error display function")) :package-version '(flycheck . "0.13") :risky t) (defcustom flycheck-clear-displayed-errors-function #'flycheck-clear-displayed-error-messages "Function to hide error message displayed by `flycheck-display-errors-function'. If set to a function, it will be called with no arguments to clear all displayed errors at point." :group 'flycheck :type '(choice (const :tag "Clear displayed error messages" flycheck-clear-displayed-error-messages) (function :tag "Clear displayed errors function")) :package-version '(flycheck . "34.2") :risky t) (defcustom flycheck-help-echo-function #'flycheck-help-echo-all-error-messages "Function to compute the contents of the error tooltips. If set to a function, call the function with the list of errors to display as single argument. Each error is an instance of the `flycheck-error' struct. The function is used to set the help-echo property of flycheck error overlays. It should return a string, which is displayed when the user hovers over an error or presses \\[display-local-help]. If set to nil, do not show error tooltips." :group 'flycheck :type '(choice (const :tag "Concatenate error messages to form a tooltip" flycheck-help-echo-all-error-messages) (function :tag "Help echo function")) :package-version '(flycheck . "0.25") :risky t) (defcustom flycheck-command-wrapper-function #'identity "Function to modify checker commands before execution. The value of this option is a function which is given a list containing the full command of a syntax checker after substitution through `flycheck-substitute-argument' but before execution. The function may return a new command for Flycheck to execute. The default value is `identity' which does not change the command. You may provide your own function to run Flycheck commands through `bundle exec', `nix-shell' or similar wrappers." :group 'flycheck :type '(choice (const :tag "Do not modify commands" identity) (function :tag "Modify command with a custom function")) :package-version '(flycheck . "0.25") :risky t) (defcustom flycheck-executable-find #'flycheck-default-executable-find "Function to search for executables. The value of this option is a function which is given the name or path of an executable and shall return the full path to the executable, or nil if the executable does not exit. The default is `flycheck-default-executable-find', which searches variable `exec-path' when given a command name, and resolves paths to absolute ones. You can customize this option to search for checkers in other environments such as bundle or NixOS sandboxes." :group 'flycheck :type '(choice (const :tag "Search executables in `exec-path'" flycheck-default-executable-find) (function :tag "Search executables with a custom function")) :package-version '(flycheck . "32") :risky t) (defun flycheck-default-executable-find (executable) "Resolve EXECUTABLE to a full path. Like `executable-find', but supports relative paths. Attempts invoking `executable-find' first; if that returns nil, and EXECUTABLE contains a directory component, expands to a full path and tries invoking `executable-find' again." ;; file-name-directory returns non-nil iff the given path has a ;; directory component. (or (executable-find executable) (when (file-name-directory executable) (executable-find (expand-file-name executable))))) (defcustom flycheck-indication-mode 'left-fringe "The indication mode for Flycheck errors. This variable controls how Flycheck indicates errors in buffers. May be `left-fringe', `right-fringe', `left-margin', `right-margin', or nil. If set to `left-fringe' or `right-fringe', indicate errors via icons in the left and right fringe respectively. If set to `left-margin' or `right-margin', use the margins instead. If set to nil, do not indicate errors and warnings, but just highlight them according to `flycheck-highlighting-mode'." :group 'flycheck :type '(choice (const :tag "Indicate in the left fringe" left-fringe) (const :tag "Indicate in the right fringe" right-fringe) (const :tag "Indicate in the left margin" left-margin) (const :tag "Indicate in the right margin" right-margin) (const :tag "Do not indicate" nil)) :safe #'symbolp) (defcustom flycheck-highlighting-mode 'symbols "The highlighting mode for Flycheck errors and warnings. The highlighting mode controls how Flycheck highlights errors in buffers when a checker only reports the starting position of an error. The following modes are known: `columns' Highlight a single character. If the error does not have a column, highlight the whole line. `symbols' Highlight a full symbol if there is any, otherwise behave like `columns'. This is the default. `sexps' Highlight a full expression, if there is any, otherwise behave like `columns'. Note that this mode can be *very* slow in some major modes. `lines' Highlight the whole line. nil Do not highlight errors at all. However, errors will still be reported in the mode line and in error message popups, and indicated according to `flycheck-indication-mode'." :group 'flycheck :type '(choice (const :tag "Highlight columns only" columns) (const :tag "Highlight symbols" symbols) (const :tag "Highlight expressions" sexps) (const :tag "Highlight whole lines" lines) (const :tag "Do not highlight errors" nil)) :package-version '(flycheck . "0.14") :safe #'symbolp) (defvar flycheck-current-errors) (defun flycheck-refresh-fringes-and-margins () "Refresh fringes and margins of all windows displaying the current buffer. If any errors are currently shown, launch a new check, to adjust to a potential new indication mode." (dolist (win (get-buffer-window-list)) (set-window-margins win left-margin-width right-margin-width) (set-window-fringes win left-fringe-width right-fringe-width)) (when flycheck-current-errors (flycheck-buffer))) (defun flycheck-set-indication-mode (&optional mode) "Set `flycheck-indication-mode' to MODE and adjust margins and fringes. When MODE is nil, adjust window parameters without changing the mode. This function can be useful as a `flycheck-mode-hook', especially if you use margins only in Flycheck buffers. When MODE is `left-margin', the left fringe is reduced to 1 pixel to save space." (interactive (list (intern (completing-read "Mode: " '("left-fringe" "right-fringe" "left-margin" "right-margin") nil t nil nil (prin1-to-string flycheck-indication-mode))))) (setq mode (or mode flycheck-indication-mode)) (pcase mode ((or `left-fringe `right-fringe) (setq left-fringe-width 8 right-fringe-width 8 left-margin-width 0 right-margin-width 0)) (`left-margin (setq left-fringe-width 1 right-fringe-width 8 left-margin-width 1 right-margin-width 0)) (`right-margin (setq left-fringe-width 8 right-fringe-width 8 left-margin-width 0 right-margin-width 1)) (_ (user-error "Invalid indication mode"))) (setq-local flycheck-indication-mode mode) (flycheck-refresh-fringes-and-margins)) (define-widget 'flycheck-highlighting-style 'lazy "A value for `flycheck-highlighting-style'." :offset 2 :format "%t: Use %v" :type '(choice :format "%[Value Menu%] %v" (const :tag "no highlighting" nil) (const :tag "a face indicating the error level" level-face) (list :tag "a pair of delimiters" (const :format "" delimiters) (string :tag "Before") (string :tag "After")) (list :tag "a conditional mix of styles" (const :format "" conditional) (integer :tag "Up to this many lines") (flycheck-highlighting-style :format "Use %v") (flycheck-highlighting-style :format "Otherwise, use %v")))) (defun flycheck--make-highlighting-delimiter (char) "Make a highlighting bracket symbol by repeating CHAR twice." (compose-chars ?\s ;; '(Bl . Br) ?\s '(Bc Br 30 0) char '(Bc Bl -30 0) char)) (defcustom flycheck-highlighting-style `(conditional 4 level-face (delimiters "" "")) "The highlighting style for Flycheck errors and warnings. The highlighting style controls how Flycheck highlights error regions in buffers. The following styles are supported: nil Do not highlight errors. Same as setting `flycheck-highlighting-mode' to nil. `level-face' Chose a face depending on the severity of the error, and apply it to the whole error text. See also the `flycheck-define-error-level' and `flycheck-error', `flycheck-warning', and `flycheck-info' faces. \(`delimiters' BEFORE AFTER) Draw delimiters on each side of the error. BEFORE and AFTER indicate which delimiters to use. If they are strings, they are used as-is. If they are characters, they are repeated twice and composed into a single character. Delimiters use the fringe face corresponding to the severity of each error, as well as the `flycheck-error-delimiter' face. Delimited text has the `flycheck-delimited-error' face. \(`conditional' NLINES S1 S2) Use style S1 for errors spanning up to NLINES lines, and style S2 otherwise. See also `flycheck-highlighting-mode' and `flycheck-indication-mode'." :group 'flycheck :type 'flycheck-highlighting-style :package-version '(flycheck . "32") :safe t) (defcustom flycheck-check-syntax-automatically '(save idle-change new-line mode-enabled) "When Flycheck should check syntax automatically. This variable is a list of events that may trigger syntax checks. The following events are known: `save' Check syntax immediately after the buffer was saved. `idle-change' Check syntax a short time (see `flycheck-idle-change-delay') after the last change to the buffer. `idle-buffer-switch' Check syntax a short time (see `flycheck-idle-buffer-switch-delay') after the user switches to a buffer. `new-line' Check syntax immediately after a new line was inserted into the buffer. `mode-enabled' Check syntax immediately when variable `flycheck-mode' is non-nil. Flycheck performs a syntax checks only on events, which are contained in this list. For instance, if the value of this variable is `(mode-enabled save)', Flycheck will only check if the mode is enabled or the buffer was saved, but never after changes to the buffer contents. If nil, never check syntax automatically. In this case, use `flycheck-buffer' to start a syntax check manually." :group 'flycheck :type '(set (const :tag "After the buffer was saved" save) (const :tag "After the buffer was changed and idle" idle-change) (const :tag "After switching the current buffer" idle-buffer-switch) (const :tag "After a new line was inserted" new-line) (const :tag "After `flycheck-mode' was enabled" mode-enabled)) :package-version '(flycheck . "0.12") :safe #'flycheck-symbol-list-p) (defcustom flycheck-idle-change-delay 0.5 "How many seconds to wait after a change before checking syntax. After the buffer was changed, Flycheck will wait as many seconds as the value of this variable before starting a syntax check. If the buffer is modified during this time, Flycheck will wait again. This variable has no effect, if `idle-change' is not contained in `flycheck-check-syntax-automatically'." :group 'flycheck :type 'number :package-version '(flycheck . "0.13") :safe #'numberp) (defcustom flycheck-idle-buffer-switch-delay 0.5 "How many seconds to wait after switching buffers before checking syntax. After the user switches to a new buffer, Flycheck will wait as many seconds as the value of this variable before starting a syntax check. If the user switches to another buffer during this time, whether a syntax check is still performed depends on the value of `flycheck-buffer-switch-check-intermediate-buffers'. This variable has no effect if `idle-buffer-switch' is not contained in `flycheck-check-syntax-automatically'." :group 'flycheck :type 'number :package-version '(flycheck . "32") :safe #'numberp) (defcustom flycheck-buffer-switch-check-intermediate-buffers nil "Whether to check syntax in a buffer you only visit briefly. If nil, then when you switch to a buffer but switch to another buffer before the syntax check is performed, then the check is canceled. If non-nil, then syntax checks due to switching buffers are always performed. This only affects buffer switches that happen less than `flycheck-idle-buffer-switch-delay' seconds apart. This variable has no effect if `idle-buffer-switch' is not contained in `flycheck-check-syntax-automatically'." :group 'flycheck :type 'boolean :package-version '(flycheck . "32") :safe #'booleanp) (defcustom flycheck-standard-error-navigation t "Whether to support error navigation with `next-error'. If non-nil, enable navigation of Flycheck errors with `next-error', `previous-error' and `first-error'. Otherwise, these functions just navigate errors from compilation modes. Flycheck error navigation with `flycheck-next-error', `flycheck-previous-error' and `flycheck-first-error' is always enabled, regardless of the value of this variable. Note that this setting only takes effect when variable `flycheck-mode' is non-nil. Changing it will not affect buffers where variable `flycheck-mode' is already non-nil." :group 'flycheck :type 'boolean :package-version '(flycheck . "0.15") :safe #'booleanp) (define-widget 'flycheck-minimum-level 'lazy "A radio-type choice of minimum error levels. See `flycheck-navigation-minimum-level' and `flycheck-error-list-minimum-level'." :type '(radio (const :tag "All locations" nil) (const :tag "Informational messages" info) (const :tag "Warnings" warning) (const :tag "Errors" error) (symbol :tag "Custom error level"))) (defcustom flycheck-navigation-minimum-level nil "The minimum level of errors to navigate. If set to an error level, only navigate errors whose error level is at least as severe as this one. If nil, navigate all errors." :group 'flycheck :type 'flycheck-minimum-level :safe #'flycheck-error-level-p :package-version '(flycheck . "0.21")) (defcustom flycheck-error-list-minimum-level nil "The minimum level of errors to display in the error list. If set to an error level, only display errors whose error level is at least as severe as this one in the error list. If nil, display all errors. This is the default level, used when the error list is opened. You can temporarily change the level using \\[flycheck-error-list-set-filter], or reset it to this value using \\[flycheck-error-list-reset-filter]." :group 'flycheck :type 'flycheck-minimum-level :safe #'flycheck-error-level-p :package-version '(flycheck . "0.24")) (defcustom flycheck-relevant-error-other-file-minimum-level 'error "The minimum level of errors from other files to display in this buffer. If set to an error level, only display errors from other files whose error level is at least as severe as this one. If nil, display all errors from other files." :group 'flycheck :type 'flycheck-minimum-level :safe #'flycheck-error-level-p :package-version '(flycheck . "32")) (defcustom flycheck-relevant-error-other-file-show t "Whether to show errors from other files." :group 'flycheck :type 'boolean :package-version '(flycheck . "32") :safe #'booleanp) (defcustom flycheck-completing-read-function #'completing-read "Function to read from minibuffer with completion. The function must be compatible to the built-in `completing-read' function." :group 'flycheck :type '(choice (const :tag "Default" completing-read) (const :tag "IDO" ido-completing-read) (function :tag "Custom function")) :risky t :package-version '(flycheck . "26")) (defcustom flycheck-temp-prefix "flycheck" "Prefix for temporary files created by Flycheck." :group 'flycheck :type 'string :package-version '(flycheck . "0.19") :risky t) (defcustom flycheck-mode-hook nil "Hooks to run after command `flycheck-mode' is toggled." :group 'flycheck :type 'hook :risky t) (defcustom flycheck-after-syntax-check-hook nil "Functions to run after each syntax check. This hook is run after a syntax check was finished. At this point, *all* chained checkers were run, and all errors were parsed, highlighted and reported. The variable `flycheck-current-errors' contains all errors from all syntax checkers run during the syntax check, so you can apply any error analysis functions. Note that this hook does *not* run after each individual syntax checker in the syntax checker chain, but only after the *last checker*. This variable is a normal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t) (defcustom flycheck-before-syntax-check-hook nil "Functions to run before each syntax check. This hook is run right before a syntax check starts. Error information from the previous syntax check is *not* cleared before this hook runs. Note that this hook does *not* run before each individual syntax checker in the syntax checker chain, but only before the *first checker*. This variable is a normal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t) (defcustom flycheck-syntax-check-failed-hook nil "Functions to run if a syntax check failed. This hook is run whenever an error occurs during Flycheck's internal processing. No information about the error is given to this hook. You should use this hook to conduct additional cleanup actions when Flycheck failed. This variable is a normal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t) (defcustom flycheck-status-changed-functions nil "Functions to run if the Flycheck status changed. This hook is run whenever the status of Flycheck changes. Each hook function takes the status symbol as single argument, as given to `flycheck-report-status', which see. This variable is an abnormal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t :package-version '(flycheck . "0.20")) (defcustom flycheck-error-list-after-refresh-hook nil "Functions to run after the error list was refreshed. This hook is run whenever the error list is refreshed. This variable is a normal hook. See Info node `(elisp)Hooks'." :group 'flycheck :type 'hook :risky t :package-version '(flycheck . "0.21")) (defface flycheck-error-delimiter `((t)) "Flycheck face for errors spanning multiple lines. See `flycheck-highlighting-style' for details on when this face is used." :package-version '(flycheck . "32") :group 'flycheck-faces) (defface flycheck-delimited-error `((t)) "Flycheck face for errors spanning multiple lines. See `flycheck-highlighting-style' for details on when this face is used." :package-version '(flycheck . "32") :group 'flycheck-faces) (defface flycheck-error '((((supports :underline (:style wave))) :underline (:style wave :color "Red1")) (t :underline t :inherit error)) "Flycheck face for errors." :package-version '(flycheck . "0.13") :group 'flycheck-faces) (defface flycheck-warning '((((supports :underline (:style wave))) :underline (:style wave :color "DarkOrange")) (t :underline t :inherit warning)) "Flycheck face for warnings." :package-version '(flycheck . "0.13") :group 'flycheck-faces) (defface flycheck-info '((((supports :underline (:style wave))) :underline (:style wave :color "ForestGreen")) (t :underline t :inherit success)) "Flycheck face for informational messages." :package-version '(flycheck . "0.15") :group 'flycheck-faces) (defface flycheck-fringe-error '((t :inherit error)) "Flycheck face for fringe error indicators." :package-version '(flycheck . "0.13") :group 'flycheck-faces) (defface flycheck-fringe-warning '((t :inherit warning)) "Flycheck face for fringe warning indicators." :package-version '(flycheck . "0.13") :group 'flycheck-faces) (defface flycheck-fringe-info ;; Semantically `success' is probably not the right face, but it looks nice as ;; a base face '((t :inherit success)) "Flycheck face for fringe info indicators." :package-version '(flycheck . "0.15") :group 'flycheck-faces) (defface flycheck-error-list-error '((t :inherit error)) "Flycheck face for error messages in the error list." :package-version '(flycheck . "0.16") :group 'flycheck-faces) (defface flycheck-error-list-warning '((t :inherit warning)) "Flycheck face for warning messages in the error list." :package-version '(flycheck . "0.16") :group 'flycheck-faces) (defface flycheck-error-list-info '((t :inherit success)) "Flycheck face for info messages in the error list." :package-version '(flycheck . "0.16") :group 'flycheck-faces) (defface flycheck-error-list-line-number '((t)) "Face for line numbers in the error list." :group 'flycheck-faces :package-version '(flycheck . "0.16")) (defface flycheck-error-list-column-number '((t)) "Face for line numbers in the error list." :group 'flycheck-faces :package-version '(flycheck . "0.16")) (defface flycheck-error-list-filename '((t :inherit mode-line-buffer-id :bold nil)) "Face for filenames in the error list." :group 'flycheck-faces :package-version '(flycheck . "32")) (defface flycheck-error-list-id '((t :inherit font-lock-type-face)) "Face for the error ID in the error list." :group 'flycheck-faces :package-version '(flycheck . "0.22")) (defface flycheck-error-list-id-with-explainer '((t :inherit flycheck-error-list-id :box (:style released-button))) "Face for the error ID in the error list, for errors that have an explainer." :group 'flycheck-faces :package-version '(flycheck . "30")) (defface flycheck-error-list-checker-name '((t :inherit font-lock-function-name-face)) "Face for the syntax checker name in the error list." :group 'flycheck-faces :package-version '(flycheck . "0.21")) (defface flycheck-error-list-error-message '((t)) "Face for the error message in the error list." :group 'flycheck-faces :package-version '(flycheck . "33")) (defface flycheck-error-list-highlight '((t :bold t)) "Flycheck face to highlight errors in the error list." :package-version '(flycheck . "0.15") :group 'flycheck-faces) (defface flycheck-verify-select-checker '((t :box (:style released-button))) "Flycheck face for the `select' button in the verify setup buffer." :package-version '(flycheck . "32") :group 'flycheck-faces) (defvar flycheck-command-map (let ((map (make-sparse-keymap))) (define-key map "c" #'flycheck-buffer) (define-key map "C" #'flycheck-clear) (define-key map (kbd "C-c") #'flycheck-compile) (define-key map "n" #'flycheck-next-error) (define-key map "p" #'flycheck-previous-error) (define-key map "l" #'flycheck-list-errors) (define-key map (kbd "C-w") #'flycheck-copy-errors-as-kill) (define-key map "s" #'flycheck-select-checker) (define-key map "?" #'flycheck-describe-checker) (define-key map "h" #'flycheck-display-error-at-point) (define-key map "e" #'flycheck-explain-error-at-point) (define-key map "H" #'display-local-help) (define-key map "i" #'flycheck-manual) (define-key map "V" #'flycheck-version) (define-key map "v" #'flycheck-verify-setup) (define-key map "x" #'flycheck-disable-checker) map) "Keymap of Flycheck interactive commands.") (defcustom flycheck-keymap-prefix (kbd "C-c !") "Prefix for key bindings of Flycheck. Changing this variable outside Customize does not have any effect. To change the keymap prefix from Lisp, you need to explicitly re-define the prefix key: (define-key flycheck-mode-map flycheck-keymap-prefix nil) (setq flycheck-keymap-prefix (kbd \"C-c f\")) (define-key flycheck-mode-map flycheck-keymap-prefix flycheck-command-map) Please note that Flycheck's manual documents the default keybindings. Changing this variable is at your own risk." :group 'flycheck :package-version '(flycheck . "0.19") :type 'string :risky t :set (lambda (variable key) (when (and (boundp variable) (boundp 'flycheck-mode-map)) (define-key flycheck-mode-map (symbol-value variable) nil) (define-key flycheck-mode-map key flycheck-command-map)) (set-default variable key))) (defcustom flycheck-mode-line '(:eval (flycheck-mode-line-status-text)) "Mode line lighter for Flycheck. The value of this variable is a mode line template as in `mode-line-format'. See Info Node `(elisp)Mode Line Format' for more information. Note that it should contain a _single_ mode line construct only. Customize this variable to change how Flycheck reports its status in the mode line. You may use `flycheck-mode-line-status-text' to obtain a human-readable status text, including an error/warning count. You may also assemble your own status text. The current status of Flycheck is available in `flycheck-last-status-change'. The errors in the current buffer are stored in `flycheck-current-errors', and the function `flycheck-count-errors' may be used to obtain the number of errors grouped by error level. Set this variable to nil to disable the mode line completely." :group 'flycheck :type 'sexp :risky t :package-version '(flycheck . "0.20")) (defcustom flycheck-mode-line-color t "Use colors for Flycheck mode line status." :group 'flycheck :type 'boolean :package-version '(flycheck . "35")) (defcustom flycheck-mode-line-prefix "FlyC" "Base mode line lighter for Flycheck. This will have an effect only with the default `flycheck-mode-line'. If you've customized `flycheck-mode-line' then the customized function must be updated to use this variable." :group 'flycheck :type 'string :package-version '(flycheck . "26")) (defcustom flycheck-mode-success-indicator ":0" "Success indicator appended to `flycheck-mode-line-prefix'." :group 'flycheck :type 'string :package-version '(flycheck . "35")) (defcustom flycheck-error-list-mode-line `(,(propertized-buffer-identification "%12b") " for buffer " (:eval (flycheck-error-list-propertized-source-name)) (:eval (flycheck-error-list-mode-line-filter-indicator))) "Mode line construct for Flycheck error list. The value of this variable is a mode line template as in `mode-line-format', to be used as `mode-line-buffer-identification' in `flycheck-error-list-mode'. See Info Node `(elisp)Mode Line Format' for more information. Customize this variable to change how the error list appears in the mode line. The default shows the name of the buffer and the name of the source buffer, i.e. the buffer whose errors are currently listed." :group 'flycheck :type 'sexp :risky t :package-version '(flycheck . "0.20")) (defcustom flycheck-global-modes t "Modes for which option `flycheck-mode' is turned on. If t, Flycheck Mode is turned on for all major modes. If a list, Flycheck Mode is turned on for all `major-mode' symbols in that list. If the `car' of the list is `not', Flycheck Mode is turned on for all `major-mode' symbols _not_ in that list. If nil, Flycheck Mode is never turned on by command `global-flycheck-mode'. Note that Flycheck is never turned on for modes whose `mode-class' property is `special' (see Info node `(elisp)Major Mode Conventions'), regardless of the value of this option. Only has effect when variable `global-flycheck-mode' is non-nil." :group 'flycheck :type '(choice (const :tag "none" nil) (const :tag "all" t) (set :menu-tag "mode specific" :tag "modes" :value (not) (const :tag "Except" not) (repeat :inline t (symbol :tag "mode")))) :risky t :package-version '(flycheck . "0.23")) ;; Add built-in functions to our hooks, via `add-hook', to make sure that our ;; functions are really present, even if the variable was implicitly defined by ;; another call to `add-hook' that occurred before Flycheck was loaded. See ;; https://lists.gnu.org/archive/html/emacs-devel/2015-02/msg01271.html for why ;; we don't initialize the hook variables right away. We append our own ;; functions, because a user likely expects that their functions come first, ;; even if they added them before Flycheck was loaded. (dolist (hook (list #'flycheck-locate-config-file-by-path #'flycheck-locate-config-file-ancestor-directories #'flycheck-locate-config-file-home)) (add-hook 'flycheck-locate-config-file-functions hook 'append)) (add-hook 'flycheck-process-error-functions #'flycheck-add-overlay 'append) ;;; Global Flycheck menu (defvar flycheck-mode-menu-map (easy-menu-create-menu "Syntax Checking" '(["Enable on-the-fly syntax checking" flycheck-mode :style toggle :selected flycheck-mode :enable (or flycheck-mode ;; Don't let users toggle the mode if there is no syntax ;; checker for this buffer (seq-find #'flycheck-checker-supports-major-mode-p flycheck-checkers))] ["Check current buffer" flycheck-buffer flycheck-mode] ["Clear errors in buffer" flycheck-clear t] ["Run checker as compile command" flycheck-compile flycheck-mode] "---" ["Go to next error" flycheck-next-error flycheck-mode] ["Go to previous error" flycheck-previous-error flycheck-mode] ["Show all errors" flycheck-list-errors flycheck-mode] "---" ["Copy messages at point" flycheck-copy-errors-as-kill (flycheck-overlays-at (point))] ["Explain error at point" flycheck-explain-error-at-point] "---" ["Select syntax checker" flycheck-select-checker flycheck-mode] ["Disable syntax checker" flycheck-disable-checker flycheck-mode] ["Set executable of syntax checker" flycheck-set-checker-executable flycheck-mode] "---" ["Describe syntax checker" flycheck-describe-checker t] ["Verify setup" flycheck-verify-setup t] ["Show Flycheck version" flycheck-version t] ["Flycheck quick help" flycheck-quick-help t] ["Read the Flycheck manual" flycheck-manual t])) "Menu of command `flycheck-mode'.") (easy-menu-add-item nil '("Tools") flycheck-mode-menu-map "Spell Checking") (defconst flycheck-version "35.0" "The current version of Flycheck. Should be kept in sync with the package version metadata. Used only when `package-get-function' is not available or fails.") (defun flycheck--pkg-version () "Extract FLYCHECK's package version from its package metadata." ;; Use `cond' below to avoid a compiler unused return value warning ;; when `package-get-version' returns nil. See #3181. (cond ((fboundp 'package-get-version) (package-get-version)) ((fboundp 'pkg-info-version-info) (pkg-info-version-info 'flycheck)) (t flycheck-version))) ;;; Version information, manual and loading of Flycheck (defun flycheck-version (&optional show-version) "Get the Flycheck version as string. If called interactively or if SHOW-VERSION is non-nil, show the version in the echo area and the messages buffer. The returned string includes both, the version from package.el and the library version, if both a present and different. If the version number could not be determined, signal an error, if called interactively, or if SHOW-VERSION is non-nil, otherwise just return nil." (interactive (list t)) (let ((version (flycheck--pkg-version))) (when show-version (message "Flycheck version: %s" version)) version)) (defun flycheck-unload-function () "Unload function for Flycheck." (global-flycheck-mode -1) (easy-menu-remove-item nil '("Tools") (cadr flycheck-mode-menu-map)) (remove-hook 'kill-emacs-hook #'flycheck-global-teardown) (setq find-function-regexp-alist (assq-delete-all 'flycheck-checker find-function-regexp-alist))) ;;;###autoload (defun flycheck-manual () "Open the Flycheck manual." (interactive) (browse-url "https://www.flycheck.org")) ;;;###autoload (defun flycheck-quick-help () "Display brief Flycheck help." (interactive) (with-current-buffer (get-buffer-create "*flycheck-quick-help*") (with-help-window (current-buffer) (flycheck-mode) ;; so that we can exapnd \\[flycheck-] (let ((help (substitute-command-keys "Flycheck automatically runs checks on writable files when changed. Mode line status for the current buffer: FlyC Not been checked yet FlyC* Flycheck is running FlyC:0 Last check resulted in no errors and no warnings FlyC:3|5 Checker reported three errors and five warnings FlyC- No checker available FlyC! The checker crashed FlyC. The last syntax check was manually interrupted FlyC? The checker did something unexpected Key bindings: \\[flycheck-buffer] Check current buffer \\[flycheck-clear] Clear errors in current buffer \\[flycheck-compile] Run checker as compile command \\[flycheck-next-error] Next error \\[flycheck-previous-error] Previous error \\[flycheck-list-errors] List all errors \\[flycheck-copy-errors-as-kill] Copy error messages at point \\[flycheck-display-error-at-point] Explain error at point "))) (help-mode) (read-only-mode 0) (insert help))))) (define-obsolete-function-alias 'flycheck-info 'flycheck-manual "Flycheck 26" "Open the Flycheck manual.") ;;; Utility functions (defun flycheck-sexp-to-string (sexp) "Convert SEXP to a string. Like `prin1-to-string' but ensure that the returned string is loadable." (let ((print-quoted t) (print-length nil) (print-level nil)) (prin1-to-string sexp))) (defun flycheck-string-to-number-safe (string) "Safely convert STRING to a number. If STRING is of string type and a numeric string, convert STRING to a number and return it. Otherwise return nil." (let ((number-re (rx string-start (one-or-more (any digit)) string-end))) (when (and (stringp string) (string-match-p number-re string)) (string-to-number string)))) (defun flycheck-string-or-nil-p (obj) "Determine if OBJ is a string or nil." (or (null obj) (stringp obj))) (defun flycheck-string-list-p (obj) "Determine if OBJ is a list of strings." (and (listp obj) (seq-every-p #'stringp obj))) (defun flycheck-string-or-string-list-p (obj) "Determine if OBJ is a string or a list of strings." (or (stringp obj) (flycheck-string-list-p obj))) (defun flycheck-symbol-list-p (obj) "Determine if OBJ is a list of symbols." (and (listp obj) (seq-every-p #'symbolp obj))) (defvar-local flycheck--file-truename-cache nil) (defun flycheck--file-truename (file) "Memoize the result of `file-truename' on (directory-file-name FILE)." ;; `file-truename' is slow, but alternatives are incomplete, so memoizing is ;; our best bet. See https://github.com/flycheck/flycheck/pull/1698. (unless flycheck--file-truename-cache (setq-local flycheck--file-truename-cache (make-hash-table :test 'equal))) (or (gethash file flycheck--file-truename-cache) (puthash file (file-truename (directory-file-name file)) flycheck--file-truename-cache))) (defun flycheck-same-files-p (file-a file-b) "Determine whether FILE-A and FILE-B refer to the same file. Files are the same if (in the order checked) they are equal, or if they resolve to the same canonical paths." (or (string= file-a file-b) (string= (flycheck--file-truename file-a) (flycheck--file-truename file-b)))) (defvar-local flycheck-temporaries nil "Temporary files and directories created by Flycheck.") (defun flycheck-temp-dir-system () "Create a unique temporary directory. Use `flycheck-temp-prefix' as prefix, and add the directory to `flycheck-temporaries'. Return the path of the directory" (let* ((tempdir (make-temp-file flycheck-temp-prefix 'directory))) (push tempdir flycheck-temporaries) tempdir)) (defun flycheck-temp-file-system (filename &optional suffix) "Create a temporary file named after FILENAME. If FILENAME is non-nil, this function creates a temporary directory with `flycheck-temp-dir-system', and creates a file with the same name as FILENAME in this directory. Otherwise this function creates a temporary file starting with `flycheck-temp-prefix'. If present, SUFFIX is appended; otherwise, a random suffix is used. The path of the file is added to `flycheck-temporaries'. Return the path of the file." (let ((tempfile (convert-standard-filename (if filename (expand-file-name (file-name-nondirectory filename) (flycheck-temp-dir-system)) (make-temp-file flycheck-temp-prefix nil suffix))))) (push tempfile flycheck-temporaries) tempfile)) (defun flycheck-temp-file-inplace (filename &optional suffix) "Create an in-place copy of FILENAME. Prefix the file with `flycheck-temp-prefix' and add the path of the file to `flycheck-temporaries'. If FILENAME is nil, fall back to `flycheck-temp-file-system' with the specified SUFFIX. Return the path of the file." (if filename (let* ((tempname (format "%s_%s" flycheck-temp-prefix (file-name-nondirectory filename))) (tempfile (convert-standard-filename (expand-file-name tempname (file-name-directory filename))))) (push tempfile flycheck-temporaries) tempfile) (flycheck-temp-file-system filename suffix))) (defun flycheck-temp-directory (checker) "Return the directory where CHECKER writes temporary files. Return nil if the CHECKER does not write temporary files." (let ((args (flycheck-checker-arguments checker))) (cond ((memq 'source args) temporary-file-directory) ((memq 'source-inplace args) (if buffer-file-name (file-name-directory buffer-file-name) temporary-file-directory)) (t nil)))) (defun flycheck-temp-files-writable-p (checker) "Whether CHECKER can write temporary files. If CHECKER has `source' or `source-inplace' in its `:command', return whether flycheck has the permissions to create the respective temporary files. Return t if CHECKER does not use temporary files." (let ((dir (flycheck-temp-directory checker))) (or (not dir) (file-writable-p dir)))) (defun flycheck-save-buffer-to-file (file-name) "Save the contents of the current buffer to FILE-NAME." (make-directory (file-name-directory file-name) t) (let ((jka-compr-inhibit t)) (write-region nil nil file-name nil 0))) (defun flycheck-save-buffer-to-temp (temp-file-fn) "Save buffer to temp file returned by TEMP-FILE-FN. Return the name of the temporary file." (let ((filename (funcall temp-file-fn (buffer-file-name)))) ;; Do not flush short-lived temporary files onto disk (let ((write-region-inhibit-fsync t)) (flycheck-save-buffer-to-file filename)) filename)) (defun flycheck-prepend-with-option (option items &optional prepend-fn) "Prepend OPTION to each item in ITEMS, using PREPEND-FN. Prepend OPTION to each item in ITEMS. ITEMS is a list of strings to pass to the syntax checker. OPTION is the option, as string. PREPEND-FN is a function called to prepend OPTION to each item in ITEMS. It receives the option and a single item from ITEMS as argument, and must return a string or a list of strings with OPTION prepended to the item. If PREPEND-FN is nil or omitted, use `list'. Return a list of strings where OPTION is prepended to each item in ITEMS using PREPEND-FN. If PREPEND-FN returns a list, it is spliced into the resulting list." (unless (stringp option) (error "Option %S is not a string" option)) (unless prepend-fn (setq prepend-fn #'list)) (let ((prepend (lambda (item) (let ((result (funcall prepend-fn option item))) (cond ((and (listp result) (seq-every-p #'stringp result)) result) ((stringp result) (list result)) (t (error "Invalid result type for option: %S" result))))))) (apply #'append (seq-map prepend items)))) (defun flycheck-find-in-buffer (pattern) "Find PATTERN in the current buffer. Return the result of the first matching group of PATTERN, or nil, if PATTERN did not match." (save-excursion (save-restriction (widen) (goto-char (point-min)) (when (re-search-forward pattern nil 'no-error) (match-string-no-properties 1))))) (defun flycheck-buffer-empty-p (&optional buffer) "Check whether a BUFFER is empty, defaulting to the current one." (= (buffer-size buffer) 0)) (defun flycheck-buffer-nonempty-p (&optional buffer) "Check whether a BUFFER is nonempty, defaulting to the current one." (> (buffer-size buffer) 0)) (defun flycheck-ephemeral-buffer-p () "Determine whether the current buffer is an ephemeral buffer. See Info node `(elisp)Buffer Names' for information about ephemeral buffers." (string-prefix-p " " (buffer-name))) (defun flycheck-encrypted-buffer-p () "Determine whether the current buffer is an encrypted file. See Info node `(epa)Top' for Emacs' interface to encrypted files." ;; The EPA file handler sets this variable locally to remember the recipients ;; of the encrypted file for re-encryption. Hence, a local binding of this ;; variable is a good indication that the buffer is encrypted. I haven't ;; found any better indicator anyway. (local-variable-p 'epa-file-encrypt-to)) (defun flycheck-autoloads-file-p () "Determine whether the current buffer is an autoloads file. Autoloads are generated by package.el during installation." (string-suffix-p "-autoloads.el" (buffer-name))) (defun flycheck-in-user-emacs-directory-p (filename) "Whether FILENAME is in `user-emacs-directory'." (string-prefix-p (file-name-as-directory (flycheck--file-truename user-emacs-directory)) (flycheck--file-truename filename))) (defun flycheck-safe-delete (file-or-dir) "Safely delete FILE-OR-DIR." (ignore-errors (if (file-directory-p file-or-dir) (delete-directory file-or-dir 'recursive) (delete-file file-or-dir)))) (defun flycheck-safe-delete-temporaries () "Safely delete all temp files and directories of Flycheck. Safely delete all files and directories listed in `flycheck-temporaries' and set the variable's value to nil." (seq-do #'flycheck-safe-delete flycheck-temporaries) (setq flycheck-temporaries nil)) (defun flycheck-rx-file-name (form) "Translate the `(file-name)' FORM into a regular expression." (let ((body (or (cdr form) '((minimal-match (one-or-more not-newline)))))) (rx-to-string `(group-n 1 ,@body) t))) (defun flycheck-rx-message (form) "Translate the `(message)' FORM into a regular expression." (let ((body (or (cdr form) '((one-or-more not-newline))))) (rx-to-string `(group-n 4 ,@body) t))) (defun flycheck-rx-id (form) "Translate the `(id)' FORM into a regular expression." (rx-to-string `(group-n 5 ,@(cdr form)) t)) (defun flycheck-rx-to-string (form &optional no-group) "Like `rx-to-string' for FORM, but with special keywords: `line' matches the initial line number. `column' matches the initial column number. `end-line' matches the final line number. `end-column' matches the final column number (exclusive). `(file-name SEXP ...)' matches the file name. SEXP describes the file name. If no SEXP is given, use a default body of `(minimal-match (one-or-more not-newline))'. `(message SEXP ...)' matches the message. SEXP constitutes the body of the message. If no SEXP is given, use a default body of `(one-or-more not-newline)'. `(id SEXP ...)' matches an error ID. SEXP describes the ID. NO-GROUP is passed to `rx-to-string'. See `rx' for a complete list of all built-in `rx' forms." (let ((rx-constituents (append `((file-name flycheck-rx-file-name 0 nil) ;; group 1 (line . ,(rx (group-n 2 (one-or-more digit)))) (column . ,(rx (group-n 3 (one-or-more digit)))) (message flycheck-rx-message 0 nil) ;; group 4 (id flycheck-rx-id 0 nil) ;; group 5 (end-line . ,(rx (group-n 6 (one-or-more digit)))) (end-column . ,(rx (group-n 7 (one-or-more digit))))) rx-constituents nil))) (rx-to-string form no-group))) (defun flycheck-current-load-file () "Get the source file currently being loaded. Always return the name of the corresponding source file, never any byte-compiled file. Return nil, if the currently loaded file cannot be determined." (when-let* ((this-file (cond (load-in-progress load-file-name) ((bound-and-true-p byte-compile-current-file)) (t (buffer-file-name)))) ;; A best guess for the source file of a compiled library. Works ;; well in most cases, and especially for ELPA packages (source-file (concat (file-name-sans-extension this-file) ".el"))) (when (file-exists-p source-file) source-file))) (defun flycheck-module-root-directory (module &optional file-name) "Get the root directory for a MODULE in FILE-NAME. MODULE is a qualified module name, either a string with components separated by a dot, or as list of components. FILE-NAME is the name of the file or directory containing the module as string. When nil or omitted, defaults to the return value of function `buffer-file-name'. Return the root directory of the module, that is, the directory, from which FILE-NAME can be reached by descending directories along each part of MODULE. If the MODULE name does not match the directory hierarchy upwards from FILE-NAME, return the directory containing FILE-NAME. When FILE-NAME is nil, return `default-directory'." (let ((file-name (or file-name (buffer-file-name))) (module-components (if (stringp module) (split-string module (rx ".")) (copy-sequence module)))) (if (and module-components file-name) (let ((parts (nreverse module-components)) (base-directory (directory-file-name (file-name-sans-extension file-name)))) (while (and parts (string= (file-name-nondirectory base-directory) (car parts))) (pop parts) (setq base-directory (directory-file-name (file-name-directory base-directory)))) (file-name-as-directory base-directory)) (if file-name (file-name-directory file-name) (expand-file-name default-directory))))) (cl-defstruct (flycheck-line-cache (:constructor flycheck-line-cache-new)) "Cache structure used to speed up `flycheck-goto-line'." tick point line) (defvar-local flycheck--line-cache nil "Cache used to speed ip `flycheck-goto-line'.") (defsubst flycheck--init-line-cache () "Initialize or reinitialize `flycheck--line-cache'." (let ((tick (buffer-modified-tick))) (if flycheck--line-cache (unless (= (flycheck-line-cache-tick flycheck--line-cache) tick) (setf (flycheck-line-cache-tick flycheck--line-cache) tick (flycheck-line-cache-point flycheck--line-cache) 1 (flycheck-line-cache-line flycheck--line-cache) 1)) (setq-local flycheck--line-cache (flycheck-line-cache-new :tick tick :point 1 :line 1))))) (defun flycheck-goto-line (line) "Move point to beginning of line number LINE. This function assumes that the current buffer is not narrowed." (flycheck--init-line-cache) (goto-char (flycheck-line-cache-point flycheck--line-cache)) (let ((delta (- line (flycheck-line-cache-line flycheck--line-cache)))) (when (= 0 (forward-line delta)) (setf (flycheck-line-cache-point flycheck--line-cache) (point)) (setf (flycheck-line-cache-line flycheck--line-cache) line)))) (defun flycheck-line-column-to-position (line column) "Return the point closest to LINE, COLUMN on line LINE. COLUMN is one-based." (save-excursion (flycheck-goto-line line) (min (+ (point) (1- column)) (line-end-position)))) (defun flycheck-line-column-at-point () "Return the line and column number at point." (cons (line-number-at-pos) (1+ (- (point) (line-beginning-position))))) (defun flycheck-line-column-at-pos (pos) "Return the line and column number at position POS. COLUMN is one-based." (let ((inhibit-field-text-motion t)) (save-excursion (goto-char pos) (flycheck-line-column-at-point)))) ;;; Minibuffer tools (defvar flycheck-read-checker-history nil "`completing-read' history of `flycheck-read-checker'.") (defun flycheck-completing-read (prompt candidates default &optional history) "Read a value from the minibuffer. Use `flycheck-completing-read-function' to read input from the minibuffer with completion. Show PROMPT and read one of CANDIDATES, defaulting to DEFAULT. HISTORY is passed to `flycheck-completing-read-function'. Note that `flycheck-completing-read-function' may return an empty string instead of nil, even when \"\" isn't among the candidates. See `completing-read' for more details." (funcall flycheck-completing-read-function prompt candidates nil 'require-match nil history default)) (defun flycheck-read-checker (prompt &optional default property candidates) "Read a flycheck checker from minibuffer with PROMPT and DEFAULT. PROMPT is a string to show in the minibuffer as prompt. It should end with a single space. DEFAULT is a symbol denoting the default checker to use, if the user did not select any checker. PROPERTY is a symbol denoting a syntax checker property. If non-nil, only complete syntax checkers which have a non-nil value for PROPERTY. CANDIDATES is an optional list of all syntax checkers available for completion, defaulting to all defined checkers. If given, PROPERTY is ignored. Return the checker as symbol, or DEFAULT if no checker was chosen. If DEFAULT is nil and no checker was chosen, signal a `user-error' if the underlying completion system does not provide a default on its own." (when (and default (not (flycheck-valid-checker-p default))) (error "%S is no valid Flycheck checker" default)) (let* ((candidates (seq-map #'symbol-name (or candidates (flycheck-defined-checkers property)))) (default (and default (symbol-name default))) (input (flycheck-completing-read prompt candidates default 'flycheck-read-checker-history))) (when (string-empty-p input) (unless default (user-error "No syntax checker selected")) (setq input default)) (let ((checker (intern input))) (unless (flycheck-valid-checker-p checker) (error "%S is not a valid Flycheck syntax checker" checker)) checker))) (defun flycheck-read-error-level (prompt) "Read an error level from the user with PROMPT. Only offers level for which errors currently exist, in addition to the default levels." (let* ((levels (seq-map #'flycheck-error-level (flycheck-error-list-current-errors))) (levels-with-defaults (append '(info warning error) levels)) (uniq-levels (seq-uniq levels-with-defaults)) (level (flycheck-completing-read prompt uniq-levels nil))) (when (string-empty-p level) (setq level nil)) (and level (intern level)))) ;;; Checker API (defun flycheck-defined-checkers (&optional property) "Find all defined syntax checkers, optionally with PROPERTY. PROPERTY is a symbol. If given, only return syntax checkers with a non-nil value for PROPERTY. The returned list is sorted alphapetically by the symbol name of the syntax checkers." (let (defined-checkers) (mapatoms (lambda (symbol) (when (and (flycheck-valid-checker-p symbol) (or (null property) (flycheck-checker-get symbol property))) (push symbol defined-checkers)))) (sort defined-checkers #'string<))) (defun flycheck-registered-checker-p (checker) "Determine whether CHECKER is registered. A checker is registered if it is contained in `flycheck-checkers'." (and (flycheck-valid-checker-p checker) (memq checker flycheck-checkers))) (defun flycheck-disabled-checker-p (checker) "Determine whether CHECKER is disabled, manually or automatically." (or (flycheck-manually-disabled-checker-p checker) (flycheck-automatically-disabled-checker-p checker))) (defun flycheck-manually-disabled-checker-p (checker) "Determine whether CHECKER has been manually disabled. A checker has been manually disabled if it is contained in `flycheck-disabled-checkers'." (memq checker flycheck-disabled-checkers)) (defun flycheck-automatically-disabled-checker-p (checker) "Determine whether CHECKER has been automatically disabled. A checker has been automatically disabled if it is contained in `flycheck--automatically-disabled-checkers'." (memq checker flycheck--automatically-disabled-checkers)) ;;; Generic syntax checkers (defconst flycheck-generic-checker-version 2 "The internal version of generic syntax checker declarations. Flycheck will not use syntax checkers whose generic version is less than this constant.") (defsubst flycheck--checker-property-name (property) "Return the SYMBOL property for checker PROPERTY." (intern (concat "flycheck-" (symbol-name property)))) (defun flycheck-checker-get (checker property) "Get the value of CHECKER's PROPERTY." (get checker (flycheck--checker-property-name property))) (gv-define-setter flycheck-checker-get (value checker property) `(setf (get ,checker (flycheck--checker-property-name ,property)) ,value)) (defun flycheck-validate-next-checker (next &optional strict) "Validate NEXT checker. With STRICT non-nil, also check whether the syntax checker and the error level in NEXT are valid. Otherwise just check whether these are symbols. Signal an error if NEXT is not a valid entry for `:next-checkers'." (when (symbolp next) (setq next (cons t next))) (pcase next (`(,level . ,checker) (if strict (progn (unless (or (eq level t) (flycheck-error-level-p level)) (error "%S is not a valid Flycheck error level" level)) (unless (flycheck-valid-checker-p checker) (error "%s is not a valid Flycheck syntax checker" checker))) (unless (symbolp level) (error "Error level %S must be a symbol" level)) (unless (symbolp checker) (error "Checker %S must be a symbol" checker)))) (_ (error "%S must be a symbol or cons cell" next))) t) (defun flycheck-define-generic-checker (symbol docstring &rest properties) "Define SYMBOL as generic syntax checker. Any syntax checker defined with this macro is eligible for manual syntax checker selection with `flycheck-select-checker'. To make the new syntax checker available for automatic selection, it must be registered in `flycheck-checkers'. DOCSTRING is the documentation of the syntax checker, for `flycheck-describe-checker'. The following PROPERTIES constitute a generic syntax checker. Unless otherwise noted, all properties are mandatory. `:start FUNCTION' A function to start the syntax checker. FUNCTION shall take two arguments and return a context object if the checker is started successfully. Otherwise it shall signal an error. The first argument is the syntax checker being started. The second is a callback function to report state changes to Flycheck. The callback takes two arguments STATUS DATA, where STATUS is a symbol denoting the syntax checker status and DATA an optional argument with additional data for the status report. See `flycheck-report-buffer-checker-status' for more information about STATUS and DATA. FUNCTION may be synchronous or asynchronous, i.e. it may call the given callback either immediately, or at some later point (e.g. from a process sentinel). A syntax checker _must_ call CALLBACK at least once with a STATUS that finishes the current syntax checker. Otherwise Flycheck gets stuck at the current syntax check with this syntax checker. The context object returned by FUNCTION is passed to `:interrupt'. `:interrupt FUNCTION' A function to interrupt the syntax check. FUNCTION is called with the syntax checker and the context object returned by the `:start' function and shall try to interrupt the syntax check. The context may be nil, if the syntax check is interrupted before actually started. FUNCTION should handle this situation. If it cannot interrupt the syntax check, it may either signal an error or silently ignore the attempt to interrupt the syntax checker, depending on the severity of the situation. If interrupting the syntax check failed, Flycheck will let the syntax check continue, but ignore any status reports. Notably, it won't highlight any errors reported by the syntax check in the buffer. This property is optional. If omitted, Flycheck won't attempt to interrupt syntax checks with this syntax checker, and simply ignore their results. `:print-doc FUNCTION' A function to print additional documentation into the Help buffer of this checker. FUNCTION is called when creating the Help buffer for the syntax checker, with the syntax checker as single argument, after printing the name of the syntax checker and its modes and predicate, but before printing DOCSTRING. It may insert additional documentation into the current buffer. The call occurs within `with-help-window'. Hence `standard-output' points to the current buffer, so you may use `princ' and friends to add content. Also, the current buffer is put into Help mode afterwards, which automatically turns symbols into references, if possible. This property is optional. If omitted, no additional documentation is printed for this syntax checker. :verify FUNCTION A function to verify the checker for the current buffer. FUNCTION is called with the syntax checker as single argument, and shall return a list of `flycheck-verification-result' objects indicating whether the syntax checker could be used in the current buffer, and highlighting potential setup problems. This property is optional. If omitted, no additional verification occurs for this syntax checker. It is however absolutely recommended that you add a `:verify' function to your syntax checker, because it will help users to spot potential setup problems. `:modes MODES' A major mode symbol or a list thereof, denoting major modes to use this syntax checker in. This syntax checker will only be used in buffers whose `major-mode' is contained in MODES. If `:predicate' is also given the syntax checker will only be used in buffers for which the `:predicate' returns non-nil. `:predicate FUNCTION' A function to determine whether to use the syntax checker in the current buffer. FUNCTION is called without arguments and shall return non-nil if this syntax checker shall be used to check the current buffer. Otherwise it shall return nil. If this checker has a `:working-directory' FUNCTION is called with `default-directory' bound to the checker's working directory. FUNCTION is only called in matching major modes. This property is optional. `:enabled FUNCTION' A function to determine whether to use the syntax checker in the current buffer. This property behaves as `:predicate', except that it's only called the first time a syntax checker is to be used in a buffer. FUNCTION is called without arguments and shall return non-nil if this syntax checker shall be used to check the current buffer. Otherwise it shall return nil. If FUNCTION returns a non-nil value the checker is put in a whitelist in `flycheck--automatically-enabled-checkers' to prevent further invocations of `:enabled'. Otherwise it is disabled via `flycheck--automatically-disabled-checkers' to prevent any further use of it. If this checker has a `:working-directory' FUNCTION is called with `default-directory' bound to the checker's working directory. FUNCTION is only called in matching major modes. This property is optional. `:error-filter FUNCTION' A function to filter the errors returned by this checker. FUNCTION is called with the list of `flycheck-error' objects returned by the syntax checker and shall return another list of `flycheck-error' objects, which is considered the final result of this syntax checker. FUNCTION is free to add, remove or modify errors, whether in place or by copying. This property is optional. The default filter is `identity'. `:error-explainer FUNCTION' A function to return an explanation text for errors generated by this checker. FUNCTION is called with a `flycheck-error' object, in the buffer of that error. It shall return an explanation message for the error. The message can take any of the following forms: - A string, which will be displayed to the user - A function (likely a closure), which will be called with `standard-output' set to a `flycheck-explain-error-mode' buffer, and should write to it. - A cons `(url . ,URL), indicating that the explanation can be found online at URL. - nil if there is no explanation for this error. If URL is provided by the checker, and cannot be composed from other elements in the `flycheck-error' object, consider passing the URL via text properties: ;; During the error object creation (put-text-property 0 1 \\='explainer-url .url .check_id) ;; In the error-explainer FUNCTION (let ((id (flycheck-error-id err))) (and id `(url . ,(get-text-property 0 \\='explainer-url id)))) This property is optional. `:next-checkers NEXT-CHECKERS' A list denoting syntax checkers to apply after this syntax checker, in what we call \"chaining\" of syntax checkers. Each ITEM is a cons cell `(LEVEL . CHECKER)'. CHECKER is a syntax checker to run after this syntax checker. LEVEL is an error level. CHECKER will only be used if there are no current errors of at least LEVEL. LEVEL may also be t, in which case CHECKER is used regardless of the current errors. ITEM may also be a syntax checker symbol, which is equivalent to `(t . ITEM)'. Flycheck tries all items in order of declaration, and uses the first whose LEVEL matches and whose CHECKER is registered and can be used for the current buffer. This feature is typically used to apply more than one syntax checker to a buffer. For instance, you might first use a compiler to check a buffer for syntax and type errors, and then run a linting tool that checks for insecure code, or questionable style. This property is optional. If omitted, it defaults to the nil, i.e. no other syntax checkers are applied after this syntax checker. `:working-directory FUNCTION' The value of `default-directory' when invoking `:start'. FUNCTION is a function taking the syntax checker as sole argument. It shall return the absolute path to an existing directory to use as `default-directory' for `:start' or nil to fall back to the `default-directory' of the current buffer. This property is optional. If omitted, invoke `:start' from the `default-directory' of the buffer being checked. Signal an error, if any property has an invalid value." (declare (indent 1) (doc-string 2)) (let ((start (plist-get properties :start)) (interrupt (plist-get properties :interrupt)) (print-doc (plist-get properties :print-doc)) (modes (plist-get properties :modes)) (predicate (plist-get properties :predicate)) (verify (plist-get properties :verify)) (enabled (plist-get properties :enabled)) (filter (or (plist-get properties :error-filter) #'identity)) (explainer (plist-get properties :error-explainer)) (next-checkers (plist-get properties :next-checkers)) (file (flycheck-current-load-file)) (working-directory (plist-get properties :working-directory))) (unless (listp modes) (setq modes (list modes))) (unless (functionp start) (error ":start %S of syntax checker %s is not a function" start symbol)) (unless (or (null interrupt) (functionp interrupt)) (error ":interrupt %S of syntax checker %s is not a function" interrupt symbol)) (unless (or (null print-doc) (functionp print-doc)) (error ":print-doc %S of syntax checker %s is not a function" print-doc symbol)) (unless (or (null verify) (functionp verify)) (error ":verify %S of syntax checker %S is not a function" verify symbol)) (unless (or (null enabled) (functionp enabled)) (error ":enabled %S of syntax checker %S is not a function" enabled symbol)) (unless modes (error "Missing :modes in syntax checker %s" symbol)) (dolist (mode modes) (unless (symbolp mode) (error "Invalid :modes %s in syntax checker %s, %s must be a symbol" modes symbol mode))) (unless (or (null predicate) (functionp predicate)) (error ":predicate %S of syntax checker %s is not a function" predicate symbol)) (unless (functionp filter) (error ":error-filter %S of syntax checker %s is not a function" filter symbol)) (unless (or (null explainer) (functionp explainer)) (error ":error-explainer %S of syntax checker %S is not a function" explainer symbol)) (dolist (checker next-checkers) (flycheck-validate-next-checker checker)) (let ((real-predicate (and predicate (lambda () ;; Run predicate in the checker's default directory (let ((default-directory (flycheck-compute-working-directory symbol))) (funcall predicate))))) (real-enabled (lambda () (if (flycheck-valid-checker-p symbol) (or (null enabled) ;; Run enabled in the checker's default directory (let ((default-directory (flycheck-compute-working-directory symbol))) (funcall enabled))) (lwarn 'flycheck :warning "%S is no valid Flycheck syntax checker. Try to reinstall the package defining this syntax checker." symbol) nil)))) (pcase-dolist (`(,prop . ,value) `((start . ,start) (interrupt . ,interrupt) (print-doc . ,print-doc) (modes . ,modes) (predicate . ,real-predicate) (verify . ,verify) (enabled . ,real-enabled) (error-filter . ,filter) (error-explainer . ,explainer) (next-checkers . ,next-checkers) (documentation . ,docstring) (file . ,file) (working-directory . ,working-directory))) (setf (flycheck-checker-get symbol prop) value))) ;; Track the version, to avoid breakage if the internal format changes (setf (flycheck-checker-get symbol 'generic-checker-version) flycheck-generic-checker-version))) (defun flycheck-valid-checker-p (checker) "Check whether a CHECKER is valid. A valid checker is a symbol defined as syntax checker with `flycheck-define-checker'." (and (symbolp checker) (= (or (get checker 'flycheck-generic-checker-version) 0) flycheck-generic-checker-version))) (defun flycheck-checker-supports-major-mode-p (checker &optional mode) "Whether CHECKER supports the given major MODE. CHECKER is a syntax checker symbol and MODE a major mode symbol. Look at the `modes' property of CHECKER to determine whether CHECKER supports buffers in the given major MODE. MODE defaults to the value of `major-mode' if omitted or nil. Return non-nil if CHECKER supports MODE and nil otherwise." (let ((mode (or mode major-mode))) (memq mode (flycheck-checker-get checker 'modes)))) (define-obsolete-variable-alias 'flycheck-enabled-checkers 'flycheck--automatically-enabled-checkers "32") (defvar flycheck--automatically-enabled-checkers nil "Syntax checkers included in automatic selection. A list of Flycheck syntax checkers included in automatic selection for the current buffer.") (make-variable-buffer-local 'flycheck--automatically-enabled-checkers) (defun flycheck-may-enable-checker (checker) "Whether a generic CHECKER may be enabled for current buffer. Return non-nil if CHECKER may be used for the current buffer, and nil otherwise. The result of the `:enabled' check, if any, is cached." (and ;; May only enable valid checkers (flycheck-valid-checker-p checker) ;; Don't run the :enabled check if the checker is already disabled… (not (flycheck-disabled-checker-p checker)) (or ;; …or if we've already cached the result (memq checker flycheck--automatically-enabled-checkers) (let* ((enabled (flycheck-checker-get checker 'enabled)) (may-enable (or (null enabled) (funcall enabled)))) ;; Cache the result (if may-enable (cl-pushnew checker flycheck--automatically-enabled-checkers) (cl-pushnew checker flycheck--automatically-disabled-checkers)) may-enable)))) (defun flycheck-reset-enabled-checker (checker) "Reset the `:enabled' test of CHECKER. Forget that CHECKER has been enabled or automatically disabled from a previous `:enabled' test. The result of the `:enabled' test is cached in `flycheck-may-enable-checker': if you wish to test the `:enabled' predicate again, you must first reset its state using this function." (when (memq checker flycheck--automatically-disabled-checkers) (setq flycheck--automatically-disabled-checkers (remq checker flycheck--automatically-disabled-checkers))) (when (memq checker flycheck--automatically-enabled-checkers) (setq flycheck--automatically-enabled-checkers (remq checker flycheck--automatically-enabled-checkers))) (flycheck-buffer)) (defun flycheck-may-use-checker (checker) "Whether a generic CHECKER may be used. Return non-nil if CHECKER may be used for the current buffer, and nil otherwise." (let ((predicate (flycheck-checker-get checker 'predicate))) (and (flycheck-valid-checker-p checker) (flycheck-checker-supports-major-mode-p checker) (flycheck-may-enable-checker checker) (or (null predicate) (funcall predicate))))) (defun flycheck-may-use-next-checker (next-checker) "Determine whether NEXT-CHECKER may be used." (when (symbolp next-checker) (push t next-checker)) (let ((level (car next-checker)) (next-checker (cdr next-checker))) (and (or (eq level t) (flycheck-has-max-current-errors-p level)) (flycheck-registered-checker-p next-checker) (flycheck-may-use-checker next-checker)))) ;;; Help for generic syntax checkers (define-button-type 'help-flycheck-checker-def :supertype 'help-xref 'help-function #'flycheck-goto-checker-definition 'help-echo "mouse-1, RET: find Flycheck checker definition") (defconst flycheck-find-checker-regexp (rx line-start (zero-or-more (syntax whitespace)) "(" symbol-start (or "flycheck-define-checker" "flycheck-define-command-checker") symbol-end (eval (list 'regexp find-function-space-re)) (? "'") symbol-start "%s" symbol-end (or (syntax whitespace) line-end)) "Regular expression to find a checker definition.") (add-to-list 'find-function-regexp-alist '(flycheck-checker . flycheck-find-checker-regexp)) (defun flycheck-goto-checker-definition (checker file) "Go to to the definition of CHECKER in FILE." (let ((location (find-function-search-for-symbol checker 'flycheck-checker file))) (pop-to-buffer (car location)) (if (cdr location) (goto-char (cdr location)) (message "Unable to find checker location in file")))) (defun flycheck-checker-at-point () "Return the Flycheck checker found at or before point. Return nil if there is no checker." (let ((symbol (variable-at-point 'any-symbol))) (when (flycheck-valid-checker-p symbol) symbol))) (defun flycheck-describe-checker (checker) "Display the documentation of CHECKER. CHECKER is a checker symbol. Pop up a help buffer with the documentation of CHECKER." (interactive (let* ((enable-recursive-minibuffers t) (default (or (flycheck-checker-at-point) (ignore-errors (flycheck-get-checker-for-buffer)))) (prompt (if default (format "Describe syntax checker (default %s): " default) "Describe syntax checker: "))) (list (flycheck-read-checker prompt default)))) (unless (flycheck-valid-checker-p checker) (user-error "You didn't specify a Flycheck syntax checker")) (let ((filename (flycheck-checker-get checker 'file)) (modes (flycheck-checker-get checker 'modes)) (predicate (flycheck-checker-get checker 'predicate)) (print-doc (flycheck-checker-get checker 'print-doc)) (next-checkers (flycheck-checker-get checker 'next-checkers)) (help-xref-following ;; Ensure that we don't reuse buffers like `flycheck-verify-checker', ;; and that we don't error out if a `help-flycheck-checker-doc' button ;; is added outside of a documentation window. (and help-xref-following (eq major-mode 'help-mode)))) (help-setup-xref (list #'flycheck-describe-checker checker) (called-interactively-p 'interactive)) (save-excursion (with-help-window (help-buffer) (princ (format "%s is a Flycheck syntax checker" checker)) (when filename (princ (format " in `%s'" (file-name-nondirectory filename))) (with-current-buffer standard-output (save-excursion (re-search-backward "`\\([^`']+\\)'" nil t) (help-xref-button 1 'help-flycheck-checker-def checker filename)))) (princ ".\n\n") (let ((modes-start (with-current-buffer standard-output (point-max)))) ;; Track the start of the modes documentation, to properly re-fill ;; it later (princ " This syntax checker checks syntax in the major mode(s) ") (princ (string-join (seq-map (apply-partially #'format "`%s'") modes) ", ")) (when predicate (princ ", and uses a custom predicate")) (princ ".") (when next-checkers (princ " It runs the following checkers afterwards:")) (with-current-buffer standard-output (save-excursion (fill-region-as-paragraph modes-start (point-max)))) (princ "\n") ;; Print the list of next checkers (when next-checkers (princ "\n") (let ((beg-checker-list (with-current-buffer standard-output (point)))) (dolist (next-checker next-checkers) (if (symbolp next-checker) (princ (format " * `%s'\n" next-checker)) (princ (format " * `%s' (maximum level `%s')\n" (cdr next-checker) (car next-checker))))) ;; (with-current-buffer standard-output (save-excursion (while (re-search-backward "`\\([^`']+\\)'" beg-checker-list t) (let ((checker (intern-soft (match-string 1)))) (when (flycheck-valid-checker-p checker) (help-xref-button 1 'help-flycheck-checker-doc checker))))))))) ;; Call the custom print-doc function of the checker, if present (when print-doc (funcall print-doc checker)) ;; Ultimately, print the docstring (princ "\nDocumentation:\n") (princ (flycheck-checker-get checker 'documentation)))))) ;;; Syntax checker verification (cl-defstruct (flycheck-verification-result (:constructor flycheck-verification-result-new)) "Structure for storing a single verification result. Slots: `label' A label for this result, as string `message' A message for this result, as string `face' The face to use for the `message'. You can either use a face symbol, or a list of face symbols." label message face) (defun flycheck-verify-generic-checker (checker) "Verify a generic CHECKER in the current buffer. Return a list of `flycheck-verification-result' objects." (let (results (predicate (flycheck-checker-get checker 'predicate)) (enabled (flycheck-checker-get checker 'enabled)) (verify (flycheck-checker-get checker 'verify))) (when enabled (let ((result (funcall enabled))) (push (flycheck-verification-result-new :label (propertize "may enable" 'help-echo ":enable") :message (if result "yes" "no") :face (if result 'success '(bold warning))) results))) (when predicate (let ((result (funcall predicate))) (push (flycheck-verification-result-new :label (propertize "may run" 'help-echo ":predicate") :message (prin1-to-string (not (null result))) :face (if result 'success '(bold warning))) results))) (append (nreverse results) (and verify (funcall verify checker))))) (define-button-type 'help-flycheck-checker-doc :supertype 'help-xref 'help-function #'flycheck-describe-checker 'help-echo "mouse-1, RET: describe Flycheck checker") (define-button-type 'flycheck-button 'follow-link t 'action (lambda (pos) (apply (get-text-property pos 'flycheck-action) (get-text-property pos 'flycheck-data)) ;; Revert the verify-setup buffer since it is now stale (revert-buffer)) 'face 'flycheck-verify-select-checker) (define-button-type 'flycheck-checker-select :supertype 'flycheck-button 'flycheck-action (lambda (buffer checker) (with-current-buffer buffer (flycheck-select-checker checker))) 'help-echo "mouse-1, RET: select this checker") (define-button-type 'flycheck-checker-enable :supertype 'flycheck-button 'flycheck-action (lambda (buffer checker) (interactive) (with-current-buffer buffer (flycheck--toggle-checker checker t) (flycheck-buffer))) 'help-echo "mouse-1, RET: re-enable this checker in this buffer") (define-button-type 'flycheck-checker-reset-enabled :supertype 'flycheck-button 'flycheck-action (lambda (buffer checker) (with-current-buffer buffer (flycheck-reset-enabled-checker checker))) 'help-echo "mouse-1, RET: try to re-enable this checker") (defun flycheck--verify-princ-checker (checker buffer &optional with-mm with-select) "Print verification result of CHECKER for BUFFER. When WITH-MM is given and non-nil, also include the major mode into the verification results. When WITH-SELECT is non-nil, add a button to select this checker." (princ " ") (insert-button (symbol-name checker) 'type 'help-flycheck-checker-doc 'help-args (list checker)) (cond ((with-current-buffer buffer (flycheck-manually-disabled-checker-p checker)) (insert (propertize " (manually disabled) " 'face '(bold error))) (insert-text-button "enable" 'type 'flycheck-checker-enable 'flycheck-data (list buffer checker))) ((with-current-buffer buffer (flycheck-automatically-disabled-checker-p checker)) (insert (propertize " (automatically disabled) " 'face '(bold error))) (insert-text-button "reset" 'type 'flycheck-checker-reset-enabled 'flycheck-data (list buffer checker)))) (when (eq checker (buffer-local-value 'flycheck-checker buffer)) (insert (propertize " (explicitly selected)" 'face 'bold))) (when with-select (princ " ") (insert-text-button "select" 'type 'flycheck-checker-select 'flycheck-data (list buffer checker))) (princ "\n") (let ((results (with-current-buffer buffer (append (flycheck-verify-generic-checker checker) (flycheck--verify-next-checkers checker))))) (when with-mm (with-current-buffer buffer (let ((message-and-face (if (flycheck-checker-supports-major-mode-p checker) (cons (format "`%s' supported" major-mode) 'success) (cons (format "`%s' not supported" major-mode) 'error)))) (push (flycheck-verification-result-new :label "major mode" :message (car message-and-face) :face (cdr message-and-face)) results)))) (let* ((label-length (seq-max (mapcar (lambda (res) (length (flycheck-verification-result-label res))) results))) (message-column (+ 8 label-length))) (dolist (result results) (princ " - ") (princ (flycheck-verification-result-label result)) (princ ": ") (princ (make-string (- message-column (current-column)) ?\ )) (let ((message (flycheck-verification-result-message result)) (face (flycheck-verification-result-face result))) ;; If face is nil, using propertize erases the face already contained ;; by the message. We don't want that, since this would remove the ;; button face from the checker chain result. (insert (if face (propertize message 'face face) message))) (princ "\n")))) (princ "\n")) (defun flycheck--get-next-checker-symbol (next) "Get the checker symmbol of NEXT checker. NEXT should be either a cons (NEXT-CHECKER . LEVEL) or a symbol." (if (consp next) (cdr next) next)) (defun flycheck-get-next-checkers (checker) "Return the immediate next checkers of CHECKER. This is a list of checker symbols. The error levels of the `:next-checker' property are ignored." (mapcar #'flycheck--get-next-checker-symbol (flycheck-checker-get checker 'next-checkers))) (defun flycheck-all-next-checkers (checker) "Return all checkers that may follow CHECKER. Return the transitive closure of the next-checker relation. The return value is a list of checkers, not including CHECKER." (let ((next-checkers) (visited) (queue (list checker))) (while queue (let ((c (pop queue))) (push c visited) (dolist (n (flycheck-get-next-checkers c)) (push n next-checkers) (unless (memq n visited) (cl-pushnew n queue))))) (seq-uniq next-checkers))) (defun flycheck--verify-next-checkers (checker) "Return a verification result for the next checkers of CHECKER." (when-let (next (flycheck-get-next-checkers checker)) (list (flycheck-verification-result-new :label "next checkers" ;; We use `make-text-button' to preserve the button properties in the ;; string :message (mapconcat (lambda (checker) (make-text-button (symbol-name checker) nil 'type 'help-flycheck-checker-doc 'help-args (list checker))) next ", "))))) (defun flycheck--verify-print-header (desc buffer) "Print a title with DESC for BUFFER in the current buffer. DESC is an arbitrary string containing a description, and BUFFER is the buffer being verified. The name and the major mode mode of BUFFER are printed. DESC and information about BUFFER are printed in the current buffer." (princ desc) (insert (propertize (buffer-name buffer) 'face 'bold)) (princ " in ") (let ((mode (buffer-local-value 'major-mode buffer))) (insert-button (symbol-name mode) 'type 'help-function 'help-args (list mode))) (princ ":\n\n")) (defun flycheck--verify-print-footer (buffer) "Print a footer for BUFFER in the current buffer. BUFFER is the buffer being verified." (princ "Flycheck Mode is ") (let ((enabled (buffer-local-value 'flycheck-mode buffer))) (insert (propertize (if enabled "enabled" "disabled") 'face (if enabled 'success '(warning bold))))) (princ (with-current-buffer buffer ;; Use key binding state in the verified buffer to print the help. (substitute-command-keys ". Use \\[universal-argument] \\[flycheck-disable-checker] \ to enable disabled checkers."))) (save-excursion (let ((end (point))) (backward-paragraph) (fill-region-as-paragraph (point) end))) (princ "\n\n--------------------\n\n") (princ (format "Flycheck version: %s\n" (flycheck--pkg-version))) (princ (format "Emacs version: %s\n" emacs-version)) (princ (format "System: %s\n" system-configuration)) (princ (format "Window system: %S\n" window-system))) (define-derived-mode flycheck-verify-mode help-mode "Flycheck verification" "Major mode to display Flycheck verification results." ;; `help-mode-finish' will restore `buffer-read-only' (setq buffer-read-only nil)) (defun flycheck-verify-checker (checker) "Check whether a CHECKER can be used in this buffer. Show a buffer listing possible problems that prevent CHECKER from being used for the current buffer. Note: Do not use this function to check whether a syntax checker is applicable from Emacs Lisp code. Use `flycheck-may-use-checker' instead." (interactive (list (flycheck-read-checker "Checker to verify: "))) (unless (flycheck-valid-checker-p checker) (user-error "%s is not a syntax checker" checker)) ;; Save the buffer to make sure that all predicates are good ;; FIXME: this may be surprising to users, with unintended side-effects. (when (and (buffer-file-name) (buffer-modified-p)) (save-buffer)) (let ((buffer (current-buffer))) (with-help-window "*Flycheck checker*" (with-current-buffer standard-output (flycheck-verify-mode) (flycheck--verify-print-header "Syntax checker in buffer " buffer) (flycheck--verify-princ-checker checker buffer 'with-mm) (if (with-current-buffer buffer (flycheck-may-use-checker checker)) (insert (propertize "Flycheck can use this syntax checker for this buffer.\n" 'face 'success)) (insert (propertize "Flycheck cannot use this syntax checker for this buffer.\n" 'face 'error))) (insert "\n") (flycheck--verify-print-footer buffer))))) (defun flycheck-verify-setup () "Check whether Flycheck can be used in this buffer. Display a new buffer listing all syntax checkers that could be applicable in the current buffer. For each syntax checkers, possible problems are shown." (interactive) ;; Save to make sure checkers that only work on saved buffers will pass the ;; verification (when (and (buffer-file-name) (buffer-modified-p)) (save-buffer)) (let* ((buffer (current-buffer)) (first-checker (flycheck-get-checker-for-buffer)) (valid-checkers (remq first-checker (seq-filter #'flycheck-may-use-checker flycheck-checkers))) (valid-next-checkers (when first-checker (seq-intersection valid-checkers (flycheck-all-next-checkers first-checker)))) (valid-remaining (seq-difference valid-checkers valid-next-checkers)) (other-checkers (seq-difference (seq-filter #'flycheck-checker-supports-major-mode-p flycheck-checkers) (cons first-checker valid-checkers)))) ;; Print all applicable checkers for this buffer (with-help-window "*Flycheck checkers*" (with-current-buffer standard-output (flycheck-verify-mode) (flycheck--verify-print-header "Syntax checkers for buffer " buffer) (if first-checker (progn (princ "First checker to run:\n\n") (flycheck--verify-princ-checker first-checker buffer)) (insert (propertize "No checker to run in this buffer.\n\n" 'face '(bold error)))) (when valid-next-checkers (princ "Checkers that may run as part of the first checker's chain:\n\n") (dolist (checker valid-next-checkers) (flycheck--verify-princ-checker checker buffer))) (when valid-remaining (princ "Checkers that could run if selected:\n\n") (dolist (checker valid-remaining) (flycheck--verify-princ-checker checker buffer nil 'with-select))) (when other-checkers (princ "Checkers that are compatible with this mode, \ but will not run until properly configured:\n\n") (dolist (checker other-checkers) (flycheck--verify-princ-checker checker buffer))) ;; If we have no checkers at all, that's worth mentioning (unless (or first-checker valid-checkers other-checkers) (insert (propertize "No checkers are available for this buffer.\n\n" 'face '(bold error)))) (let ((unregistered-checkers (seq-difference (flycheck-defined-checkers) flycheck-checkers))) (when unregistered-checkers (insert (propertize "The following syntax checkers are not registered:\n" 'face '(bold warning))) (dolist (checker unregistered-checkers) (princ " - ") (princ checker) (princ "\n")) (princ "Try adding these syntax checkers to `flycheck-checkers'.\n\n"))) (flycheck--verify-print-footer buffer) (setq-local revert-buffer-function (lambda (_ignore-auto _noconfirm) (with-current-buffer buffer (flycheck-verify-setup)))))))) ;;; Predicates for generic syntax checkers (defun flycheck-buffer-saved-p (&optional buffer) "Determine whether BUFFER is saved to a file. BUFFER is the buffer to check. If omitted or nil, use the current buffer as BUFFER. Return non-nil if the BUFFER is backed by a file, and not modified, or nil otherwise." (let ((file-name (buffer-file-name buffer))) (and file-name (file-exists-p file-name) (not (buffer-modified-p buffer))))) ;;; Extending generic checkers (defun flycheck-remove-next-checker (checker next) "After CHECKER remove a NEXT checker. CHECKER is a syntax checker symbol, from which to remove NEXT checker. NEXT is a cons or a symbol, as documented in `flycheck-add-next-checker'." (unless (flycheck-valid-checker-p checker) (error "%s is not a valid syntax checker" checker)) (let* ((next-symbol (flycheck--get-next-checker-symbol next))) (setf (flycheck-checker-get checker 'next-checkers) (seq-remove (lambda (next) (eq (flycheck--get-next-checker-symbol next) next-symbol)) (flycheck-checker-get checker 'next-checkers))))) (defun flycheck-add-next-checker (checker next &optional append) "After CHECKER add a NEXT checker. CHECKER is a syntax checker symbol, to which to add NEXT checker. NEXT is a cons cell `(LEVEL . NEXT-CHECKER)'. NEXT-CHECKER is a symbol denoting the syntax checker to run after CHECKER. LEVEL is an error level. NEXT-CHECKER will only be used if there is no current error whose level is more severe than LEVEL. LEVEL may also be t, in which case NEXT-CHECKER is used regardless of the current errors. NEXT can also be a syntax checker symbol only, which is equivalent to `(t . NEXT)'. NEXT-CHECKER is prepended before other next checkers, unless APPEND is non-nil." (unless (flycheck-valid-checker-p checker) (error "%s is not a valid syntax checker" checker)) (flycheck-validate-next-checker next 'strict) (flycheck-remove-next-checker checker next) (let ((next-checkers (flycheck-checker-get checker 'next-checkers))) (setf (flycheck-checker-get checker 'next-checkers) (if append (append next-checkers (list next)) (cons next next-checkers))))) (defun flycheck-add-mode (checker mode) "To CHECKER add a new major MODE. CHECKER and MODE are symbols denoting a syntax checker and a major mode respectively. Add MODE to the `:modes' property of CHECKER, so that CHECKER will be used in buffers with MODE." (unless (flycheck-valid-checker-p checker) (error "%s is not a valid syntax checker" checker)) (unless (symbolp mode) (error "%s is not a symbol" mode)) (push mode (flycheck-checker-get checker 'modes))) ;;; Generic syntax checks (cl-defstruct (flycheck-syntax-check (:constructor flycheck-syntax-check-new)) "Structure for storing syntax check state. Slots: `buffer' The buffer being checked. `checker' The syntax checker being used. `context' The context object. `working-directory' Working directory for the syntax checker. Serve as a value for `default-directory' for a checker." buffer checker context working-directory) (defun flycheck-syntax-check-start (syntax-check callback) "Start a SYNTAX-CHECK with CALLBACK." (let ((checker (flycheck-syntax-check-checker syntax-check)) (default-directory (flycheck-syntax-check-working-directory syntax-check))) (setf (flycheck-syntax-check-context syntax-check) (funcall (flycheck-checker-get checker 'start) checker callback)))) (defun flycheck-syntax-check-interrupt (syntax-check) "Interrupt a SYNTAX-CHECK." (let* ((checker (flycheck-syntax-check-checker syntax-check)) (interrupt-fn (flycheck-checker-get checker 'interrupt)) (context (flycheck-syntax-check-context syntax-check))) (when interrupt-fn (funcall interrupt-fn checker context)))) ;;; Syntax checking mode (defvar flycheck-mode-map (let ((map (make-sparse-keymap))) (define-key map flycheck-keymap-prefix flycheck-command-map) ;; We place the menu under a custom menu key. Since this menu key is not ;; present in the menu of the global map, no top-level menu entry is added ;; to the global menu bar. However, it still appears on the mode line ;; lighter. (define-key map [menu-bar flycheck] flycheck-mode-menu-map) map) "Keymap of command `flycheck-mode'.") (defvar-local flycheck-old-next-error-function nil "Remember the old `next-error-function'.") (defconst flycheck-hooks-alist '( ;; Handle events that may start automatic syntax checks (after-save-hook . flycheck-handle-save) (after-change-functions . flycheck-handle-change) ;; Handle events that may triggered pending deferred checks (window-configuration-change-hook . flycheck-perform-deferred-syntax-check) (post-command-hook . flycheck-perform-deferred-syntax-check) ;; Teardown Flycheck whenever the buffer state is about to get lost, to ;; clean up temporary files and directories. (kill-buffer-hook . flycheck-teardown) (change-major-mode-hook . flycheck-teardown) (before-revert-hook . flycheck-teardown) ;; Update the error list if necessary (post-command-hook . flycheck-error-list-update-source) (post-command-hook . flycheck-error-list-highlight-errors) ;; Display errors. Show errors at point after commands (like movements) and ;; when Emacs gets focus. Cancel the display timer when Emacs looses focus ;; (as there's no need to display errors if the user can't see them), and ;; hide the error buffer (for large error messages) if necessary. Note that ;; the focus hooks only work on Emacs 24.4 and upwards, but since undefined ;; hooks are perfectly ok we don't need a version guard here. They'll just ;; not work silently. (post-command-hook . flycheck-display-error-at-point-soon) (focus-in-hook . flycheck-display-error-at-point-soon) (focus-out-hook . flycheck-cancel-error-display-error-at-point-timer) (post-command-hook . flycheck-hide-error-buffer) ;; Immediately show error popups when navigating to an error (next-error-hook . flycheck-display-error-at-point)) "Hooks which Flycheck needs to hook in. The `car' of each pair is a hook variable, the `cdr' a function to be added or removed from the hook variable if Flycheck mode is enabled and disabled respectively.") ;;;###autoload (define-minor-mode flycheck-mode "Flycheck is a minor mode for on-the-fly syntax checking. In `flycheck-mode' the buffer is automatically syntax-checked using the first suitable syntax checker from `flycheck-checkers'. Use `flycheck-select-checker' to select a checker for the current buffer manually. If you run into issues, use `\\[flycheck-verify-setup]' to get help. Flycheck supports many languages out of the box, and many additional ones are available on MELPA. Adding new ones is very easy. Complete documentation is available online at URL `https://www.flycheck.org/en/latest/'. Please report issues and request features at URL `https://github.com/flycheck/flycheck'. Flycheck displays its status in the mode line. In the default configuration, it looks like this: `FlyC' This buffer has not been checked yet. `FlyC*' Flycheck is running. Expect results soon! `FlyC:0' Last check resulted in no errors and no warnings. `FlyC:3|5' This buffer contains three errors and five warnings. Use `\\[flycheck-list-errors]' to see the list. `FlyC-' Flycheck doesn't have a checker for this buffer. You may also see the following icons: `FlyC!' The checker crashed. `FlyC.' The last syntax check was manually interrupted. `FlyC?' The checker did something unexpected, like exiting with 1 but returning no errors. The following keybindings are available in `flycheck-mode': \\{flycheck-mode-map} \(you can change the prefix by customizing `flycheck-keymap-prefix') If called interactively, enable Flycheck mode if ARG is positive, and disable it if ARG is zero or negative. If called from Lisp, also enable the mode if ARG is omitted or nil, and toggle it if ARG is ‘toggle’; disable the mode otherwise." :init-value nil :keymap flycheck-mode-map :lighter flycheck-mode-line :after-hook (flycheck-buffer-automatically 'mode-enabled 'force-deferred) (cond (flycheck-mode (flycheck-clear) (pcase-dolist (`(,hook . ,fn) (reverse flycheck-hooks-alist)) (add-hook hook fn nil 'local)) (setq flycheck-old-next-error-function (if flycheck-standard-error-navigation next-error-function :unset)) (when flycheck-standard-error-navigation (setq next-error-function #'flycheck-next-error-function)) ;; This hook must be added globally since otherwise we cannot ;; detect a change from a buffer where Flycheck is enabled to a ;; buffer where Flycheck is not enabled, and therefore cannot ;; notice that there has been any change when the user switches ;; back to the buffer where Flycheck is enabled. (add-hook 'buffer-list-update-hook #'flycheck-handle-buffer-switch)) (t (unless (eq flycheck-old-next-error-function :unset) (setq next-error-function flycheck-old-next-error-function)) (pcase-dolist (`(,hook . ,fn) flycheck-hooks-alist) (remove-hook hook fn 'local)) (flycheck-teardown)))) ;;; Syntax checker selection for the current buffer (defun flycheck-get-checker-for-buffer () "Find the checker for the current buffer. Use the selected checker for the current buffer, if any, otherwise search for the best checker from `flycheck-checkers'. Return checker if there is a checker for the current buffer, or nil otherwise." (if flycheck-checker (when (flycheck-may-use-checker flycheck-checker) flycheck-checker) (seq-find #'flycheck-may-use-checker flycheck-checkers))) (defun flycheck-get-next-checker-for-buffer (checker) "Get the checker to run after CHECKER for the current buffer." (let ((next (seq-find #'flycheck-may-use-next-checker (flycheck-checker-get checker 'next-checkers)))) (when next (if (symbolp next) next (cdr next))))) (defun flycheck-select-checker (checker) "Select CHECKER for the current buffer. CHECKER is a syntax checker symbol (see `flycheck-checkers') or nil. In the former case, use CHECKER for the current buffer, otherwise deselect the current syntax checker (if any) and use automatic checker selection via `flycheck-checkers'. If called interactively prompt for CHECKER. With prefix arg deselect the current syntax checker and enable automatic selection again. Set `flycheck-checker' to CHECKER and automatically start a new syntax check if the syntax checker changed. CHECKER will be used, even if it is not contained in `flycheck-checkers', or if it is disabled via `flycheck-disabled-checkers'." (interactive (if current-prefix-arg (list nil) (list (flycheck-read-checker "Select checker: " (flycheck-get-checker-for-buffer))))) (when (not (eq checker flycheck-checker)) (unless (or (not checker) (flycheck-may-use-checker checker)) (flycheck-verify-checker checker) (user-error "Can't use syntax checker %S in this buffer" checker)) (setq flycheck-checker checker) (when flycheck-mode (flycheck-buffer)))) (defun flycheck--toggle-checker (checker enable) "Enable or disable CHECKER for the current buffer. If ENABLE, re-enable CHECKER by removing it from the buffer-local value of `flycheck-disabled-checkers'. Otherwise, add the syntax checker to the buffer-local value of `flycheck-disabled-checkers'." (cond (enable ;; We must use `remq' instead of `delq', because we must _not_ modify the ;; list. Otherwise we could potentially modify the global default value, ;; in case the list is the global default. (when (memq checker flycheck-disabled-checkers) (setq flycheck-disabled-checkers (remq checker flycheck-disabled-checkers))) (when (memq checker flycheck--automatically-disabled-checkers) (setq flycheck--automatically-disabled-checkers (remq checker flycheck--automatically-disabled-checkers)))) (t (unless (memq checker flycheck-disabled-checkers) (push checker flycheck-disabled-checkers))))) (defun flycheck-disable-checker (checker &optional enable) "Interactively disable CHECKER for the current buffer. Prompt for a syntax checker to disable, and add the syntax checker to the buffer-local value of `flycheck-disabled-checkers'. With non-nil ENABLE or with prefix arg, prompt for a disabled syntax checker and re-enable it by removing it from the buffer-local value of `flycheck-disabled-checkers'." (declare (interactive-only "Directly set `flycheck-disabled-checkers' instead")) (interactive (let* ((enable current-prefix-arg) (candidates (if enable (append flycheck-disabled-checkers flycheck--automatically-disabled-checkers) flycheck-checkers)) (prompt (if enable "Enable syntax checker: " "Disable syntax checker: "))) (when (and enable (not candidates)) (user-error "No syntax checkers disabled in this buffer")) (list (flycheck-read-checker prompt nil nil candidates) enable))) (unless checker (user-error "No syntax checker given")) (flycheck--toggle-checker checker enable) (flycheck-buffer)) ;;; Syntax checks for the current buffer (defvar-local flycheck-current-syntax-check nil "The current syntax check in the this buffer.") (put 'flycheck-current-syntax-check 'permanent-local t) (defun flycheck-start-current-syntax-check (checker) "Start a syntax check in the current buffer with CHECKER. Set `flycheck-current-syntax-check' accordingly." ;; Allocate the current syntax check *before* starting it. This allows for ;; synchronous checks, which call the status callback immediately in their ;; start function. (let* ((check (flycheck-syntax-check-new :buffer (current-buffer) :checker checker :context nil :working-directory (flycheck-compute-working-directory checker))) (callback (flycheck-buffer-status-callback check))) (setq flycheck-current-syntax-check check) (flycheck-report-status 'running) (flycheck-syntax-check-start check callback))) (defun flycheck-running-p () "Determine whether a syntax check is running in the current buffer." (not (null flycheck-current-syntax-check))) (defun flycheck-stop () "Stop any ongoing syntax check in the current buffer." (when (flycheck-running-p) (flycheck-syntax-check-interrupt flycheck-current-syntax-check) ;; Remove the current syntax check, to reset Flycheck into a non-running ;; state, and to make `flycheck-report-buffer-checker-status' ignore any ;; status reports from the current syntax check. (setq flycheck-current-syntax-check nil) (flycheck-report-status 'interrupted))) (defun flycheck-buffer-status-callback (syntax-check) "Create a status callback for SYNTAX-CHECK in the current buffer." (lambda (&rest args) (apply #'flycheck-report-buffer-checker-status syntax-check args))) (defun flycheck-buffer () "Start checking syntax in the current buffer. Get a syntax checker for the current buffer with `flycheck-get-checker-for-buffer', and start it." (interactive) (flycheck-clean-deferred-check) (if flycheck-mode (unless (flycheck-running-p) ;; Clear error list and mark all overlays for deletion. We do not ;; delete all overlays immediately to avoid excessive re-displays and ;; flickering, if the same errors gets highlighted again after the check ;; completed. (run-hooks 'flycheck-before-syntax-check-hook) (flycheck-clear-errors) (flycheck-mark-all-overlays-for-deletion) (condition-case err (let* ((checker (flycheck-get-checker-for-buffer))) (if checker (flycheck-start-current-syntax-check checker) (flycheck-clear) (flycheck-report-status 'no-checker))) (error (flycheck-report-failed-syntax-check) (signal (car err) (cdr err))))) (user-error "Flycheck mode disabled"))) (defun flycheck-report-buffer-checker-status (syntax-check status &optional data) "In BUFFER, report a SYNTAX-CHECK STATUS with DATA. SYNTAX-CHECK is the `flycheck-syntax-check' which reported STATUS. STATUS denotes the status of CHECKER, with an optional DATA. STATUS may be one of the following symbols: `errored' The syntax checker has errored. DATA is an optional error message. This report finishes the current syntax check. `interrupted' The syntax checker was interrupted. DATA is ignored. This report finishes the current syntax check. `finished' The syntax checker has finished with a proper error report for the current buffer. DATA is the (potentially empty) list of `flycheck-error' objects reported by the syntax check. This report finishes the current syntax check. `suspicious' The syntax checker encountered a suspicious state, which the user needs to be informed about. DATA is an optional message. A syntax checker _must_ report a status at least once with any symbol that finishes the current syntax checker. Otherwise Flycheck gets stuck with the current syntax check. If CHECKER is not the currently used syntax checker in `flycheck-current-syntax-check', the status report is largely ignored. Notably, any errors reported by the checker are discarded." (let ((buffer (flycheck-syntax-check-buffer syntax-check))) ;; Ignore the status report if the buffer is gone, or if this syntax check ;; isn't the current one in buffer (which can happen if this is an old ;; report of an interrupted syntax check, and a new syntax check was started ;; since this check was interrupted) (when (and (buffer-live-p buffer) (eq syntax-check (buffer-local-value 'flycheck-current-syntax-check buffer))) (with-current-buffer buffer (let ((checker (flycheck-syntax-check-checker syntax-check))) (pcase status ((or `errored `interrupted) (flycheck-report-failed-syntax-check status) (when (eq status 'errored) ;; In case of error, show the error message (message "Error from syntax checker %s: %s" checker (or data "UNKNOWN!")))) (`suspicious (when flycheck-mode (message "Suspicious state from syntax checker %s: %s" checker (or data "UNKNOWN!"))) (flycheck-report-status 'suspicious)) (`finished (when flycheck-mode ;; Only report errors from the checker if Flycheck Mode is ;; still enabled. (flycheck-finish-current-syntax-check data (flycheck-syntax-check-working-directory syntax-check)))) (_ (error "Unknown status %s from syntax checker %s" status checker)))))))) (defun flycheck-finish-current-syntax-check (errors working-dir) "Finish the current syntax-check in the current buffer with ERRORS. ERRORS is a list of `flycheck-error' objects reported by the current syntax check in `flycheck-current-syntax-check'. Report all ERRORS and potentially start any next syntax checkers. If the current syntax checker reported excessive errors, it is disabled via `flycheck-disable-excessive-checker' for subsequent syntax checks. Relative file names in ERRORS will be expanded relative to WORKING-DIR." (let* ((syntax-check flycheck-current-syntax-check) (checker (flycheck-syntax-check-checker syntax-check)) (errors (flycheck-relevant-errors (flycheck-fill-and-expand-error-file-names (flycheck-filter-errors (flycheck-assert-error-list-p errors) checker) working-dir)))) (unless (flycheck-disable-excessive-checker checker errors) (flycheck-report-current-errors errors)) (let ((next-checker (flycheck-get-next-checker-for-buffer checker))) (if next-checker (flycheck-start-current-syntax-check next-checker) (setq flycheck-current-syntax-check nil) (flycheck-report-status 'finished) ;; Delete overlays only after the very last checker has run, to avoid ;; flickering on intermediate re-displays (flycheck-delete-marked-overlays) (flycheck-error-list-refresh) (run-hooks 'flycheck-after-syntax-check-hook) (when (and flycheck-auto-display-errors-after-checking (eq (current-buffer) (window-buffer))) (flycheck-display-error-at-point)) ;; Immediately try to run any pending deferred syntax check, which ;; were triggered by intermediate automatic check event, to make sure ;; that we quickly refine outdated error information (flycheck-perform-deferred-syntax-check))))) (defun flycheck-disable-excessive-checker (checker errors) "Disable CHECKER if it reported excessive ERRORS. If ERRORS has more items than `flycheck-checker-error-threshold', add CHECKER to `flycheck--automatically-disabled-checkers', and show a warning. Return t when CHECKER was disabled, or nil otherwise." (when (and flycheck-checker-error-threshold (> (length errors) flycheck-checker-error-threshold)) ;; Disable CHECKER for this buffer ;; (`flycheck--automatically-disabled-checkers' is a local variable). (lwarn '(flycheck syntax-checker) :warning (substitute-command-keys "Syntax checker %s reported too many errors (%s) and is disabled. Use `\\[customize-variable] RET flycheck-checker-error-threshold' to change the threshold or `\\[universal-argument] \ \\[flycheck-disable-checker]' to re-enable the checker.") checker (length errors)) (push checker flycheck--automatically-disabled-checkers) t)) (defun flycheck-clear (&optional shall-interrupt) "Clear all errors in the current buffer. With prefix arg or SHALL-INTERRUPT non-nil, also interrupt the current syntax check." (interactive "P") (when shall-interrupt (flycheck-stop)) (flycheck-delete-all-overlays) (flycheck-clear-errors) (flycheck-clear-displayed-error-messages) (flycheck-error-list-refresh) (flycheck-hide-error-buffer)) (defun flycheck--empty-variables () "Empty variables used by Flycheck." (kill-local-variable 'flycheck--file-truename-cache) (kill-local-variable 'flycheck--idle-trigger-timer) (kill-local-variable 'flycheck--idle-trigger-conditions) (kill-local-variable 'flycheck--last-error-display-tick)) (defun flycheck-teardown (&optional ignore-global) "Teardown Flycheck in the current buffer. Completely clear the whole Flycheck state. Remove overlays, kill running checks, and empty all variables used by Flycheck. Unless optional argument IGNORE-GLOBAL is non-nil, check to see if no more Flycheck buffers remain (aside from the current buffer), and if so then clean up global hooks." (flycheck-safe-delete-temporaries) (flycheck-stop) (flycheck-clean-deferred-check) (flycheck-clear) (flycheck-cancel-error-display-error-at-point-timer) (flycheck--clear-idle-trigger-timer) (flycheck--empty-variables) (unless (or ignore-global (seq-some (lambda (buf) (and (not (equal buf (current-buffer))) (buffer-local-value 'flycheck-mode buf))) (buffer-list))) (flycheck-global-teardown 'ignore-local))) ;;; Automatic syntax checking in a buffer (defun flycheck-may-check-automatically (&rest conditions) "Determine whether the buffer may be checked under one of CONDITIONS. Read-only buffers may never be checked automatically. If CONDITIONS are given, determine whether syntax may be checked under at least one of them, according to `flycheck-check-syntax-automatically'." (and (not (or buffer-read-only (flycheck-ephemeral-buffer-p))) (file-exists-p default-directory) (or (not conditions) (seq-some (lambda (condition) (memq condition flycheck-check-syntax-automatically)) conditions)))) (defvar-local flycheck--idle-trigger-timer nil "Timer used to trigger a syntax check after an idle delay.") (defvar-local flycheck--idle-trigger-conditions nil "List of conditions under which an idle syntax check will be triggered. This will be some subset of the allowable values for `flycheck-check-syntax-automatically'. For example, if the user switches to a buffer and then makes an edit, this list will have the values `idle-change' and `idle-buffer-switch' in it, at least until the idle timer expires.") (defun flycheck-buffer-automatically (&optional condition force-deferred) "Automatically check syntax at CONDITION. Syntax is not checked if `flycheck-may-check-automatically' returns nil for CONDITION. (CONDITION may be a single condition or a list of them.) The syntax check is deferred if FORCE-DEFERRED is non-nil, or if `flycheck-must-defer-check' returns t." (when (and flycheck-mode (if (listp condition) (apply #'flycheck-may-check-automatically condition) (flycheck-may-check-automatically condition))) (flycheck--clear-idle-trigger-timer) (setq flycheck--idle-trigger-conditions nil) (if (or force-deferred (flycheck-must-defer-check)) (flycheck-buffer-deferred) (with-demoted-errors "Error while checking syntax automatically: %S" (flycheck-buffer))))) (defun flycheck--clear-idle-trigger-timer () "Clear the idle trigger timer." (when flycheck--idle-trigger-timer (cancel-timer flycheck--idle-trigger-timer) (setq flycheck--idle-trigger-timer nil))) (defun flycheck--handle-idle-trigger (buffer) "Run a syntax check in BUFFER if appropriate. This function is called by `flycheck--idle-trigger-timer'." (let ((current-buffer (current-buffer))) (when (buffer-live-p buffer) (with-current-buffer buffer (unless (or flycheck-buffer-switch-check-intermediate-buffers (eq buffer current-buffer)) (setq flycheck--idle-trigger-conditions (delq 'idle-buffer-switch flycheck--idle-trigger-conditions))) (when flycheck--idle-trigger-conditions (flycheck-buffer-automatically flycheck--idle-trigger-conditions) (setq flycheck--idle-trigger-conditions nil)))))) (defun flycheck-handle-change (beg end _len) "Handle a buffer change between BEG and END. BEG and END mark the beginning and end of the change text. _LEN is ignored. Start a syntax check if a new line has been inserted into the buffer." ;; Save and restore the match data, as recommended in (elisp)Change Hooks (save-match-data (when flycheck-mode (if (string-match-p (rx "\n") (buffer-substring beg end)) (flycheck-buffer-automatically 'new-line 'force-deferred) (when (memq 'idle-change flycheck-check-syntax-automatically) (flycheck--clear-idle-trigger-timer) (cl-pushnew 'idle-change flycheck--idle-trigger-conditions) (setq flycheck--idle-trigger-timer (run-at-time flycheck-idle-change-delay nil #'flycheck--handle-idle-trigger (current-buffer)))))))) (defvar flycheck--last-buffer (current-buffer) "The current buffer or the buffer that was previously current. This is usually equal to the current buffer, unless the user just switched buffers. After a buffer switch, it is the previous buffer.") (defun flycheck-handle-buffer-switch () "Handle a possible switch to another buffer. If a buffer switch actually happened, schedule a syntax check." ;; Switching buffers here is weird, but unfortunately necessary. It ;; turns out that `with-temp-buffer' triggers ;; `buffer-list-update-hook' twice, and the value of ;; `current-buffer' is bogus in one of those triggers (the one just ;; after the temp buffer is killed). If we rely on the bogus value, ;; Flycheck will think that the user is switching back and forth ;; between different buffers during the `with-temp-buffer' call ;; (note: two different normal buffers, not the current buffer and ;; the temp buffer!), and that would trigger spurious syntax checks. ;; It seems that reading (window-buffer) gets us the correct current ;; buffer in all important real-life situations (although it doesn't ;; necessarily catch uses of `set-buffer'). (with-current-buffer (window-buffer) (unless (or (equal flycheck--last-buffer (current-buffer)) ;; Don't bother keeping track of changes to and from ;; the minibuffer, as they will never require us to ;; run a syntax check. (minibufferp)) (setq flycheck--last-buffer (current-buffer)) (when (and flycheck-mode (memq 'idle-buffer-switch flycheck-check-syntax-automatically)) (flycheck--clear-idle-trigger-timer) (cl-pushnew 'idle-buffer-switch flycheck--idle-trigger-conditions) (setq flycheck--idle-trigger-timer (run-at-time flycheck-idle-buffer-switch-delay nil #'flycheck--handle-idle-trigger (current-buffer))))))) (defun flycheck-handle-save () "Handle a save of the buffer." (flycheck-buffer-automatically 'save)) ;;; Deferred syntax checking (defvar-local flycheck-deferred-syntax-check nil "If non-nil, a deferred syntax check is pending.") (defun flycheck-must-defer-check () "Determine whether the syntax check has to be deferred. A check has to be deferred if the buffer is not visible, or if the buffer is currently being reverted. Return t if the check is to be deferred, or nil otherwise." (or (not (get-buffer-window)) ;; We defer the syntax check if Flycheck is already running, to ;; immediately start a new syntax check after the current one finished, ;; because the result of the current check will most likely be outdated by ;; the time it is finished. (flycheck-running-p) ;; We must defer checks while a buffer is being reverted, to avoid race ;; conditions while the buffer contents are being restored. revert-buffer-in-progress-p)) (defun flycheck-deferred-check-p () "Determine whether the current buffer has a deferred check. Return t if so, or nil otherwise." flycheck-deferred-syntax-check) (defun flycheck-buffer-deferred () "Defer syntax check for the current buffer." (setq flycheck-deferred-syntax-check t)) (defun flycheck-clean-deferred-check () "Clean a deferred syntax checking state." (setq flycheck-deferred-syntax-check nil)) (defun flycheck-perform-deferred-syntax-check () "Perform the deferred syntax check." (when (flycheck-deferred-check-p) (flycheck-clean-deferred-check) (flycheck-buffer-automatically))) ;;; Syntax checking in all buffers (defun flycheck-may-enable-mode () "Determine whether Flycheck mode may be enabled. Flycheck mode is not enabled for - the minibuffer, - `fundamental-mode' - major modes whose `mode-class' property is `special', - ephemeral buffers (see `flycheck-ephemeral-buffer-p'), - encrypted buffers (see `flycheck-encrypted-buffer-p'), - remote files (see `file-remote-p'), - and major modes excluded by `flycheck-global-modes'. Return non-nil if Flycheck mode may be enabled, and nil otherwise." (and (pcase flycheck-global-modes ;; Whether `major-mode' is disallowed by `flycheck-global-modes' (`t t) (`(not . ,modes) (not (memq major-mode modes))) (modes (memq major-mode modes))) (not (or (minibufferp) (eq major-mode 'fundamental-mode) (eq (get major-mode 'mode-class) 'special) (flycheck-ephemeral-buffer-p) (flycheck-encrypted-buffer-p) (and (buffer-file-name) (file-remote-p (buffer-file-name) 'method)))))) (defun flycheck-mode-on-safe () "Enable command `flycheck-mode' if it is safe to do so. Command `flycheck-mode' is only enabled if `flycheck-may-enable-mode' returns a non-nil result." (when (flycheck-may-enable-mode) (flycheck-mode))) ;;;###autoload (define-globalized-minor-mode global-flycheck-mode flycheck-mode flycheck-mode-on-safe :init-value nil :group 'flycheck) (defun flycheck-global-teardown (&optional ignore-local) "Teardown Flycheck in all buffers. Completely clear the whole Flycheck state in all buffers, stop all running checks, remove all temporary files, and empty all variables of Flycheck. Also remove global hooks. (If optional argument IGNORE-LOCAL is non-nil, then only do this and skip per-buffer teardown.)" (unless ignore-local (dolist (buffer (buffer-list)) (when (buffer-live-p buffer) (with-current-buffer buffer (when flycheck-mode (flycheck-teardown 'ignore-global)))))) (remove-hook 'buffer-list-update-hook #'flycheck-handle-buffer-switch)) ;; Clean up the entire state of Flycheck when Emacs is killed, to get rid of any ;; pending temporary files. (add-hook 'kill-emacs-hook #'flycheck-global-teardown) ;;; Errors from syntax checks (cl-defstruct (flycheck-error (:constructor nil) (:constructor flycheck-error-new (&key line column end-line end-column buffer checker filename message level id group &aux (-end-line end-line) (-end-column end-column))) (:constructor flycheck-error-new-at (line column &optional level message &key end-line end-column checker id group (filename (buffer-file-name)) (buffer (current-buffer)) &aux (-end-line end-line) (-end-column end-column))) (:constructor flycheck-error-new-at-pos (pos &optional level message &key end-pos checker id group (filename (buffer-file-name)) (buffer (current-buffer)) &aux ((line . column) (if pos (flycheck-line-column-at-pos pos) '(nil . nil))) ((-end-line . -end-column) (if end-pos (flycheck-line-column-at-pos end-pos) '(nil . nil)))))) "Structure representing an error reported by a syntax checker. Slots: `buffer' The buffer that the error was reported for, as buffer object. `checker' The syntax checker which reported this error, as symbol. `filename' The file name the error refers to, as string. `line' The line on which the error starts, as number. `column' (optional) The column at which the error starts, as number. For compatibility with external tools and unlike Emacs itself (e.g. in Compile Mode) Flycheck uses _1-based_ columns: The first character on a line is column 1. Occasionally some tools try to proactively adapt to Emacs and emit 0-based columns automatically. In these cases, the columns must be adjusted for Flycheck, see `flycheck-increment-error-columns'. If nil, the whole line is highlighted. `end-line' (optional) The line on which the error ends. If nil, this is computed according to `flycheck-highlighting-mode'. `end-column' The column at which the error ends. If nil, this is computed according to `flycheck-highlighting-mode'. Error intervals are right-open: the end-column points to the first character not included in the error. For example, 1:1 is an empty range. and in \"line-number-at-pos\", the range 6:12 covers the word \"number\". `message' (optional) The error message as a string, if any. `level' The error level, as either `info', `warning' or `error'. `id' (optional) An ID identifying the kind of error. `group' (optional) A symbol identifying the group the error belongs to. Some tools will emit multiple errors that relate to the same issue (e.g., lifetime errors in Rust). All related errors collected by a checker should have the same `group` value, in order to be able to present them to the user. See `flycheck-related-errors`." buffer checker filename line column message level id group ;; The fields below are at the end of the record to preserve backwards ;; compatibility; see https://github.com/flycheck/flycheck/pull/1400 and ;; https://lists.gnu.org/archive/html/emacs-devel/2018-07/msg00436.html -end-line -end-column) ;; These accessors are defined for backwards compatibility ;; FIXME: Clean up once package.el learns how to recompile dependencies. (defun flycheck-error-end-line (err) "Return the end line of a Flycheck error ERR." (condition-case nil (flycheck-error--end-line err) (args-out-of-range nil))) (defun flycheck-error-end-column (err) "Return the end column of a Flycheck error ERR." (condition-case nil (flycheck-error--end-column err) (args-out-of-range nil))) (defun flycheck-error--set-end-line (err line) "Set the end line of a Flycheck error ERR to LINE." (condition-case nil (setf (flycheck-error--end-line err) line) (args-out-of-range nil))) (defun flycheck-error--set-end-column (err column) "Set the end column of a Flycheck error ERR to COLUMN." (condition-case nil (setf (flycheck-error--end-column err) column) (args-out-of-range nil))) (gv-define-simple-setter flycheck-error-end-line flycheck-error--set-end-line) (gv-define-simple-setter flycheck-error-end-column flycheck-error--set-end-column) (defmacro flycheck-error-with-buffer (err &rest forms) "Switch to the buffer of ERR and evaluate FORMS. If the buffer of ERR is not live, FORMS are not evaluated." (declare (indent 1) (debug t)) `(when (buffer-live-p (flycheck-error-buffer ,err)) (with-current-buffer (flycheck-error-buffer ,err) ,@forms))) (defun flycheck--exact-region (err) "Get the region of ERR, if ERR specifies a range. Return a cons cell `(BEG . END)'. If the input range is empty, it is expanded to cover at least one character so that END is always greater than BEG. If ERR doesn't specify an end-column return nil." (if-let* ((line (flycheck-error-line err)) (column (flycheck-error-column err)) (end-line (or (flycheck-error-end-line err) line)) (end-column (flycheck-error-end-column err))) ;; Ignoring fields speeds up calls to `line-end-position'. (let* ((inhibit-field-text-motion t) (beg (flycheck-line-column-to-position line column)) (end (flycheck-line-column-to-position end-line end-column))) (cond ((< beg end) (cons beg end)) ((= end (point-max)) (cons (1- end) end)) (t (cons end (1+ end))))))) (defun flycheck--line-region (pos) "Get the line region of position POS. Return a cons cell `(BEG . END)' where BEG is the first non-whitespace character on the line ERR refers to, and END the end of the line." (save-excursion (goto-char pos) (forward-line 0) (let ((bol (point)) (end (line-end-position))) ;; Move to the beginning of this line's indentation, similar to ;; `back-to-indentation' (skip-syntax-forward " " end) (backward-prefix-chars) ;; If the current line is blank, highlight it in full; if it's ;; empty, include the previous line break character(s) to have ;; any region at all (when called with 0, `line-end-position' ;; gives us the end of the previous line). (cons (if (eolp) (if (= bol end) (line-end-position 0) bol) (point)) end)))) (defun flycheck--column-region (pos) "Get the column region of position POS. Return a cons cell `(BEG . END)' where BEG is the character before the column, and END the actual column." (save-excursion (goto-char pos) ;; (eobp): No enough lines in the buffer (if (eobp) (cons (1- (point-max)) (point-max)) (cons pos (1+ pos))))) (defun flycheck-bounds-of-thing-at-point (thing pos) "Get the region of THING at position POS. THING is a understood by `thing-at-point'. Return a cons cell `(BEG . END)' where BEG is the beginning of the THING at the column, and END the end of the THING." (save-excursion (goto-char pos) (bounds-of-thing-at-point thing))) (defun flycheck--approximate-region (err mode) "Compute the region of ERR based on MODE and ERR's line and column." ;; Ignoring fields speeds up calls to `line-end-position'. (let* ((inhibit-field-text-motion t) (line (flycheck-error-line err)) (column (flycheck-error-column err)) (beg (flycheck-line-column-to-position line (or column 1)))) (if (or (null column) (eq mode 'lines)) (flycheck--line-region beg) (or (pcase mode (`symbols ;; Ensure that we're on a word or symbol. See ;; https://github.com/flycheck/flycheck/issues/1519 (and (<= (point-min) beg) (< beg (point-max)) (memq (char-syntax (char-after beg)) '(?w ?_)) (flycheck-bounds-of-thing-at-point 'symbol beg))) (`sexps (flycheck-bounds-of-thing-at-point 'sexp beg))) (flycheck--column-region beg))))) (defun flycheck-error-region-for-mode (err mode) "Get the region of ERR for the highlighting MODE. ERR is a Flycheck error. If its position is fully specified, use that to compute a region; otherwise, use MODE, as documented in `flycheck-highlighting-mode'. If MODE is nil, signal an error." (flycheck-error-with-buffer err (save-restriction (widen) (or (flycheck--exact-region err) (flycheck--approximate-region err mode))))) (defun flycheck-error-pos (err) "Get the buffer position of ERR. ERR is a Flycheck error whose position to get. The error position is the error column, or the first non-whitespace character of the error line, if ERR has no error column." (car (flycheck-error-region-for-mode err flycheck-highlighting-mode))) (defun flycheck-error-format-snippet (err &optional max-length) "Extract the text that ERR refers to from the buffer. Newlines and blanks are replaced by single spaces. If ERR doesn't include an end-position, return nil. MAX-LENGTH is how many characters to read from the buffer, at most. It defaults to 20." (flycheck-error-with-buffer err (save-restriction (widen) (pcase (flycheck--exact-region err) (`(,beg . ,end) (truncate-string-to-width (replace-regexp-in-string "\\s-+" " " (buffer-substring beg (min end (point-max)))) (or max-length 20) nil nil t)))))) (defun flycheck-error-format-message-and-id (err &optional include-snippet) "Format the message and id of ERR as human-readable string. If INCLUDE-SNIPPET is non-nil, prepend the message with a snippet of the text that the error applies to (such text can only be determined if the error contains a full span, not just a beginning position)." (let* ((id (flycheck-error-id err)) (fname (flycheck-error-filename err)) (other-file-p (and fname (not (equal fname (buffer-file-name)))))) (concat (and other-file-p (format "In %S:\n" (file-relative-name fname))) (and include-snippet (when-let* ((snippet (flycheck-error-format-snippet err))) (format-message "`%s': " snippet))) (or (flycheck-error-message err) (format "Unknown %S" (flycheck-error-level err))) (and id (format " [%s]" id))))) (defun flycheck-error-format-position (err) "Format the position of ERR as a human-readable string." (let ((line (flycheck-error-line err)) (column (flycheck-error-column err)) (end-line (flycheck-error-end-line err)) (end-column (flycheck-error-end-column err))) (if (and line column) (if (or (null end-line) (equal line end-line)) (if (or (null end-column) (equal column (1- end-column))) (format "%d:%d" line column) (format "%d:%d-%d" line column end-column)) (format "(%d:%d)-(%d:%d)" line column end-line end-column)) (if (or (null end-line) (equal line end-line)) (format "%d" line) (format "%d-%d" line end-line))))) (defun flycheck-error-format (err &optional with-file-name) "Format ERR as human-readable string, optionally WITH-FILE-NAME. Return a string that represents the given ERR. If WITH-FILE-NAME is given and non-nil, include the file-name as well, otherwise omit it." (let* ((level (symbol-name (flycheck-error-level err))) (checker (symbol-name (flycheck-error-checker err))) (format `(,@(when with-file-name (list (flycheck-error-filename err) ":")) ,(flycheck-error-format-position err) ":" ,level ": " ,(flycheck-error-format-message-and-id err) " (" ,checker ")"))) (apply #'concat format))) (defun flycheck-error-< (err1 err2) "Determine whether ERR1 is less than ERR2 by location." (let ((l1 (flycheck-error-line err1)) (l2 (flycheck-error-line err2))) (if (/= l1 l2) (< l1 l2) (let ((c1 (or (flycheck-error-column err1) 1)) (c2 (or (flycheck-error-column err2) 1))) (if (/= c1 c2) (< c1 c2) (let ((el1 (or (flycheck-error-end-line err1) l1)) (el2 (or (flycheck-error-end-line err2) l2))) (if (/= el1 el2) (< el1 el2) (let ((cl1 (or (flycheck-error-end-column err1) 1)) (cl2 (or (flycheck-error-end-column err2) 1))) (< cl1 cl2))))))))) (defun flycheck-error-level-< (err1 err2) "Determine whether ERR1 is less than ERR2 by error level. Like `flycheck-error-<', but compares by error level severity first. Levels of the same severity are compared by name." (let* ((level1 (flycheck-error-level err1)) (level2 (flycheck-error-level err2)) (severity1 (flycheck-error-level-severity level1)) (severity2 (flycheck-error-level-severity level2))) (cond ((= severity1 severity2) (if (string= level1 level2) (flycheck-error-< err1 err2) (string< level1 level2))) (t (< severity1 severity2))))) (defun flycheck-assert-error-list-p (errors) "Assert that all items in ERRORS are of `flycheck-error' type. Signal an error if any item in ERRORS is not a `flycheck-error' object, as by `flycheck-error-p'. Otherwise return ERRORS again." (unless (listp errors) (signal 'wrong-type-argument (list 'listp errors))) (dolist (err errors) (unless (flycheck-error-p err) (signal 'wrong-type-argument (list 'flycheck-error-p err)))) errors) ;;; Errors in the current buffer (defvar-local flycheck-current-errors nil "A list of all errors and warnings in the current buffer.") (defun flycheck-report-current-errors (errors) "Report ERRORS in the current buffer. Add ERRORS to `flycheck-current-errors' and process each error with `flycheck-process-error-functions'." (setq flycheck-current-errors (append errors flycheck-current-errors)) (overlay-recenter (point-max)) ;; We can't use `seq-sort-by' because it's not in Emacs 25's built-in `seq', ;; and installing an updated version doesn't help (this is a package.el bug; ;; see https://lists.gnu.org/archive/html/emacs-devel/2020-04/msg01974.html). (seq-do (lambda (err) (run-hook-with-args-until-success 'flycheck-process-error-functions err)) (seq-sort (lambda (e1 e2) (< (flycheck-error-line e1) (flycheck-error-line e2))) errors))) (defun flycheck-clear-errors () "Remove all error information from the current buffer." (setq flycheck-current-errors nil) (flycheck-report-status 'not-checked)) (defun flycheck-fill-and-expand-error-file-names (errors directory) "Fill and expand file names in ERRORS relative to DIRECTORY. Expand all file names of ERRORS against DIRECTORY. If the file name of an error is nil fill in the result of function `buffer-file-name' in the current buffer. Return ERRORS, modified in-place." (seq-do (lambda (err) (setf (flycheck-error-filename err) (if-let (filename (flycheck-error-filename err)) (expand-file-name filename directory) (buffer-file-name)))) errors) errors) (defun flycheck-relevant-error-other-file-p (err) "Determine whether ERR is a relevant error for another file." (let ((file-name (flycheck-error-filename err))) (and file-name flycheck-relevant-error-other-file-show (or (null buffer-file-name) (not (flycheck-same-files-p buffer-file-name file-name))) (<= (flycheck-error-level-severity flycheck-relevant-error-other-file-minimum-level) (flycheck-error-level-severity (flycheck-error-level err)))))) (defun flycheck-relevant-error-p (err) "Determine whether ERR is relevant for the current buffer. Return t if ERR may be shown for the current buffer, or nil otherwise." (flycheck-error-with-buffer err (let ((file-name (flycheck-error-filename err)) (message (flycheck-error-message err))) (and (or ;; Neither the error nor buffer have a file name (and (not file-name) (not buffer-file-name)) ;; Both have files, and they match (and buffer-file-name file-name (flycheck-same-files-p file-name buffer-file-name)) ;; This is a significant error from another file (flycheck-relevant-error-other-file-p err)) message (not (string-empty-p message)) ;; Errors without line numbers are discarded. If a linter ;; reports relevant errors without line numbers, use ;; `flycheck-fill-empty-line-numbers' as the checker's ;; `:error-filter' to set them to line 0. (flycheck-error-line err))))) (defun flycheck-relevant-errors (errors) "Filter the relevant errors from ERRORS. Return a list of all errors that are relevant for their corresponding buffer." (seq-filter #'flycheck-relevant-error-p errors)) (defun flycheck-related-errors (err &optional error-set) "Get all the errors that are in the same group as ERR. Return a list of all errors (from ERROR-SET) that have the same `flycheck-error-group' as ERR, including ERR itself. If ERROR-SET is nil, `flycheck-current-errors' is used instead." (let ((group (flycheck-error-group err)) (checker (flycheck-error-checker err))) (if group (seq-filter (lambda (e) (and (eq (flycheck-error-checker e) checker) (eq (flycheck-error-group e) group))) (or error-set flycheck-current-errors)) (list err)))) ;;; Status reporting for the current buffer (defvar-local flycheck-last-status-change 'not-checked "The last status change in the current buffer.") (defun flycheck-report-failed-syntax-check (&optional status) "Report a failed Flycheck syntax check with STATUS. STATUS is a status symbol for `flycheck-report-status', defaulting to `errored'. Clear Flycheck state, run `flycheck-syntax-check-failed-hook' and report an error STATUS." (flycheck-clear) (setq flycheck-current-syntax-check nil) (run-hooks 'flycheck-syntax-check-failed-hook) (flycheck-report-status (or status 'errored))) (defun flycheck-report-status (status) "Report Flycheck STATUS. STATUS is one of the following symbols: `not-checked' The current buffer was not checked. `no-checker' Automatic syntax checker selection did not find a suitable syntax checker. `running' A syntax check is now running in the current buffer. `errored' The current syntax check has errored. `finished' The current syntax check was finished normally. `interrupted' The current syntax check was interrupted. `suspicious' The last syntax check had a suspicious result. Set `flycheck-last-status-change' and call `flycheck-status-changed-functions' with STATUS. Afterwards refresh the mode line." (setq flycheck-last-status-change status) (run-hook-with-args 'flycheck-status-changed-functions status) (force-mode-line-update)) (defun flycheck-mode-line-status-text (&optional status) "Get a text describing STATUS for use in the mode line. STATUS defaults to `flycheck-last-status-change' if omitted or nil." (let* ((current-status (or status flycheck-last-status-change)) (indicator (pcase current-status (`not-checked "") (`no-checker "-") (`running "*") (`errored "!") (`finished (let-alist (flycheck-count-errors flycheck-current-errors) (if (or .error .warning) (format ":%s|%s" (or .error 0) (or .warning 0)) flycheck-mode-success-indicator))) (`interrupted ".") (`suspicious "?"))) (face (when flycheck-mode-line-color (pcase current-status (`errored 'error) (`finished (let-alist (flycheck-count-errors flycheck-current-errors) (if (or .error .warning) 'error 'success)))))) (text (format " %s%s" flycheck-mode-line-prefix indicator))) (when face (setq text (propertize text 'face face))) text)) ;;; Error levels (defun flycheck-make-margin-spec (margin-str face) "Make a display spec to indicate errors in the margins. Returns MARGIN-STR with FACE applied." (propertize margin-str 'face `(,face default))) (defconst flycheck-default-margin-str "»" "String used to indicate errors in the margins.") (defconst flycheck-default-margin-continuation-str "⋮" "String used to indicate continuation lines in the margins.") ;;;###autoload (defun flycheck-define-error-level (level &rest properties) "Define a new error LEVEL with PROPERTIES. The following PROPERTIES constitute an error level: `:severity SEVERITY' A number denoting the severity of this level. The higher the number, the more severe is this level compared to other levels. Defaults to 0; info is -10, warning is 10, and error is 100. The severity is used by `flycheck-error-level-<' to determine the ordering of errors according to their levels. `:compilation-level LEVEL' A number indicating the broad class of messages that errors at this level belong to: one of 0 (info), 1 (warning), or 2 or nil (error). Defaults to nil. This is used by `flycheck-checker-pattern-to-error-regexp' to map error levels into `compilation-mode''s hierarchy and to get proper highlighting of errors in `compilation-mode'. `:overlay-category CATEGORY' A symbol denoting the overlay category to use for error highlight overlays for this level. See Info node `(elisp)Overlay Properties' for more information about overlay categories. A category for an error level overlay should at least define the `face' property, for error highlighting. Another useful property for error level categories is `priority', to influence the stacking of multiple error level overlays. `:fringe-bitmap BITMAPS' A fringe bitmap symbol denoting the bitmap to use for fringe indicators for this level, or a cons of two bitmaps (one for narrow fringes and one for wide fringes). See Info node `(elisp)Fringe Bitmaps' for more information about fringe bitmaps, including a list of built-in fringe bitmaps. `:fringe-face FACE' A face symbol denoting the face to use for fringe indicators for this level. `:margin-spec SPEC' A display specification indicating what to display in the margin when `flycheck-indication-mode' is `left-margin' or `right-margin'. See Info node `(elisp)Displaying in the Margins'. If omitted, Flycheck generates an image spec from the fringe bitmap. `:error-list-face FACE' A face symbol denoting the face to use for messages of this level in the error list. See `flycheck-list-errors'." (declare (indent 1)) (setf (get level 'flycheck-error-level) t) (setf (get level 'flycheck-error-severity) (or (plist-get properties :severity) 0)) (setf (get level 'flycheck-compilation-level) (plist-get properties :compilation-level)) (setf (get level 'flycheck-overlay-category) (plist-get properties :overlay-category)) (setf (get level 'flycheck-fringe-bitmaps) (let ((bitmap (plist-get properties :fringe-bitmap))) (if (consp bitmap) bitmap (cons bitmap bitmap)))) ;; Kept for compatibility (setf (get level 'flycheck-fringe-bitmap-double-arrow) (car (get level 'flycheck-fringe-bitmaps))) (setf (get level 'flycheck-fringe-face) (plist-get properties :fringe-face)) (setf (get level 'flycheck-margin-spec) (or (plist-get properties :margin-spec) (flycheck-make-margin-spec flycheck-default-margin-str (or (get level 'flycheck-fringe-face) 'default)))) (setf (get level 'flycheck-margin-continuation) (flycheck-make-margin-spec flycheck-default-margin-continuation-str (or (get level 'flycheck-fringe-face) 'default))) (setf (get level 'flycheck-error-list-face) (plist-get properties :error-list-face))) (defun flycheck-error-level-p (level) "Determine whether LEVEL is a Flycheck error level." (get level 'flycheck-error-level)) (defun flycheck-error-level-severity (level) "Get the numeric severity of LEVEL." (or (get level 'flycheck-error-severity) 0)) (defun flycheck-error-level-compilation-level (level) "Get the compilation level for LEVEL." (get level 'flycheck-compilation-level)) (defun flycheck-error-level-overlay-category (level) "Get the overlay category for LEVEL." (get level 'flycheck-overlay-category)) (defun flycheck-error-level-margin-spec (level) "Get the margin spec for LEVEL." (get level 'flycheck-margin-spec)) (defun flycheck-error-level-margin-continuation-spec (level) "Get the margin continuation spec for LEVEL." (get level 'flycheck-margin-continuation)) (defun flycheck-error-level-fringe-bitmap (level &optional hi-res) "Get the fringe bitmap for LEVEL. Optional argument HI-RES non-nil means that the returned bitmap will be the high resolution version." (let ((bitmaps (get level 'flycheck-fringe-bitmaps))) (if hi-res (cdr bitmaps) (car bitmaps)))) (defun flycheck-error-level-fringe-face (level) "Get the fringe face for LEVEL." (get level 'flycheck-fringe-face)) (defun flycheck-error-level-error-list-face (level) "Get the error list face for LEVEL." (get level 'flycheck-error-list-face)) (defun flycheck-error-level-make-indicator (level side &optional continuation) "Create the fringe or margin icon for LEVEL at SIDE. Return a propertized string that shows an indicator according to LEVEL and the given fringe or margin SIDE. LEVEL is a Flycheck error level defined with `flycheck-define-error-level', and SIDE is either `left-fringe', `right-fringe', `left-margin', or `right-margin'. CONTINUATION indicates which fringe bitmap or margin spec to use: either the `:fringe-bitmap' and `:margin-spec' properties of LEVEL when CONTINUATION is nil or omitted, or bitmaps and specs indicating an error spanning more than one line. Return a propertized string representing the fringe icon, intended for use as `before-string' of an overlay to actually show the indicator." (propertize "!" 'display (pcase side ((or `left-fringe `right-fringe) (list side (if continuation 'flycheck-fringe-bitmap-continuation (let* ((fringe-width (pcase side (`left-fringe (car (window-fringes))) (`right-fringe (cadr (window-fringes))))) (high-res (>= fringe-width 16))) (flycheck-error-level-fringe-bitmap level high-res))) (flycheck-error-level-fringe-face level))) ((or `left-margin `right-margin) `((margin ,side) ,(or (if continuation (flycheck-error-level-margin-continuation-spec level) (flycheck-error-level-margin-spec level)) ""))) (_ (error "Invalid fringe side: %S" side))))) (define-obsolete-function-alias 'flycheck-error-level-make-fringe-icon 'flycheck-error-level-make-indicator "33") ;;; Built-in error levels (defconst flycheck-fringe-bitmap-double-arrow [#b11011000 #b01101100 #b00110110 #b00011011 #b00110110 #b01101100 #b11011000] "Bitmaps used to indicate errors in the left fringes.") (defconst flycheck-fringe-bitmap-double-left-arrow [#b00011011 #b00110110 #b01101100 #b11011000 #b01101100 #b00110110 #b00011011] "Bitmaps used to indicate errors in the right fringes.") (defconst flycheck-fringe-bitmap-double-arrow-hi-res [#b1111001111000000 #b0111100111100000 #b0011110011110000 #b0001111001111000 #b0000111100111100 #b0000011110011110 #b0000011110011110 #b0000111100111100 #b0001111001111000 #b0011110011110000 #b0111100111100000 #b1111001111000000] "High-resolution bitmap used to indicate errors in the left fringes.") (defconst flycheck-fringe-bitmap-double-left-arrow-hi-res [#b0000001111001111 #b0000011110011110 #b0000111100111100 #b0001111001111000 #b0011110011110000 #b0111100111100000 #b0111100111100000 #b0011110011110000 #b0001111001111000 #b0000111100111100 #b0000011110011110 #b0000001111001111] "High-resolution bitmap used to indicate errors in the right fringes.") (defconst flycheck-fringe-bitmap-continuation [#b1000000010000000 #b0010000000100000 #b0000100000001000 #b0000001000000010] "Bitmap used to indicate continuation lines in the fringes.") (when (fboundp 'define-fringe-bitmap) ;; #ifdef HAVE_WINDOW_SYSTEM (define-fringe-bitmap 'flycheck-fringe-bitmap-double-arrow flycheck-fringe-bitmap-double-arrow) (define-fringe-bitmap 'flycheck-fringe-bitmap-double-arrow-hi-res flycheck-fringe-bitmap-double-arrow-hi-res nil 16) (define-fringe-bitmap 'flycheck-fringe-bitmap-double-left-arrow flycheck-fringe-bitmap-double-left-arrow) (define-fringe-bitmap 'flycheck-fringe-bitmap-double-left-arrow-hi-res flycheck-fringe-bitmap-double-left-arrow-hi-res nil 16) (define-fringe-bitmap 'flycheck-fringe-bitmap-continuation flycheck-fringe-bitmap-continuation nil 16 '(top repeat))) (defun flycheck-redefine-standard-error-levels (&optional margin-str fringe-bitmap) "Redefine Flycheck's standard error levels. This is useful to change the character drawn in the margins (MARGIN-STR, a string) or the bitmap drawn in the fringes (FRINGE-BITMAP, a fringe bitmap symbol or a cons of such symbols, as in `flycheck-define-error-level')." (unless margin-str (setq margin-str flycheck-default-margin-str)) (unless fringe-bitmap (setq fringe-bitmap (cons 'flycheck-fringe-bitmap-double-arrow 'flycheck-fringe-bitmap-double-arrow-hi-res))) (setf (get 'flycheck-error-overlay 'face) 'flycheck-error) (setf (get 'flycheck-error-overlay 'priority) 110) (flycheck-define-error-level 'error :severity 100 :compilation-level 2 :overlay-category 'flycheck-error-overlay :margin-spec (flycheck-make-margin-spec margin-str 'flycheck-fringe-error) :fringe-bitmap fringe-bitmap :fringe-face 'flycheck-fringe-error :error-list-face 'flycheck-error-list-error) (setf (get 'flycheck-warning-overlay 'face) 'flycheck-warning) (setf (get 'flycheck-warning-overlay 'priority) 100) (flycheck-define-error-level 'warning :severity 10 :compilation-level 1 :overlay-category 'flycheck-warning-overlay :margin-spec (flycheck-make-margin-spec margin-str 'flycheck-fringe-warning) :fringe-bitmap fringe-bitmap :fringe-face 'flycheck-fringe-warning :error-list-face 'flycheck-error-list-warning) (setf (get 'flycheck-info-overlay 'face) 'flycheck-info) (setf (get 'flycheck-info-overlay 'priority) 90) (flycheck-define-error-level 'info :severity -10 :compilation-level 0 :overlay-category 'flycheck-info-overlay :margin-spec (flycheck-make-margin-spec margin-str 'flycheck-fringe-info) :fringe-bitmap fringe-bitmap :fringe-face 'flycheck-fringe-info :error-list-face 'flycheck-error-list-info)) (flycheck-redefine-standard-error-levels) ;;; Error filtering (defun flycheck-filter-errors (errors checker) "Filter ERRORS from CHECKER. Apply the error filter of CHECKER to ERRORs and return the result. If CHECKER has no error filter, fall back to `flycheck-sanitize-errors'." (let ((filter (or (flycheck-checker-get checker 'error-filter) #'flycheck-sanitize-errors))) (funcall filter errors))) (defun flycheck-sanitize-errors (errors) "Sanitize ERRORS. Sanitize ERRORS by trimming leading and trailing whitespace in all error messages, and by replacing 0 columns and empty error messages with nil. Returns sanitized ERRORS." (dolist (err errors) (flycheck-error-with-buffer err (let ((message (flycheck-error-message err)) (id (flycheck-error-id err))) (when message (setq message (string-trim message)) (setf (flycheck-error-message err) (if (string-empty-p message) nil message))) (when (and id (string-empty-p id)) (setf (flycheck-error-id err) nil)) (when (eq (flycheck-error-column err) 0) (setf (flycheck-error-column err) nil)) (when (eq (flycheck-error-end-column err) 0) (setf (flycheck-error-end-column err) nil))))) errors) (defun flycheck-remove-error-file-names (file-name errors) "Remove matching FILE-NAME from ERRORS. Use as `:error-filter' for syntax checkers that output faulty filenames. Flycheck will later fill in the buffer file name. Return ERRORS." (seq-do (lambda (err) (when (and (flycheck-error-filename err) (string= (flycheck-error-filename err) file-name)) (setf (flycheck-error-filename err) nil))) errors) errors) (defun flycheck-increment-error-columns (errors &optional offset) "Increment all columns of ERRORS by OFFSET (default: 1). Use this as `:error-filter' if a syntax checker outputs 0-based columns." (setq offset (or offset 1)) ;; Emacs bug #31715 (seq-do (lambda (err) (when (flycheck-error-column err) (cl-incf (flycheck-error-column err) offset)) (when (flycheck-error-end-column err) (cl-incf (flycheck-error-end-column err) offset))) errors) errors) (defun flycheck-collapse-error-message-whitespace (errors) "Collapse whitespace in all messages of ERRORS. Return ERRORS." (dolist (err errors) (when-let (message (flycheck-error-message err)) (setf (flycheck-error-message err) (replace-regexp-in-string (rx (one-or-more (any space "\n" "\r"))) " " message 'fixed-case 'literal)))) errors) (defun flycheck-dedent-error-messages (errors) "Dedent all messages of ERRORS. For each error in ERRORS, determine the indentation offset from the leading whitespace of the first line, and dedent all further lines accordingly. Return ERRORS, with in-place modifications." (dolist (err errors) (when-let (message (flycheck-error-message err)) (with-temp-buffer (insert message) ;; Determine the indentation offset (goto-char (point-min)) (back-to-indentation) (let* ((indent-offset (- (point) (point-min)))) ;; Now iterate over all lines and dedent each according to ;; `indent-offset' (while (not (eobp)) (back-to-indentation) ;; If the current line starts with sufficient whitespace, delete the ;; indentation offset. Otherwise keep the line intact, as we might ;; loose valuable information (when (>= (- (point) (line-beginning-position)) indent-offset) (delete-char (- indent-offset))) (forward-line 1))) (delete-trailing-whitespace (point-min) (point-max)) (setf (flycheck-error-message err) (buffer-substring-no-properties (point-min) (point-max)))))) errors) (defun flycheck-fold-include-levels (errors sentinel-message) "Fold levels of ERRORS from included files. ERRORS is a list of `flycheck-error' objects. SENTINEL-MESSAGE is a regular expression matched against the error message to determine whether the error denotes errors from an included file. Alternatively, it is a function that is given an error and shall return non-nil, if the error denotes errors from an included file." (unless (or (stringp sentinel-message) (functionp sentinel-message)) (error "Sentinel must be string or function: %S" sentinel-message)) (let ((sentinel (if (functionp sentinel-message) sentinel-message (lambda (err) (string-match-p sentinel-message (flycheck-error-message err))))) (remaining-errors errors)) (while remaining-errors (let* ((current-error (pop remaining-errors))) (when (funcall sentinel current-error) ;; We found an error denoting errors in the included file: ;; 1. process all subsequent errors until faulty include file is found ;; 2. process again all subsequent errors until an error has the ;; current file name again ;; 3. find the most severe error level (let ((current-filename (flycheck-error-filename current-error)) (current-level nil) (faulty-include-filename nil) (filename nil) (done (null remaining-errors))) (while (not done) (setq filename (flycheck-error-filename (car remaining-errors))) (unless faulty-include-filename (unless (string= filename current-filename) (setq faulty-include-filename filename))) (let* ((error-in-include (pop remaining-errors)) (in-include-level (flycheck-error-level error-in-include))) (unless (funcall sentinel error-in-include) ;; Ignore nested "included file" errors, we are only ;; interested in real errors because these define our level (when (or (not current-level) (> (flycheck-error-level-severity in-include-level) (flycheck-error-level-severity current-level))) (setq current-level in-include-level)))) (setq done (or (null remaining-errors) (and faulty-include-filename (string= filename current-filename))))) (setf (flycheck-error-level current-error) current-level (flycheck-error-message current-error) (format "In include %s" faulty-include-filename)))))) errors)) (defun flycheck-dequalify-error-ids (errors) "De-qualify error ids in ERRORS. Remove all qualifications from error ids in ERRORS, by stripping all leading dotted components from error IDs. For instance, if the error ID is com.foo.E100, replace it with E100. This error filter is mainly useful to simplify error IDs obtained from parsing Checkstyle XML, which frequently has very verbose IDs, that include the name of the tool." (seq-do (lambda (err) (let ((id (flycheck-error-id err))) (when id (setf (flycheck-error-id err) (replace-regexp-in-string (rx string-start (group (optional (zero-or-more not-newline) ".")) (one-or-more (not (any "."))) string-end) "" id 'fixedcase 'literal 1))))) errors) errors) (defun flycheck-remove-error-ids (errors) "Remove all error ids from ERRORS." (seq-do (lambda (err) (setf (flycheck-error-id err) nil)) errors) errors) (defun flycheck-fill-empty-line-numbers (errors) "Set ERRORS without lines to line 0. Use as `:error-filter' for syntax checkers that output errors without line numbers. Return ERRORS." (seq-do (lambda (err) (unless (flycheck-error-line err) (setf (flycheck-error-line err) 0))) errors) errors) ;;; Error analysis (defun flycheck-count-errors (errors) "Count the number of ERRORS, grouped by level. Return an alist, where each ITEM is a cons cell whose `car' is an error level, and whose `cdr' is the number of errors of that level." (let (counts-by-level) (dolist (err errors) (let* ((level (flycheck-error-level err)) (item (assq level counts-by-level))) (if item (cl-incf (cdr item)) (push (cons level 1) counts-by-level)))) counts-by-level)) (defun flycheck-has-max-errors-p (errors level) "Check if there is no error in ERRORS more severe than LEVEL." (let ((severity (flycheck-error-level-severity level))) (seq-every-p (lambda (e) (<= (flycheck-error-level-severity (flycheck-error-level e)) severity)) errors))) (defun flycheck-has-max-current-errors-p (level) "Check if there is no current error more severe than LEVEL." (flycheck-has-max-errors-p flycheck-current-errors level)) (defun flycheck-has-errors-p (errors level) "Determine if there are any ERRORS with LEVEL." (seq-some (lambda (e) (eq (flycheck-error-level e) level)) errors)) (defun flycheck-has-current-errors-p (&optional level) "Determine if the current buffer has errors with LEVEL. If LEVEL is omitted if the current buffer has any errors at all." (if level (flycheck-has-errors-p flycheck-current-errors level) (and flycheck-current-errors t))) ;;; Error overlays in the current buffer (defvar-local flycheck--last-overlay-index 0 "Last index given to a Flycheck overlay. These indices are used to preserve error order (Emacs doesn't preserve overlay order when calling `overlays-at').") (defun flycheck--next-overlay-index () "Compute the index to assign to a new Flycheck overlay." (cl-incf flycheck--last-overlay-index)) (defun flycheck--highlighting-style (err) "Determine the highlighting style to apply to ERR. Styles are documented in `flycheck-highlighting-style'; this functions resolves `conditional' style specifications." (let* ((style flycheck-highlighting-style) (first-line (flycheck-error-line err)) (end-line (or (flycheck-error-end-line err) first-line)) (nlines (- end-line first-line))) (while (eq (car-safe style) 'conditional) (pcase-let ((`(,threshold ,s1 ,s2) (cdr style))) (setq style (if (< nlines threshold) s1 s2)))) (pcase style (`(delimiters ,before ,after) (when (characterp before) (setq before (flycheck--make-highlighting-delimiter before))) (when (characterp after) (setq after (flycheck--make-highlighting-delimiter after))) (setq style `(delimiters ,before ,after)))) style)) (defun flycheck--setup-highlighting (err overlay) "Apply properties to OVERLAY to highlight ERR." (let ((level (flycheck-error-level err))) (unless flycheck-highlighting-mode ;; Erase the highlighting from the overlay if requested by the user (setf (overlay-get overlay 'face) nil)) (when flycheck-indication-mode (setf (overlay-get overlay 'before-string) (flycheck-error-level-make-indicator level flycheck-indication-mode)) (setf (overlay-get overlay 'line-prefix) (flycheck-error-level-make-indicator level flycheck-indication-mode t))) (pcase (flycheck--highlighting-style err) ((or `nil (guard (null flycheck-highlighting-mode))) ;; Erase the highlighting (setf (overlay-get overlay 'face) nil)) (`level-face) (`(delimiters ,before ,after) ;; Replace the highlighting with delimiters (let* ((fringe-face (flycheck-error-level-fringe-face level)) (delim-face `(flycheck-error-delimiter ,fringe-face))) (setf (overlay-get overlay 'face) 'flycheck-delimited-error) (setf (overlay-get overlay 'before-string) (concat (propertize before 'face delim-face) (or (overlay-get overlay 'before-string) ""))) (setf (overlay-get overlay 'after-string) (propertize after 'face delim-face)))) (other (error "Unsupported highlighting style: %S" other))))) (defun flycheck-add-overlay (err) "Add overlay for ERR. Return the created overlay." ;; We must have a proper error region for the sake of fringe indication, ;; error display and error navigation, even if the highlighting is disabled. ;; We erase the highlighting later on in this case (pcase-let* ((`(,beg . ,end) (if (flycheck-relevant-error-other-file-p err) ;; Display overlays for other-file errors on the first line (cons (point-min) (save-excursion (goto-char (point-min)) (line-end-position))) (flycheck-error-region-for-mode err (or flycheck-highlighting-mode 'lines)))) (overlay (make-overlay beg end)) (level (flycheck-error-level err)) (category (flycheck-error-level-overlay-category level)) (index (flycheck--next-overlay-index))) (unless (flycheck-error-level-p level) (error "Undefined error level: %S" level)) (setf (overlay-get overlay 'flycheck-error-index) index) (setf (overlay-get overlay 'flycheck-overlay) t) (setf (overlay-get overlay 'flycheck-error) err) (setf (overlay-get overlay 'category) category) (setf (overlay-get overlay 'help-echo) #'flycheck-help-echo) (flycheck--setup-highlighting err overlay) overlay)) (defun flycheck-help-echo (_window object pos) "Construct a tooltip message. Most of the actual work is done by calling `flycheck-help-echo-function' with the appropriate list of errors. Arguments WINDOW, OBJECT and POS are as described in info node `(elisp)Special properties', as this function is intended to be used as the \\='help-echo property of flycheck error overlays." (when-let (buf (cond ((bufferp object) object) ((overlayp object) (overlay-buffer object)))) (with-current-buffer buf (when-let* ((fn flycheck-help-echo-function) (errs (flycheck-overlay-errors-at pos))) (propertize (funcall fn errs) 'help-echo-inhibit-substitution t))))) (defun flycheck-help-echo-all-error-messages (errs) "Concatenate error messages and ids from ERRS." (pcase (delq nil errs) ;; FIXME why would errors be nil here? (`(,err) ;; A single error (flycheck-error-format-message-and-id err)) (_ ;; Zero or multiple errors (mapconcat (lambda (err) (flycheck-error-format-message-and-id err 'include-snippet)) errs "\n")))) (defun flycheck-filter-overlays (overlays) "Get all Flycheck overlays from OVERLAYS, in original order." ;; The order of errors returned from overlays is not stable, so we sort ;; them again using the internal index to guarantee errors are always ;; displayed in the same order. (seq-sort ;; We can't use `seq-sort-by' here; see above (lambda (o1 o2) (< (overlay-get o1 'flycheck-error-index) (overlay-get o2 'flycheck-error-index))) (seq-filter (lambda (o) (overlay-get o 'flycheck-overlay)) overlays))) (defun flycheck-overlays-at (pos) "Get all Flycheck overlays at POS." (flycheck-filter-overlays (overlays-at pos))) (defun flycheck-overlays-in (beg end) "Get all Flycheck overlays between BEG and END." (flycheck-filter-overlays (overlays-in beg end))) (defun flycheck-overlay-errors-at (pos) "Return a list of all flycheck errors overlaid at POS." (seq-map (lambda (o) (overlay-get o 'flycheck-error)) (flycheck-overlays-at pos))) (defun flycheck-overlay-errors-in (beg end) "Return a list of all flycheck errors overlaid between BEG and END." (seq-map (lambda (o) (overlay-get o 'flycheck-error)) (flycheck-overlays-in beg end))) (defvar-local flycheck-overlays-to-delete nil "Overlays mark for deletion after all syntax checks completed.") (put 'flycheck-overlays-to-delete 'permanent-local t) (defun flycheck-delete-all-overlays () "Remove all flycheck overlays in the current buffer." (overlay-recenter (point-max)) (flycheck-delete-marked-overlays) (setq flycheck--last-overlay-index 0) (save-restriction (widen) (seq-do #'delete-overlay (flycheck-overlays-in (point-min) (point-max))))) (defun flycheck-mark-all-overlays-for-deletion () "Mark all current overlays for deletion." (setq flycheck-overlays-to-delete (append (flycheck-overlays-in (point-min) (point-max)) flycheck-overlays-to-delete))) (defun flycheck-delete-marked-overlays () "Delete all overlays marked for deletion." (overlay-recenter (point-max)) (seq-do #'delete-overlay flycheck-overlays-to-delete) (setq flycheck-overlays-to-delete nil)) ;;; Error navigation in the current buffer (defun flycheck-error-level-interesting-at-pos-p (pos) "Check if error severity at POS passes `flycheck-error-level-interesting-p'." (flycheck-error-level-interesting-p (get-char-property pos 'flycheck-error))) (defun flycheck-error-level-interesting-p (err) "Check if ERR severity is >= `flycheck-navigation-minimum-level'. ERR is also interesting (the function returns true) if there are no errors as or more severe than `flycheck-navigation-minimum-level'." (when (flycheck-error-p err) (if-let (min-level flycheck-navigation-minimum-level) (or (<= (flycheck-error-level-severity min-level) (flycheck-error-level-severity (flycheck-error-level err))) (not (flycheck-has-current-errors-p min-level))) t))) (defun flycheck-next-error-pos (n &optional reset) "Get the position of the N-th next error. With negative N, get the position of the (-N)-th previous error instead. With non-nil RESET, search from `point-min', otherwise search from the current point. Return the position of the next or previous error, or nil if there is none. If N is zero, return `point', or `point-min' if RESET is non-nil." (let ((n (or n 1)) (pos (if reset (point-min) (point)))) (if (>= n 0) ;; Search forwards (while (and pos (> n 0)) (setq n (1- n)) (when (get-char-property pos 'flycheck-error) ;; Move beyond from the current error if any (setq pos (next-single-char-property-change pos 'flycheck-error))) (while (not (or (= pos (point-max)) (flycheck-error-level-interesting-at-pos-p pos))) ;; Scan for the next error (setq pos (next-single-char-property-change pos 'flycheck-error))) (when (and (= pos (point-max)) (not (flycheck-error-level-interesting-at-pos-p pos))) ;; If we reached the end of the buffer, but no error, we didn't find ;; any (setq pos nil))) ;; Search backwards (while (and pos (< n 0)) (setq n (1+ n)) ;; Loop until we find an error. We need to check the position *before* ;; the current one, because `previous-single-char-property-change' ;; always moves to the position *of* the change. (while (not (or (= pos (point-min)) (flycheck-error-level-interesting-at-pos-p (1- pos)))) (setq pos (previous-single-char-property-change pos 'flycheck-error))) (when (and (= pos (point-min)) (not (flycheck-error-level-interesting-at-pos-p pos))) ;; We didn't find any error. (setq pos nil)) (when pos ;; We found an error, so move to its beginning (setq pos (previous-single-char-property-change pos 'flycheck-error))))) pos)) (defun flycheck-next-error-function (n reset) "Visit the N-th error from the current point. N is the number of errors to advance by, where a negative N advances backwards. With non-nil RESET, advance from the beginning of the buffer, otherwise advance from the current position. Intended for use with `next-error-function'." (if-let* ((pos (flycheck-next-error-pos n reset)) (err (get-char-property pos 'flycheck-error))) (flycheck-jump-to-error err) (user-error "No more Flycheck errors"))) (defun flycheck-next-error (&optional n reset) "Visit the N-th error from the current point. N is the number of errors to advance by, where a negative N advances backwards. With non-nil RESET, advance from the beginning of the buffer, otherwise advance from the current position." (interactive "P") (when (consp n) ;; Universal prefix argument means reset (setq reset t n nil)) (flycheck-next-error-function n reset) (flycheck-display-error-at-point)) (defun flycheck-previous-error (&optional n) "Visit the N-th previous error. If given, N specifies the number of errors to move backwards by. If N is negative, move forwards instead." (interactive "P") (flycheck-next-error (- (or n 1)))) (defun flycheck-first-error (&optional n) "Visit the N-th error from beginning of the buffer. If given, N specifies the number of errors to move forward from the beginning of the buffer." (interactive "P") (flycheck-next-error n 'reset)) ;;; Listing errors in buffers (defconst flycheck-error-list-buffer "*Flycheck errors*" "The name of the buffer to show error lists.") (defmacro flycheck-error-list-with-buffer (&rest body) "Evaluate BODY in flycheck-error-list-buffer, if it exists." (declare (indent 0) (debug t)) `(when (get-buffer flycheck-error-list-buffer) (with-current-buffer flycheck-error-list-buffer ,@body))) (defvar flycheck-error-list-mode-map (let ((map (make-sparse-keymap))) (define-key map (kbd "f") #'flycheck-error-list-set-filter) (define-key map (kbd "F") #'flycheck-error-list-reset-filter) (define-key map (kbd "n") #'flycheck-error-list-next-error) (define-key map (kbd "p") #'flycheck-error-list-previous-error) (define-key map (kbd "g") #'flycheck-error-list-check-source) (define-key map (kbd "e") #'flycheck-error-list-explain-error) (define-key map (kbd "RET") #'flycheck-error-list-goto-error) map) "The keymap of `flycheck-error-list-mode'.") (defun flycheck-error-list-make-last-column (message checker) "Compute contents of the last error list cell. MESSAGE and CHECKER are displayed in a single column to allow the message to stretch arbitrarily far." (let ((checker-name (propertize (symbol-name checker) 'face 'flycheck-error-list-checker-name)) (message (propertize message 'face 'flycheck-error-list-error-message))) (format "%s (%s)" message checker-name))) (defconst flycheck-error-list-format `[("File" 6) ("Line" 5 flycheck-error-list-entry-< :right-align t) ("Col" 3 nil :right-align t) ("Level" 8 flycheck-error-list-entry-level-<) ("ID" 6 t) (,(flycheck-error-list-make-last-column "Message" 'Checker) 0 t)] "Table format for the error list.") (defconst flycheck-error-list-padding 1 "Padding used in error list.") (defconst flycheck--error-list-msg-offset (seq-reduce (lambda (offset fmt) (pcase-let* ((`(,_ ,width ,_ . ,props) fmt) (padding (or (plist-get props :pad-right) 1))) (+ offset width padding))) (seq-subseq flycheck-error-list-format 0 -1) flycheck-error-list-padding) "Amount of space to use in `flycheck-flush-multiline-message'.") (define-derived-mode flycheck-error-list-mode tabulated-list-mode "Flycheck errors" "Major mode for listing Flycheck errors. \\{flycheck-error-list-mode-map}" (setq tabulated-list-format flycheck-error-list-format ;; Sort by location initially tabulated-list-sort-key (cons "Line" nil) tabulated-list-padding flycheck-error-list-padding tabulated-list-entries #'flycheck-error-list-entries ;; `revert-buffer' updates the mode line for us, so all we need to do is ;; set the corresponding mode line construct. mode-line-buffer-identification flycheck-error-list-mode-line) ;; See https://github.com/flycheck/flycheck/issues/1101 (setq-local truncate-string-ellipsis "…") (tabulated-list-init-header)) (defvar-local flycheck-error-list-source-buffer nil "The current source buffer of the error list.") ;; Needs to permanently local to preserve the source buffer across buffer ;; reversions (put 'flycheck-error-list-source-buffer 'permanent-local t) (defun flycheck-error-list-set-source (buffer) "Set BUFFER as the source buffer of the error list." (flycheck-error-list-with-buffer (setq flycheck-error-list-source-buffer buffer) (flycheck-error-list-refresh))) (defun flycheck-error-list-update-source () "Make the error list display errors from the current buffer. The update is skipped if the current buffer is the error list or if the error list is already pointing to the current buffer." (unless (memq (current-buffer) (list (get-buffer flycheck-error-list-buffer) (flycheck-error-list-with-buffer flycheck-error-list-source-buffer))) (flycheck-error-list-set-source (current-buffer)))) (defun flycheck-error-list-check-source () "Trigger a syntax check in the source buffer of the error list." (interactive) (let ((buffer (get-buffer flycheck-error-list-source-buffer))) (when (buffer-live-p buffer) (with-current-buffer buffer (flycheck-buffer))))) (define-button-type 'flycheck-error-list 'action #'flycheck-error-list-goto-error 'help-echo "mouse-1, RET: goto error" 'face nil) (define-button-type 'flycheck-error-list-explain-error 'action #'flycheck-error-list-explain-error 'help-echo "mouse-1, RET: explain error") (defsubst flycheck-error-list-make-cell (text &optional face help-echo type) "Make an error list cell with TEXT and FACE. If FACE is nil don't set a FACE on TEXT. If TEXT already has face properties, do not specify a FACE. Note though, that if TEXT gets truncated it will not inherit any previous face properties. If you expect TEXT to be truncated in the error list, do specify a FACE explicitly! If HELP-ECHO is non-nil, set a help-echo property on TEXT, with value HELP-ECHO. This is convenient if you expect TEXT to be truncated. The cell will have the type TYPE unless TYPE is nil, and the default type `flycheck-error-list' will be used instead." (append (list text 'type (if type type 'flycheck-error-list)) (and face (list 'face face)) (and help-echo (list 'help-echo help-echo)))) (defsubst flycheck-error-list-make-number-cell (number face) "Make a table cell for a NUMBER with FACE. Convert NUMBER to string, fontify it with FACE and return the string with attached text properties." (flycheck-error-list-make-cell (if (numberp number) (number-to-string number) "") face)) (defun flycheck-error-list-make-entry (error) "Make a table cell for the given ERROR. Return a list with the contents of the table cell." (let* ((level (flycheck-error-level error)) (level-face (flycheck-error-level-error-list-face level)) (filename (flycheck-error-filename error)) (line (flycheck-error-line error)) (column (flycheck-error-column error)) (message (or (flycheck-error-message error) (format "Unknown %S" level))) (flushed-msg (flycheck-flush-multiline-message message)) (id (flycheck-error-id error)) (id-str (if id (format "%s" id) "")) (checker (flycheck-error-checker error)) (msg-and-checker (flycheck-error-list-make-last-column flushed-msg checker)) (explainer (flycheck-checker-get checker 'error-explainer))) (list error (vector (flycheck-error-list-make-cell (if filename (file-name-nondirectory filename) "") 'flycheck-error-list-filename) (flycheck-error-list-make-number-cell line 'flycheck-error-list-line-number) (flycheck-error-list-make-number-cell column 'flycheck-error-list-column-number) (flycheck-error-list-make-cell (symbol-name (flycheck-error-level error)) level-face) ;; Error ID use a different face when an error-explainer is ;; present (flycheck-error-list-make-cell id-str (if explainer 'flycheck-error-list-id-with-explainer 'flycheck-error-list-id) id-str 'flycheck-error-list-explain-error) (flycheck-error-list-make-cell msg-and-checker nil msg-and-checker))))) (defun flycheck-flush-multiline-message (msg) "Prepare error message MSG for display in the error list. Prepend all lines of MSG except the first with enough space to ensure that they line up properly once the message is displayed." (let* ((spc-spec `(space . (:width ,flycheck--error-list-msg-offset))) (spc (propertize " " 'display spc-spec)) (rep (concat "\\1" spc "\\2"))) (replace-regexp-in-string "\\([\r\n]+\\)\\(.\\)" rep msg))) (defun flycheck-error-list-current-errors () "Read the list of errors in `flycheck-error-list-source-buffer'." (when (buffer-live-p flycheck-error-list-source-buffer) (buffer-local-value 'flycheck-current-errors flycheck-error-list-source-buffer))) (defun flycheck-error-list-entries () "Create the entries for the error list." (when-let* ((errors (flycheck-error-list-current-errors)) (filtered (flycheck-error-list-apply-filter errors))) (seq-map #'flycheck-error-list-make-entry filtered))) (defun flycheck-error-list-entry-< (entry1 entry2) "Determine whether ENTRY1 is before ENTRY2 by location. See `flycheck-error-<'." (flycheck-error-< (car entry1) (car entry2))) (defun flycheck-error-list-entry-level-< (entry1 entry2) "Determine whether ENTRY1 is before ENTRY2 by level. See `flycheck-error-level-<'." (not (flycheck-error-level-< (car entry1) (car entry2)))) (defvar flycheck-error-list-mode-line-map (let ((map (make-sparse-keymap))) (define-key map [mode-line mouse-1] #'flycheck-error-list-mouse-switch-to-source) map) "Keymap for error list mode line.") (defun flycheck-error-list-propertized-source-name () "Get the name of the current source buffer for the mode line. Propertize the name of the current source buffer for use in the mode line indication of `flycheck-error-list-mode'." (let ((name (replace-regexp-in-string (rx "%") "%%" (buffer-name flycheck-error-list-source-buffer) 'fixed-case 'literal))) (propertize name 'face 'mode-line-buffer-id 'mouse-face 'mode-line-highlight 'help-echo "mouse-1: switch to source" 'local-map flycheck-error-list-mode-line-map))) (defun flycheck-error-list-mouse-switch-to-source (event) "Switch to the error list source buffer of the EVENT window." (interactive "e") (save-selected-window (when (eventp event) (select-window (posn-window (event-start event)))) (when (buffer-live-p flycheck-error-list-source-buffer) (switch-to-buffer flycheck-error-list-source-buffer)))) (defun flycheck-get-error-list-window-list (&optional all-frames) "Get all windows displaying the error list. ALL-FRAMES specifies the frames to consider, as in `get-buffer-window-list'." (when-let (buf (get-buffer flycheck-error-list-buffer)) (get-buffer-window-list buf nil all-frames))) (defun flycheck-get-error-list-window (&optional all-frames) "Get a window displaying the error list, or nil if none. ALL-FRAMES specifies the frames to consider, as in `get-buffer-window'." (when-let (buf (get-buffer flycheck-error-list-buffer)) (get-buffer-window buf all-frames))) (defun flycheck-error-list-recenter-at (pos) "Recenter the error list at POS." (dolist (window (flycheck-get-error-list-window-list t)) (with-selected-window window (goto-char pos) (let ((recenter-redisplay nil)) (recenter))))) (defun flycheck-error-list-refresh () "Refresh the current error list. Add all errors currently reported for the current `flycheck-error-list-source-buffer', and recenter the error list." ;; We only refresh the error list, when it is visible in a window, and we ;; select this window while reverting, because Tabulated List mode attempts to ;; recenter the error at the old location, so it must have the proper window ;; selected. (when-let (window (flycheck-get-error-list-window t)) (with-selected-window window (revert-buffer)) (run-hooks 'flycheck-error-list-after-refresh-hook) (let ((preserve-pos (eq (current-buffer) (get-buffer flycheck-error-list-buffer)))) ;; If the error list is the current buffer, don't recenter when ;; highlighting (flycheck-error-list-highlight-errors preserve-pos)))) (defun flycheck-error-list-mode-line-filter-indicator () "Create a string representing the current error list filter." (if flycheck-error-list-minimum-level (format " [>= %s]" flycheck-error-list-minimum-level) "")) (defun flycheck-error-list-set-filter (level) "Restrict the error list to errors at level LEVEL or higher. LEVEL is either an error level symbol, or nil, to remove the filter." (interactive (list (flycheck-read-error-level "Minimum error level (errors at lower levels will be hidden): "))) (when (and level (not (flycheck-error-level-p level))) (user-error "Invalid level: %s" level)) (flycheck-error-list-with-buffer (setq-local flycheck-error-list-minimum-level level) (force-mode-line-update) (flycheck-error-list-refresh) (flycheck-error-list-recenter-at (point-min)))) (defun flycheck-error-list-reset-filter (&optional refresh) "Remove local error filters and reset to the default filter. Interactively, or with non-nil REFRESH, refresh the error list." (interactive '(t)) (flycheck-error-list-with-buffer (kill-local-variable 'flycheck-error-list-minimum-level) (when refresh (flycheck-error-list-refresh) (flycheck-error-list-recenter-at (point-min)) (force-mode-line-update)))) (defun flycheck-error-list-apply-filter (errors) "Filter ERRORS according to `flycheck-error-list-minimum-level'." (if-let* ((min-level flycheck-error-list-minimum-level) (min-severity (flycheck-error-level-severity min-level))) (seq-filter (lambda (err) (>= (flycheck-error-level-severity (flycheck-error-level err)) min-severity)) errors) errors)) (defun flycheck-error-list-goto-error (&optional pos) "Go to the location of the error at POS in the error list. POS defaults to `point'." (interactive) (when-let* ((error (tabulated-list-get-id pos))) (flycheck-jump-to-error error))) (defun flycheck-jump-to-error (error) "Go to the location of ERROR." (let* ((error-copy (copy-flycheck-error error)) (filename (flycheck-error-filename error)) (other-file-error (flycheck-relevant-error-other-file-p error)) (buffer (if filename (find-file-noselect filename) (flycheck-error-buffer error)))) (when (buffer-live-p buffer) (setf (flycheck-error-buffer error-copy) buffer) (flycheck-jump-in-buffer buffer error-copy) ;; When jumping to an error in another file, it may not have ;; this error available for highlighting yet, so we trigger a check ;; if necessary. (when other-file-error (with-current-buffer buffer ;; `seq-contains-p' is only in seq >= 2.21 (unless (with-no-warnings (seq-contains flycheck-current-errors error-copy 'equal)) (when flycheck-mode (flycheck-buffer)))))))) (defun flycheck-jump-in-buffer (buffer error) "In BUFFER, jump to ERROR." ;; FIXME: we assume BUFFER and the buffer of ERROR are the same. We don't ;; need the first argument then. (if (eq (window-buffer) (get-buffer flycheck-error-list-buffer)) ;; When called from within the error list, keep the error list, ;; otherwise replace the current buffer. (pop-to-buffer buffer 'other-window) (switch-to-buffer buffer)) (let ((pos (flycheck-error-pos error))) (unless (eq (goto-char pos) (point)) ;; If widening gets in the way of moving to the right place, remove it ;; and try again (widen) (goto-char pos))) ;; Re-highlight the errors. We have post-command-hook for that, but calls to ;; `flycheck-jump-in-buffer' that come from other buffers (e.g. from the error ;; list) won't trigger it. (flycheck-error-list-highlight-errors 'preserve-pos)) (defun flycheck-error-list-explain-error (&optional pos) "Explain the error at POS in the error list. POS defaults to `point'." (interactive) (when-let* ((error (tabulated-list-get-id pos)) (explainer (flycheck-checker-get (flycheck-error-checker error) 'error-explainer))) (flycheck-error-with-buffer error (when-let (explanation (funcall explainer error)) (flycheck-display-error-explanation explanation))))) (defun flycheck-error-list-next-error-pos (pos &optional n) "Starting from POS get the N'th next error in the error list. N defaults to 1. If N is negative, search for the previous error instead. Get the beginning position of the N'th next error from POS, or nil, if there is no next error." (let ((n (or n 1))) (if (>= n 0) ;; Search forward (while (and pos (/= n 0)) (setq n (1- n)) (setq pos (next-single-property-change pos 'tabulated-list-id))) ;; Search backwards (while (/= n 0) (setq n (1+ n)) ;; We explicitly give the limit here to explicitly have the minimum ;; point returned, to be able to move to the first error (which starts ;; at `point-min') (setq pos (previous-single-property-change pos 'tabulated-list-id nil (point-min))))) pos)) (defun flycheck-error-list-previous-error (n) "Go to the N'th previous error in the error list." (interactive "P") (flycheck-error-list-next-error (- (or n 1)))) (defun flycheck-error-list-next-error (n) "Go to the N'th next error in the error list." (interactive "P") (let ((pos (flycheck-error-list-next-error-pos (point) n))) (when (and pos (/= pos (point))) (goto-char pos) (save-selected-window ;; Keep the error list selected, so that the user can navigate errors by ;; repeatedly pressing n/p, without having to re-select the error list ;; window. (flycheck-error-list-goto-error))))) (defvar-local flycheck-error-list-highlight-overlays nil "Error highlight overlays in the error list buffer.") (put 'flycheck-error-list-highlight-overlays 'permanent-local t) (defun flycheck-error-list-highlight-errors (&optional preserve-pos) "Highlight errors in the error list. Highlight all errors in the error list that are at point in the source buffer, and on the same line as point. Then recenter the error list to the highlighted error, unless PRESERVE-POS is non-nil." (when (get-buffer flycheck-error-list-buffer) (with-current-buffer flycheck-error-list-buffer (let ((current-errors (when (buffer-live-p flycheck-error-list-source-buffer) (with-current-buffer flycheck-error-list-source-buffer (flycheck-overlay-errors-in (line-beginning-position) (line-end-position)))))) (let ((old-overlays flycheck-error-list-highlight-overlays) (min-point (point-max)) (max-point (point-min))) ;; Display the new overlays first, to avoid re-display flickering (setq flycheck-error-list-highlight-overlays nil) (when current-errors (let ((next-error-pos (point-min))) (while next-error-pos (let* ((beg next-error-pos) (end (flycheck-error-list-next-error-pos beg)) (err (tabulated-list-get-id beg))) (when (member err current-errors) (setq min-point (min min-point beg) max-point (max max-point beg)) (let ((ov (make-overlay beg ;; Extend overlay to the beginning ;; of the next line, to highlight ;; the whole line (or end (point-max))))) (push ov flycheck-error-list-highlight-overlays) (setf (overlay-get ov 'flycheck-error-highlight-overlay) t) (setf (overlay-get ov 'face) 'flycheck-error-list-highlight))) (setq next-error-pos end))))) ;; Delete the old overlays (seq-do #'delete-overlay old-overlays) (when (and (not preserve-pos) current-errors) ;; Move point to the middle error (goto-char (+ min-point (/ (- max-point min-point) 2))) (beginning-of-line) ;; And recenter the error list at this position (flycheck-error-list-recenter-at (point)))))))) (defun flycheck-list-errors () "Show the error list for the current buffer." (interactive) (unless flycheck-mode (user-error "Flycheck mode not enabled")) ;; Create and initialize the error list (unless (get-buffer flycheck-error-list-buffer) (with-current-buffer (get-buffer-create flycheck-error-list-buffer) (flycheck-error-list-mode))) ;; Reset the error filter (flycheck-error-list-reset-filter) (let ((source (current-buffer))) ;; Show the error list in a side window. Under some configurations of ;; `display-buffer', this may select `flycheck-error-list-buffer' (see URL ;; `https://github.com/flycheck/flycheck/issues/1776'). (display-buffer flycheck-error-list-buffer) ;; Adjust the source, causing a refresh (flycheck-error-list-set-source source))) (defalias 'list-flycheck-errors 'flycheck-list-errors) ;;; Displaying errors in the current buffer (defun flycheck-display-errors (errors) "Display ERRORS using `flycheck-display-errors-function'." (when flycheck-display-errors-function (funcall flycheck-display-errors-function errors))) (defun flycheck-clear-displayed-errors () "Clear errors using `flycheck-clear-displayed-errors-function'." (when flycheck-clear-displayed-errors-function (funcall flycheck-clear-displayed-errors-function))) (defvar-local flycheck-display-error-at-point-timer nil "Timer to automatically show errors.") (defun flycheck-cancel-error-display-error-at-point-timer () "Cancel the error display timer for the current buffer." (when flycheck-display-error-at-point-timer (cancel-timer flycheck-display-error-at-point-timer) (setq flycheck-display-error-at-point-timer nil))) (defun flycheck-display-error-at-point () "Display all the error messages at point. If there are no errors, clears the error messages at point." (interactive) ;; This function runs from a timer, so we must take care to not ignore any ;; errors (with-demoted-errors "Flycheck error display error: %s" (flycheck-cancel-error-display-error-at-point-timer) (when flycheck-mode (let ((errors (flycheck-overlay-errors-at (point)))) (if errors (flycheck-display-errors errors) (flycheck-clear-displayed-errors)))))) (defun flycheck-display-error-at-point-soon () "Display error messages at point, with a delay." (flycheck-cancel-error-display-error-at-point-timer) (setq flycheck-display-error-at-point-timer (run-at-time flycheck-display-errors-delay nil 'flycheck-display-error-at-point))) ;;; Functions to display errors (defconst flycheck-error-message-buffer "*Flycheck error messages*" "The name of the buffer to show long error messages in.") (defun flycheck-error-message-buffer () "Get the buffer object to show long error messages in. Get the buffer named by variable `flycheck-error-message-buffer', or nil if the buffer does not exist." (get-buffer flycheck-error-message-buffer)) (defun flycheck-may-use-echo-area-p () "Determine whether the echo area may be used. The echo area may be used if the cursor is not in the echo area, and if the echo area is not occupied by minibuffer input." (not (or cursor-in-echo-area (active-minibuffer-window)))) (define-derived-mode flycheck-error-message-mode text-mode "Flycheck error messages" "Major mode for extended error messages.") (defvar flycheck--last-displayed-message nil "Reference to the last displayed message so it can be cleared. This value is the return value from `display-message-or-buffer', thus it can be a string or a window. See `flycheck-clear-displayed-error-messages'.") (defun flycheck-display-error-messages (errors) "Display the messages of ERRORS. Concatenate all non-nil messages of ERRORS as with `flycheck-help-echo-all-error-messages', and display them with `display-message-or-buffer', which shows the messages either in the echo area or in a separate buffer, depending on the number of lines. See Info node `(elisp)Displaying Messages' for more information. In the latter case, show messages in the buffer denoted by variable `flycheck-error-message-buffer'." (when (and errors (flycheck-may-use-echo-area-p)) (let* ((message (flycheck-help-echo-all-error-messages errors)) (retval (display-message-or-buffer message flycheck-error-message-buffer 'not-this-window))) ;; We cannot rely on `display-message-or-buffer' returning the right ;; window. See URL `https://github.com/flycheck/flycheck/issues/1643'. (when-let (buf (get-buffer flycheck-error-message-buffer)) (with-current-buffer buf (unless (derived-mode-p 'flycheck-error-message-mode) (flycheck-error-message-mode)))) (setq flycheck--last-displayed-message retval) retval))) (defun flycheck-display-error-messages-unless-error-list (errors) "Show messages of ERRORS unless the error list is visible. Like `flycheck-display-error-messages', but only if the error list (see `flycheck-list-errors') is not visible in any window in the current frame." (unless (flycheck-get-error-list-window 'current-frame) (flycheck-display-error-messages errors))) (defun flycheck-hide-error-buffer () "Hide the Flycheck error buffer if necessary. Hide the error buffer if there is no error under point." (when-let* ((buffer (flycheck-error-message-buffer)) (window (get-buffer-window buffer))) (unless (flycheck-overlays-at (point)) ;; save-selected-window prevents `quit-window' from changing the current ;; buffer (see https://github.com/flycheck/flycheck/issues/648). (save-selected-window (quit-window nil window))))) (defun flycheck-clear-displayed-error-messages () "Clear error messages displayed by `flycheck-display-error-messages'." (when flycheck--last-displayed-message (if (and (stringp flycheck--last-displayed-message) (equal (current-message) flycheck--last-displayed-message)) (message nil) (flycheck-hide-error-buffer)))) ;;; Working with errors (defun flycheck-copy-errors-as-kill (pos &optional formatter) "Copy each error at POS into kill ring, using FORMATTER. FORMATTER is a function to turn an error into a string, defaulting to `flycheck-error-message'. Interactively, use `flycheck-error-format-message-and-id' as FORMATTER with universal prefix arg, and `flycheck-error-id' with normal prefix arg, i.e. copy the message and the ID with universal prefix arg, and only the id with normal prefix arg." (interactive (list (point) (pcase current-prefix-arg ((pred not) #'flycheck-error-message) ((pred consp) #'flycheck-error-format-message-and-id) (_ #'flycheck-error-id)))) (let ((messages (delq nil (seq-map (or formatter #'flycheck-error-message) (flycheck-overlay-errors-at pos))))) (when messages (seq-do #'kill-new (reverse messages)) (message (string-join messages "\n"))))) (defun flycheck-explain-error-at-point () "Display an explanation for the first explainable error at point. The first explainable error at point is the first error at point with a non-nil `:error-explainer' function defined in its checker. The `:error-explainer' function is then called with this error to produce the explanation to display." (interactive) (when-let* ((first-error ;; Get the first error at point that has an `error-explainer'. (seq-find (lambda (error) (flycheck-checker-get (flycheck-error-checker error) 'error-explainer)) (flycheck-overlay-errors-at (point)))) (explainer (flycheck-checker-get (flycheck-error-checker first-error) 'error-explainer)) (explanation (funcall explainer first-error))) (flycheck-display-error-explanation explanation))) (defconst flycheck-explain-error-buffer "*Flycheck error explanation*" "The name of the buffer to show error explanations.") (define-derived-mode flycheck-explain-error-mode help-mode "Error explanation" "Major mode for displaying error explanations." (setq buffer-read-only t)) (defun flycheck-display-error-explanation (explanation) "Display the EXPLANATION for an error." (pcase explanation (`nil) (`(url . ,url) (browse-url url)) (_ (let ((inhibit-read-only t) (standard-output (temp-buffer-window-setup flycheck-explain-error-buffer))) (with-current-buffer standard-output (flycheck-explain-error-mode)) (cond ((functionp explanation) (funcall explanation)) ((stringp explanation) (princ explanation)) (t (error "Unsupported error explanation: %S" explanation))) (display-message-or-buffer standard-output nil 'not-this-window))))) ;;; Syntax checkers using external commands (defun flycheck-command-argument-p (arg) "Check whether ARG is a valid command argument." (pcase arg ((pred stringp) t) ((or `source `source-inplace `source-original) t) (`(,(or `source `source-inplace) ,suffix) (stringp suffix)) ((or `temporary-directory `temporary-file-name) t) (`null-device t) (`(config-file ,option-name ,config-file-var) (and (stringp option-name) (symbolp config-file-var))) (`(config-file ,option-name ,config-file-var ,prepender) (and (stringp option-name) (symbolp config-file-var) (symbolp prepender))) (`(,(or `option `option-list) ,option-name ,option-var) (and (stringp option-name) (symbolp option-var))) (`(,(or `option `option-list) ,option-name ,option-var ,prepender) (and (stringp option-name) (symbolp option-var) (symbolp prepender))) (`(,(or `option `option-list) ,option-name ,option-var ,prepender ,filter) (and (stringp option-name) (symbolp option-var) (symbolp prepender) (symbolp filter))) (`(option-flag ,option-name ,option-var) (and (stringp option-name) (symbolp option-var))) (`(eval ,_) t) (_ nil))) (defun flycheck-compute-working-directory (checker) "Get the default working directory for CHECKER. Compute the value of `default-directory' for the invocation of the syntax checker command, by calling the function in the `working-directory' property of CHECKER, with CHECKER as sole argument, and returning its value. Signal an error if the function returns a non-existing working directory. If the property is undefined or if the function returns nil return the `default-directory' of the current buffer." (let* ((def-directory-fn (flycheck-checker-get checker 'working-directory)) (directory (or (and def-directory-fn (funcall def-directory-fn checker)) ;; Default to the `default-directory' of the current ;; buffer default-directory))) (unless (file-exists-p directory) (error ":working-directory %s of syntax checker %S does not exist" directory checker)) directory)) ;;;###autoload (defun flycheck-define-command-checker (symbol docstring &rest properties) "Define SYMBOL as syntax checker to run a command. Define SYMBOL as generic syntax checker via `flycheck-define-generic-checker', which uses an external command to check the buffer. SYMBOL and DOCSTRING are the same as for `flycheck-define-generic-checker'. In addition to the properties understood by `flycheck-define-generic-checker', the following PROPERTIES constitute a command syntax checker. Unless otherwise noted, all properties are mandatory. Note that the default `:error-filter' of command checkers is `flycheck-sanitize-errors'. `:command COMMAND' The command to run for syntax checking. COMMAND is a list of the form `(EXECUTABLE [ARG ...])'. EXECUTABLE is a string with the executable of this syntax checker. It can be overridden with the variable `flycheck-SYMBOL-executable'. Note that this variable is NOT implicitly defined by this function. Use `flycheck-def-executable-var' to define this variable. Each ARG is an argument to the executable, either as string, or as special symbol or form for `flycheck-substitute-argument', which see. `:error-patterns PATTERNS' A list of patterns to parse the output of the `:command'. Each ITEM in PATTERNS is a list `(LEVEL SEXP ...)', where LEVEL is a Flycheck error level (see `flycheck-define-error-level'), followed by one or more RX `SEXP's which parse an error of that level and extract line, column, file name and the message. See `rx' for general information about RX, and `flycheck-rx-to-string' for some special RX forms provided by Flycheck. All patterns are applied in the order of declaration to the whole output of the syntax checker. Output already matched by a pattern will not be matched by subsequent patterns. In other words, the first pattern wins. This property is optional. If omitted, however, an `:error-parser' is mandatory. `:error-parser FUNCTION' A function to parse errors with. The function shall accept three arguments OUTPUT CHECKER BUFFER. OUTPUT is the syntax checker output as string, CHECKER the syntax checker that was used, and BUFFER a buffer object representing the checked buffer. The function must return a list of `flycheck-error' objects parsed from OUTPUT. This property is optional. If omitted, it defaults to `flycheck-parse-with-patterns'. In this case, `:error-patterns' is mandatory. `:standard-input t' Whether to send the buffer contents on standard input. If this property is given and has a non-nil value, send the contents of the buffer on standard input. Some checkers that support reading from standard input have a separate flag to indicate the name of the file whose contents are being passed on standard input (typically `stdin-filename'). In that case, use the `(option)' form in `:command' to pass the value of variable `buffer-file-name' when the current buffer has a file name (that is, use `option \"--stdin-file-name\" buffer-file-name'). For buffers not backed by files, checkers that support input on stdin typically report a file name like `-' or `'. Make sure your error parser or patterns expect these file names (for example, use `(or \"\" (file-name))') or call `flycheck-remove-error-file-names' in a custom `:error-filter'. Defaults to nil. Note that you may not give `:start', `:interrupt', and `:print-doc' for a command checker. You can give a custom `:verify' function, though, whose results will be appended to the default `:verify' function of command checkers." (declare (indent 1) (doc-string 2)) (dolist (prop '(:start :interrupt :print-doc)) (when (plist-get properties prop) (error "%s not allowed in definition of command syntax checker %s" prop symbol))) (unless (plist-get properties :error-filter) ;; Default to `flycheck-sanitize-errors' as error filter (setq properties (plist-put properties :error-filter #'flycheck-sanitize-errors))) (let ((verify-fn (plist-get properties :verify))) (setq properties (plist-put properties :verify (lambda (checker) (append (flycheck-verify-command-checker checker) (and verify-fn (funcall verify-fn checker))))))) (let ((command (plist-get properties :command)) (patterns (plist-get properties :error-patterns)) (parser (or (plist-get properties :error-parser) #'flycheck-parse-with-patterns)) (enabled (plist-get properties :enabled)) (standard-input (plist-get properties :standard-input))) (unless command (error "Missing :command in syntax checker %s" symbol)) (unless (stringp (car command)) (error "Command executable for syntax checker %s must be a string: %S" symbol (car command))) (dolist (arg (cdr command)) (unless (flycheck-command-argument-p arg) (error "Invalid command argument %S in syntax checker %s" arg symbol))) (when (and (eq parser 'flycheck-parse-with-patterns) (not patterns)) (error "Missing :error-patterns in syntax checker %s" symbol)) (setq properties ;; Automatically disable command checkers if the executable does not ;; exist. (plist-put properties :enabled (lambda () (and (flycheck-find-checker-executable symbol) (flycheck-temp-files-writable-p symbol) (or (not enabled) (funcall enabled)))))) (apply #'flycheck-define-generic-checker symbol docstring :start #'flycheck-start-command-checker :interrupt #'flycheck-interrupt-command-checker :print-doc #'flycheck-command-checker-print-doc properties) ;; Pre-compile all errors patterns into strings, so that we don't need to do ;; that on each error parse (let ((patterns (seq-map (lambda (p) (cons (flycheck-rx-to-string `(and ,@(cdr p)) 'no-group) (car p))) patterns))) (pcase-dolist (`(,prop . ,value) `((command . ,command) (error-parser . ,parser) (error-patterns . ,patterns) (standard-input . ,standard-input))) (setf (flycheck-checker-get symbol prop) value))))) (eval-and-compile ;; Make this function available during byte-compilation, since we need it ;; at macro expansion of `flycheck-def-executable-var'. (defun flycheck-checker-executable-variable (checker) "Get the executable variable of CHECKER. The executable variable is named `flycheck-CHECKER-executable'." (intern (format "flycheck-%s-executable" checker)))) (defun flycheck-checker-default-executable (checker) "Get the default executable of CHECKER." (car (flycheck-checker-get checker 'command))) (defun flycheck-checker-executable (checker) "Get the command executable of CHECKER. The executable is either the value of the variable `flycheck-CHECKER-executable', or the default executable given in the syntax checker definition, if the variable is nil." (let ((var (flycheck-checker-executable-variable checker))) (or (and (boundp var) (symbol-value var)) (flycheck-checker-default-executable checker)))) (defun flycheck-find-checker-executable (checker) "Get the full path of the executable of CHECKER. Return the full absolute path to the executable of CHECKER, or nil if the executable does not exist." (funcall flycheck-executable-find (flycheck-checker-executable checker))) (defun flycheck-call-checker-process (checker infile destination error &rest args) "Call CHECKER's executable with ARGS. Return nil (or raise an error if ERROR is non-nil) when CHECKER's executable cannot be found, and return a numeric exit status or a signal description string otherwise. CHECKER's input is taken from INFILE, and its output is sent to DESTINATION, as in `call-process'." (if-let (executable (flycheck-find-checker-executable checker)) (condition-case err (apply #'call-process executable infile destination nil args) (error (when error (signal (car err) (cdr err))))) (when error (user-error "Cannot find `%s' using `flycheck-executable-find'" (flycheck-checker-executable checker))))) (defun flycheck-call-checker-process-for-output (checker infile error &rest args) "Call CHECKER's executable with ARGS and return its output. Call `flycheck-call-checker-process' with INFILE, ERROR, and ARGS. If it returns 0, return the process' output. Otherwise, return nil or throw an error. This function is similar to `flycheck-call-checker-process' called in a `with-output-to-string' block, but it takes care of the error checking automatically." (let ((temp (generate-new-buffer " *temp*"))) (unwind-protect ;; We need to call the checker process in the right buffer, so that it ;; uses the right exec-path, checker executable, etc. See URL ;; `https://github.com/flycheck/flycheck/issues/1770'. (let ((exit-code (apply #'flycheck-call-checker-process checker infile temp error args)) (output (with-current-buffer temp (buffer-string)))) (if (eql 0 exit-code) output (when error (error "Process %s failed with %S (%s)" checker exit-code output)))) (kill-buffer temp)))) (defun flycheck-checker-arguments (checker) "Get the command arguments of CHECKER." (cdr (flycheck-checker-get checker 'command))) (defun flycheck-substitute-argument (arg checker) "Substitute ARG for CHECKER. Return a list of real arguments for the executable of CHECKER, substituted for the symbolic argument ARG. Single arguments, e.g. if ARG is a literal strings, are wrapped in a list. ARG may be one of the following forms: STRING Return ARG unchanged. `source', `source-inplace' Create a temporary file to check and return its path. With `source-inplace' create the temporary file in the same directory as the original file. The value of `flycheck-temp-prefix' is used as prefix of the file name. With `source', try to retain the non-directory component of the buffer's file name in the temporary file. `source' is the preferred way to pass the input file to a syntax checker. `source-inplace' should only be used if the syntax checker needs other files from the source directory, such as include files in C. `(source SUFFIX)', `(source-inplace SUFFIX)' Like `source' and `source-inplace', but ensure generated file names end with the given suffix. Use this when the checker requires that file names on its command line have a certain suffix (file extension). `source-original' Return the path of the actual file to check, or an empty string if the buffer has no file name. Note that the contents of the file may not be up to date with the contents of the buffer to check. Do not use this as primary input to a checker, unless absolutely necessary. When using this symbol as primary input to the syntax checker, add `flycheck-buffer-saved-p' to the `:predicate'. `temporary-directory' Create a unique temporary directory and return its path. `temporary-file-name' Return a unique temporary filename. The file is *not* created. To ignore the output of syntax checkers, try symbol `null-device' first. symbol `null-device' Return the value of variable `null-device', i.e the system null device. Use this option to ignore the output of a syntax checker. If the syntax checker cannot handle the null device, or won't write to an existing file, try `temporary-file-name' instead. `(config-file OPTION VARIABLE [PREPEND-FN])' Search the configuration file bound to VARIABLE with `flycheck-locate-config-file' and return a list of arguments that pass this configuration file to the syntax checker, or nil if the configuration file was not found. PREPEND-FN is called with the OPTION and the located configuration file, and should return OPTION prepended before the file, either a string or as list. If omitted, PREPEND-FN defaults to `list'. `(option OPTION VARIABLE [PREPEND-FN [FILTER]])' Retrieve the value of VARIABLE and return a list of arguments that pass this value as value for OPTION to the syntax checker. PREPEND-FN is called with the OPTION and the value of VARIABLE, and should return OPTION prepended before the file, either a string or as list. If omitted, PREPEND-FN defaults to `list'. FILTER is an optional function to be applied to the value of VARIABLE before prepending. This function must return nil or a string. In the former case, return nil. In the latter case, return a list of arguments as described above. `(option-list OPTION VARIABLE [PREPEND-FN [FILTER]])' Retrieve the value of VARIABLE, which must be a list, and prepend OPTION before each item in this list, using PREPEND-FN. PREPEND-FN is called with the OPTION and each item of the list as second argument, and should return OPTION prepended before the item, either as string or as list. If omitted, PREPEND-FN defaults to `list'. FILTER is an optional function to be applied to each item in the list before prepending OPTION. It shall return the option value for each item as string, or nil, if the item is to be ignored. `(option-flag OPTION VARIABLE)' Retrieve the value of VARIABLE and return OPTION, if the value is non-nil. Otherwise return nil. `(eval FORM)' Return the result of evaluating FORM in the buffer to be checked. FORM must either return a string or a list of strings, or nil to indicate that nothing should be substituted for CELL. For all other return types, signal an error _No_ further substitutions are performed, neither in FORM before it is evaluated, nor in the result of evaluating FORM. In all other cases, signal an error. Note that substitution is *not* recursive. No symbols or cells are substituted within the body of cells!" (pcase arg ((pred stringp) (list arg)) (`source (list (flycheck-save-buffer-to-temp #'flycheck-temp-file-system))) (`source-inplace (list (flycheck-save-buffer-to-temp #'flycheck-temp-file-inplace))) (`(source ,suffix) (list (flycheck-save-buffer-to-temp (lambda (filename) (flycheck-temp-file-system filename suffix))))) (`(source-inplace ,suffix) (list (flycheck-save-buffer-to-temp (lambda (filename) (flycheck-temp-file-inplace filename suffix))))) (`source-original (list (or (buffer-file-name) ""))) (`temporary-directory (list (flycheck-temp-dir-system))) (`temporary-file-name (let ((directory (flycheck-temp-dir-system))) (list (make-temp-name (expand-file-name "flycheck" directory))))) (`null-device (list null-device)) (`(config-file ,option-name ,file-name-var) (when-let* ((value (symbol-value file-name-var)) (file-name (flycheck-locate-config-file value checker))) (flycheck-prepend-with-option option-name (list file-name)))) (`(config-file ,option-name ,file-name-var ,prepend-fn) (when-let* ((value (symbol-value file-name-var)) (file-name (flycheck-locate-config-file value checker))) (flycheck-prepend-with-option option-name (list file-name) prepend-fn))) (`(option ,option-name ,variable) (when-let (value (symbol-value variable)) (unless (stringp value) (error "Value %S of %S for option %s is not a string" value variable option-name)) (flycheck-prepend-with-option option-name (list value)))) (`(option ,option-name ,variable ,prepend-fn) (when-let (value (symbol-value variable)) (unless (stringp value) (error "Value %S of %S for option %s is not a string" value variable option-name)) (flycheck-prepend-with-option option-name (list value) prepend-fn))) (`(option ,option-name ,variable ,prepend-fn ,filter) (when-let (value (funcall filter (symbol-value variable))) (unless (stringp value) (error "Value %S of %S (filter: %S) for option %s is not a string" value variable filter option-name)) (flycheck-prepend-with-option option-name (list value) prepend-fn))) (`(option-list ,option-name ,variable) (let ((value (symbol-value variable))) (unless (and (listp value) (seq-every-p #'stringp value)) (error "Value %S of %S for option %S is not a list of strings" value variable option-name)) (flycheck-prepend-with-option option-name value))) (`(option-list ,option-name ,variable ,prepend-fn) (let ((value (symbol-value variable))) (unless (and (listp value) (seq-every-p #'stringp value)) (error "Value %S of %S for option %S is not a list of strings" value variable option-name)) (flycheck-prepend-with-option option-name value prepend-fn))) (`(option-list ,option-name ,variable ,prepend-fn ,filter) (let ((value (delq nil (seq-map filter (symbol-value variable))))) (unless (and (listp value) (seq-every-p #'stringp value)) (error "Value %S of %S for option %S is not a list of strings" value variable option-name)) (flycheck-prepend-with-option option-name value prepend-fn))) (`(option-flag ,option-name ,variable) (when (symbol-value variable) (list option-name))) (`(eval ,form) (let ((result (eval form))) (cond ((and (listp result) (seq-every-p #'stringp result)) result) ((stringp result) (list result)) (t (error "Invalid result from evaluation of %S: %S" form result))))) (_ (error "Unsupported argument %S" arg)))) (defun flycheck-checker-substituted-arguments (checker) "Get the substituted arguments of a CHECKER. Substitute each argument of CHECKER using `flycheck-substitute-argument'. This replaces any special symbols in the command." (apply #'append (seq-map (lambda (arg) (flycheck-substitute-argument arg checker)) (flycheck-checker-arguments checker)))) (defun flycheck--process-send-buffer-contents-chunked (process) "Send contents of current buffer to PROCESS in small batches. Send the entire buffer to the standard input of PROCESS in chunks of 4096 characters. Chunking is done in Emacs Lisp, hence this function is probably far less efficient than `send-process-region'. Use only when required." (let ((from (point-min))) (while (< from (point-max)) (let ((to (min (+ from 4096) (point-max)))) (process-send-region process from to) (setq from to))))) (defvar flycheck-chunked-process-input ;; Chunk process output on Windows to work around ;; https://github.com/flycheck/flycheck/issues/794 and ;; https://debbugs.gnu.org/cgi/bugreport.cgi?bug=22344. The presence of ;; `w32-pipe-buffer-size' denotes an Emacs version (> Emacs 25.1) where pipe ;; writes on Windows are fixed. ;; ;; TODO: Remove option and chunking when dropping Emacs 24 support, see ;; https://github.com/flycheck/flycheck/issues/856 (and (eq system-type 'windows-nt) (not (boundp 'w32-pipe-buffer-size))) "If non-nil send process input in small chunks. If this variable is non-nil `flycheck-process-send-buffer' sends buffer contents in small chunks. Defaults to nil, except on Windows to work around Emacs bug #22344.") (defun flycheck-process-send-buffer (process) "Send all contents of current buffer to PROCESS. Sends all contents of the current buffer to the standard input of PROCESS, and terminates standard input with EOF. If `flycheck-chunked-process-input' is non-nil, send buffer contents in chunks via `flycheck--process-send-buffer-contents-chunked', which see. Otherwise use `process-send-region' to send all contents at once and rely on Emacs' own buffering and chunking." (save-restriction (widen) (if flycheck-chunked-process-input (flycheck--process-send-buffer-contents-chunked process) (process-send-region process (point-min) (point-max)))) (process-send-eof process)) (defun flycheck--wrap-command (prog args) "Wrap PROG and ARGS using `flycheck-command-wrapper-function'." ;; We don't call `flycheck-executable-find' on the output of the wrapper ;; function, since it might not expect it (an executable-find function ;; designed to find binaries in a sandbox could get confused if we asked it ;; about the sandboxing program itself). (funcall flycheck-command-wrapper-function (cons prog args))) (defun flycheck-start-command-checker (checker callback) "Start a command CHECKER with CALLBACK." (let (process) (condition-case err (let* ((program (flycheck-find-checker-executable checker)) (args (flycheck-checker-substituted-arguments checker)) (command (flycheck--wrap-command program args)) (sentinel-events nil) ;; Use pipes to receive output from the syntax checker. They are ;; more efficient and more robust than PTYs, which Emacs uses by ;; default, and since we don't need any job control features, we ;; can easily use pipes. (process-connection-type nil)) ;; We pass do not associate the process with any buffer, by ;; passing nil for the BUFFER argument of `start-process'. ;; Instead, we just remember the buffer being checked in a ;; process property (see below). This neatly avoids all ;; side-effects implied by attached a process to a buffer, which ;; may cause conflicts with other packages. ;; ;; See https://github.com/flycheck/flycheck/issues/298 for an ;; example for such a conflict. (setq process (apply 'start-process (format "flycheck-%s" checker) nil command)) ;; Process sentinels can be called while sending input to the process. ;; We want to record errors raised by process-send before calling ;; `flycheck-handle-signal', so initially just accumulate events. (setf (process-sentinel process) (lambda (_ event) (push event sentinel-events))) (setf (process-filter process) #'flycheck-receive-checker-output) (set-process-query-on-exit-flag process nil) ;; Remember the syntax checker, the buffer and the callback (process-put process 'flycheck-checker checker) (process-put process 'flycheck-callback callback) (process-put process 'flycheck-buffer (current-buffer)) ;; The default directory is bound in the `flycheck-syntax-check-start' ;; function. (process-put process 'flycheck-working-directory default-directory) ;; Track the temporaries created by argument substitution in the ;; process itself, to get rid of the global state ASAP. (process-put process 'flycheck-temporaries flycheck-temporaries) (setq flycheck-temporaries nil) ;; Send the buffer to the process on standard input, if enabled. (when (flycheck-checker-get checker 'standard-input) (condition-case err (flycheck-process-send-buffer process) ;; Some checkers exit before reading all input, causing errors ;; such as a `file-error' for a closed pipe, or a plain “no longer ;; connected to pipe; closed it” error for a disconnection. We ;; report them if needed in `flycheck-finish-checker-process' (see ;; `https://github.com/flycheck/flycheck/issues/1278'). (error (process-put process 'flycheck-error err)))) ;; Set the actual sentinel and process any events that might have ;; happened while we were sending input. (setf (process-sentinel process) #'flycheck-handle-signal) (dolist (event (nreverse sentinel-events)) (flycheck-handle-signal process event)) ;; Return the process. process) (error ;; In case of error, clean up our resources, and report the error back to ;; Flycheck. (flycheck-safe-delete-temporaries) (when process ;; No need to explicitly delete the temporary files of the process, ;; because deleting runs the sentinel, which will delete them anyway. (delete-process process)) (signal (car err) (cdr err)))))) (defun flycheck-interrupt-command-checker (_checker process) "Interrupt a PROCESS." ;; Deleting the process always triggers the sentinel, which does the cleanup (when process (delete-process process))) (defun flycheck-command-checker-print-doc (checker) "Print additional documentation for a command CHECKER." (let ((executable (flycheck-checker-default-executable checker)) (config-file-var (flycheck-checker-get checker 'config-file-var)) (option-vars (seq-sort #'string< (flycheck-checker-get checker 'option-vars)))) (princ "\n") (let ((doc-start (with-current-buffer standard-output (point-max)))) ;; Track the start of our documentation so that we can re-indent it ;; properly (princ " This syntax checker executes \"") (princ executable) (princ "\"") (when config-file-var (princ ", using a configuration file from `") (princ (symbol-name config-file-var)) (princ "'")) (princ ". The executable can be overridden with `") (princ (symbol-name (flycheck-checker-executable-variable checker))) (princ "'.") (with-current-buffer standard-output (save-excursion (fill-region-as-paragraph doc-start (point-max))))) (princ "\n") (when option-vars (princ "\n This syntax checker can be configured with these options:\n\n") (dolist (var option-vars) (princ (format " * `%s'\n" var)))))) (defun flycheck-verify-command-checker (checker) "Verify a command CHECKER in the current buffer. Return a list of `flycheck-verification-result' objects for CHECKER." (let ((executable (flycheck-find-checker-executable checker)) (config-file-var (flycheck-checker-get checker 'config-file-var))) `( ,(flycheck-verification-result-new :label "executable" :message (if executable (format "Found at %s" executable) "Not found") :face (if executable 'success '(bold error))) ,@(when config-file-var (let* ((value (symbol-value config-file-var)) (path (and value (flycheck-locate-config-file value checker)))) (list (flycheck-verification-result-new :label "configuration file" :message (if path (format "Found at %S" path) "Not found") :face (if path 'success 'warning))))) ,@(when (not (flycheck-temp-files-writable-p checker)) (list (flycheck-verification-result-new :label "temp directory" :message (format "%s is not writable" (flycheck-temp-directory checker)) :face 'error)))))) ;;; Process management for command syntax checkers (defun flycheck-receive-checker-output (process output) "Receive a syntax checking PROCESS OUTPUT." (push output (process-get process 'flycheck-pending-output))) (defun flycheck-get-output (process) "Get the complete output of PROCESS." (with-demoted-errors "Error while retrieving process output: %S" (let ((pending-output (process-get process 'flycheck-pending-output))) (apply #'concat (nreverse pending-output))))) (defun flycheck-handle-signal (process _event) "Handle a signal from the syntax checking PROCESS. _EVENT is ignored." (when (memq (process-status process) '(signal exit)) (let ((files (process-get process 'flycheck-temporaries)) (buffer (process-get process 'flycheck-buffer)) (callback (process-get process 'flycheck-callback)) (cwd (process-get process 'flycheck-working-directory)) (err (process-get process 'flycheck-error))) ;; Delete the temporary files (seq-do #'flycheck-safe-delete files) (when (buffer-live-p buffer) (with-current-buffer buffer (condition-case err (pcase (process-status process) (`signal (funcall callback 'interrupted)) (`exit (flycheck-finish-checker-process (process-get process 'flycheck-checker) (or err (process-exit-status process)) files (flycheck-get-output process) callback cwd))) ((debug error) (funcall callback 'errored (error-message-string err))))))))) (defun flycheck-finish-checker-process (checker exit-status files output callback cwd) "Finish a checker process from CHECKER with EXIT-STATUS. EXIT-STATUS can be a number or an arbitrary form (if it is not 0, a `suspicious' status is reported to CALLBACK). FILES is a list of files given as input to the checker. OUTPUT is the output of the syntax checker. CALLBACK is the status callback to use for reporting. Parse the OUTPUT and report an appropriate error status. Resolve all errors in OUTPUT using CWD as working directory." (let ((errors (flycheck-parse-output output checker (current-buffer)))) (when (and (not (equal exit-status 0)) (null errors)) ;; Warn about a suspicious result from the syntax checker. We do right ;; after parsing the errors, before filtering, because a syntax checker ;; might report errors from other files (e.g. includes) even if there ;; are no errors in the file being checked. (funcall callback 'suspicious (format "Flycheck checker %S returned %S, but \ its output contained no errors: %s\nTry installing a more \ recent version of %S, and please open a bug report if the issue \ persists in the latest release. Thanks!" checker exit-status output checker))) (funcall callback 'finished ;; Fix error file names, by substituting them backwards from the ;; temporaries. (seq-map (lambda (e) (flycheck-fix-error-filename e files cwd)) errors)))) ;;; Executables of command checkers. (defmacro flycheck-def-executable-var (checker default-executable) "Define the executable variable for CHECKER. DEFAULT-EXECUTABLE is the default executable. It is only used in the docstring of the variable. The variable is defined with `defcustom' in the `flycheck-executables' group. It's also defined to be risky as file-local variable, to avoid arbitrary executables being used for syntax checking." (let ((executable-var (flycheck-checker-executable-variable checker))) `(progn (defcustom ,executable-var nil ,(format "The executable of the %s syntax checker. Either a string containing the name or the path of the executable, or nil to use the default executable from the syntax checker declaration. The default executable is %S." checker default-executable) :type '(choice (const :tag "Default executable" nil) (string :tag "Name or path")) :group 'flycheck-executables :risky t)))) (defun flycheck-set-checker-executable (checker &optional executable) "Set the executable of CHECKER in the current buffer. CHECKER is a syntax checker symbol. EXECUTABLE is a string with the name of an executable or the path to an executable file, which is to be used as executable for CHECKER. If omitted or nil, reset the executable of CHECKER. Interactively, prompt for a syntax checker and an executable file, and set the executable of the selected syntax checker. With prefix arg, prompt for a syntax checker only, and reset the executable of the select checker to the default. Set the executable variable of CHECKER, that is, `flycheck-CHECKER-executable' to EXECUTABLE. Signal `user-error', if EXECUTABLE does not denote a command or an executable file. This command is intended for interactive use only. In Lisp, just `let'-bind the corresponding variable, or set it directly. Use `flycheck-checker-executable-variable' to obtain the executable variable symbol for a syntax checker." (declare (interactive-only "Set the executable variable directly instead")) (interactive (let* ((checker (flycheck-read-checker "Syntax checker: ")) (default-executable (flycheck-checker-default-executable checker)) (executable (if current-prefix-arg nil (read-file-name "Executable: " nil default-executable nil nil flycheck-executable-find)))) (list checker executable))) (when (and executable (not (funcall flycheck-executable-find executable))) (user-error "%s is no executable" executable)) (let ((variable (flycheck-checker-executable-variable checker))) (set (make-local-variable variable) executable))) ;;; Configuration files and options for command checkers (defun flycheck-register-config-file-var (var checkers) "Register VAR as config file var for CHECKERS. CHECKERS is a single syntax checker or a list thereof." (when (symbolp checkers) (setq checkers (list checkers))) (dolist (checker checkers) (setf (flycheck-checker-get checker 'config-file-var) var))) ;;;###autoload (defmacro flycheck-def-config-file-var (symbol checker &optional file-name &rest custom-args) "Define SYMBOL as config file variable for CHECKER, with default FILE-NAME. SYMBOL is declared as customizable variable using `defcustom', to provide configuration files for the given syntax CHECKER. CUSTOM-ARGS are forwarded to `defcustom'. FILE-NAME is the initial value of the new variable. If omitted, the default value is nil. It can be either a string or a list of strings. Use this together with the `config-file' form in the `:command' argument to `flycheck-define-checker'." (declare (indent 3)) `(progn (defcustom ,symbol ,file-name ,(format "Configuration file for `%s'. If set to a string, locate the configuration file using the functions from `flycheck-locate-config-file-functions'. If the file is found pass it to the syntax checker as configuration file. If no configuration file is found, or if this variable is set to nil, invoke the syntax checker without a configuration file. Use this variable as file-local variable if you need a specific configuration file for a buffer." checker) :type '(choice (const :tag "No configuration file" nil) (string :tag "File name or path") (repeat :tag "File names or paths" string)) :safe #'flycheck-string-or-string-list-p :group 'flycheck-config-files ,@custom-args) (flycheck-register-config-file-var ',symbol ',checker))) (defun flycheck-locate-config-file (filenames checker) "Locate the configuration file for CHECKER, based on FILENAMES. FILENAMES can be either a single file, or a list. Each filename is passed to all `flycheck-locate-config-file-functions', until one returns non-nil. Return the absolute path of the configuration file, or nil if no configuration file was found." (when (stringp filenames) (setq filenames (list filenames))) (let ((config-file nil)) (while (and filenames (null config-file)) (setq config-file (run-hook-with-args-until-success 'flycheck-locate-config-file-functions (pop filenames) checker))) (when (and config-file (file-exists-p config-file)) config-file))) (defun flycheck-locate-config-file-by-path (filepath _checker) "Locate a configuration file by a FILEPATH. If FILEPATH is a contains a path separator, expand it against the default directory and return it if it points to an existing file. Otherwise return nil. _CHECKER is ignored." ;; If the path is just a plain file name, skip it. (unless (string= (file-name-nondirectory filepath) filepath) (let ((file-name (expand-file-name filepath))) (and (file-exists-p file-name) file-name)))) (defun flycheck-locate-config-file-ancestor-directories (filename _checker) "Locate a configuration FILENAME in ancestor directories. If the current buffer has a file name, search FILENAME in the directory of the current buffer and all ancestors thereof (see `locate-dominating-file'). If the file is found, return its absolute path. Otherwise return nil. _CHECKER is ignored." (when-let* ((basefile (buffer-file-name)) (directory (locate-dominating-file basefile filename))) (expand-file-name filename directory))) (defun flycheck-locate-config-file-home (filename _checker) "Locate a configuration FILENAME in the home directory. Return the absolute path, if FILENAME exists in the user's home directory, or nil otherwise." (let ((path (expand-file-name filename "~"))) (when (file-exists-p path) path))) (seq-do (apply-partially #'custom-add-frequent-value 'flycheck-locate-config-file-functions) '(flycheck-locate-config-file-by-path flycheck-locate-config-file-ancestor-directories flycheck-locate-config-file-home)) (defun flycheck-register-option-var (var checkers) "Register an option VAR with CHECKERS. VAR is an option symbol, and CHECKERS a syntax checker symbol or a list thereof. Register VAR with all CHECKERS so that it appears in the help output." (when (symbolp checkers) (setq checkers (list checkers))) (dolist (checker checkers) (cl-pushnew var (flycheck-checker-get checker 'option-vars)))) ;;;###autoload (defmacro flycheck-def-option-var (symbol init-value checkers docstring &rest custom-args) "Define SYMBOL as option variable with INIT-VALUE for CHECKER. SYMBOL is declared as customizable variable using `defcustom', to provide an option for the given syntax CHECKERS (a checker or a list of checkers). INIT-VALUE is the initial value of the variable, and DOCSTRING is its docstring. CUSTOM-ARGS are forwarded to `defcustom'. Use this together with the `option', `option-list' and `option-flag' forms in the `:command' argument to `flycheck-define-checker'." (declare (indent 3) (doc-string 4)) `(progn (defcustom ,symbol ,init-value ,(concat docstring " This variable is an option for the following syntax checkers: " (mapconcat (lambda (c) (format " - `%s'" c)) (if (symbolp checkers) (list checkers) checkers) "\n")) :group 'flycheck-options ,@custom-args) (flycheck-register-option-var ',symbol ',checkers))) (defun flycheck-option-int (value) "Convert an integral option VALUE to a string. If VALUE is nil, return nil. Otherwise return VALUE converted to a string." (and value (number-to-string value))) (defun flycheck-option-symbol (value) "Convert a symbol option VALUE to string. If VALUE is nil return nil. Otherwise return VALUE converted to a string." (and value (symbol-name value))) (defun flycheck-option-comma-separated-list (value &optional separator filter) "Convert VALUE into a list separated by SEPARATOR. SEPARATOR is a string to separate items in VALUE, defaulting to \",\". FILTER is an optional function, which takes a single argument and returns either a string or nil. If VALUE is a list, apply FILTER to each item in VALUE, remove all nil items, and return a single string of all remaining items separated by SEPARATOR. Otherwise, apply FILTER to VALUE and return the result. SEPARATOR is ignored in this case." (let ((filter (or filter #'identity)) (separator (or separator ","))) (if (listp value) (when-let (value (delq nil (seq-map filter value))) (string-join value separator)) (funcall filter value)))) (defmacro flycheck-def-args-var (symbol checkers &rest custom-args) "Define SYMBOL as argument variable for CHECKERS. SYMBOL is declared as customizable, risky and buffer-local variable using `defcustom' to provide an option for arbitrary arguments for the given syntax CHECKERS (either a single checker or a list of checkers). CUSTOM-ARGS is forwarded to `defcustom'. Use the `eval' form to splice this variable into the `:command'." (declare (indent 2)) `(flycheck-def-option-var ,symbol nil ,checkers "A list of additional command line arguments. The value of this variable is a list of strings with additional command line arguments." :risky t :type '(repeat (string :tag "Argument")) ,@custom-args)) ;;; Command syntax checkers as compile commands (defun flycheck-checker-pattern-to-error-regexp (pattern) "Convert PATTERN into an error regexp for compile.el. Return a list representing PATTERN, suitable as element in `compilation-error-regexp-alist'." (let* ((regexp (car pattern)) (level (cdr pattern)) (level-no (flycheck-error-level-compilation-level level))) `(,regexp 1 (2 . 6) (3 . 7) ,level-no))) (defun flycheck-checker-compilation-error-regexp-alist (checker) "Convert error patterns of CHECKER for use with compile.el. Return an alist of all error patterns of CHECKER, suitable for use with `compilation-error-regexp-alist'." (seq-map #'flycheck-checker-pattern-to-error-regexp (flycheck-checker-get checker 'error-patterns))) (defun flycheck--substitute-shell-command-argument (arg checker) "Substitute ARG for CHECKER. Like `flycheck-substitute-argument', except for source, source-inplace, and source-original." (if (memq arg '(source source-inplace source-original)) (list buffer-file-name) (flycheck-substitute-argument arg checker))) (defun flycheck--checker-substituted-shell-command-arguments (checker) "Get the substituted arguments of a CHECKER to run as a shell command. Substitute each argument of CHECKER using `flycheck-substitute-shell-command-argument'." (apply #'append (seq-map (lambda (arg) (flycheck--substitute-shell-command-argument arg checker)) (flycheck-checker-arguments checker)))) (defun flycheck-checker-shell-command (checker) "Get a shell command for CHECKER. Perform substitution in the arguments of CHECKER, but with `flycheck--substitute-shell-command-argument'. Return the command of CHECKER as single string, suitable for shell execution." ;; Note: Do NOT use `combine-and-quote-strings' here. Despite it's name it ;; does not properly quote shell arguments, and actually breaks for special ;; characters. See https://github.com/flycheck/flycheck/pull/522 (let* ((args (flycheck--checker-substituted-shell-command-arguments checker)) (program (or (flycheck-find-checker-executable checker) (user-error "Cannot find `%s' using `flycheck-executable-find'" (flycheck-checker-executable checker)))) (wrapped (flycheck--wrap-command program args)) (abs-prog ;; The executable path returned by `flycheck-command-wrapper-function' ;; may not be absolute, so expand it here. See URL ;; `https://github.com/flycheck/flycheck/issues/1461'. (or (executable-find (car wrapped)) (user-error "Cannot find `%s' using `executable-find'" (car wrapped)))) (command (mapconcat #'shell-quote-argument (cons abs-prog (cdr wrapped)) " "))) (if (flycheck-checker-get checker 'standard-input) ;; If the syntax checker expects the source from standard input add an ;; appropriate shell redirection (concat command " < " (shell-quote-argument (buffer-file-name))) command))) (defun flycheck-compile-name (_name) "Get a name for a Flycheck compilation buffer. _NAME is ignored." (format "*Flycheck %s*" (buffer-file-name))) (defun flycheck-compile (checker) "Run CHECKER via `compile'. CHECKER must be a valid syntax checker. Interactively, prompt for a syntax checker to run. Instead of highlighting errors in the buffer, this command pops up a separate buffer with the entire output of the syntax checker tool, just like `compile' (\\[compile])." (interactive (let* ((default (flycheck-get-checker-for-buffer)) (prompt (concat "Run syntax checker as compile command" (when default (concat " [" (format "%S" default) "]")) ": "))) (list (flycheck-read-checker prompt (when (flycheck-checker-get default 'command) default) 'command)))) (unless (flycheck-valid-checker-p checker) (user-error "%S is not a valid syntax checker" checker)) (unless (buffer-file-name) (user-error "Cannot compile a buffer without a backing file")) (unless (flycheck-may-use-checker checker) (user-error "Cannot use syntax checker %S in this buffer" checker)) (unless (flycheck-checker-executable checker) (user-error "Cannot run checker %S as shell command" checker)) (save-some-buffers) (let* ((default-directory (flycheck-compute-working-directory checker)) (command (flycheck-checker-shell-command checker)) (buffer (compilation-start command nil #'flycheck-compile-name))) (with-current-buffer buffer (setq-local compilation-error-regexp-alist (flycheck-checker-compilation-error-regexp-alist checker))))) ;;; General error parsing for command checkers (defun flycheck-parse-output (output checker buffer) "Parse OUTPUT from CHECKER in BUFFER. OUTPUT is a string with the output from the checker symbol CHECKER. BUFFER is the buffer which was checked. Return the errors parsed with the error patterns of CHECKER." (funcall (flycheck-checker-get checker 'error-parser) output checker buffer)) (defun flycheck-fix-error-filename (err buffer-files cwd) "Fix the file name of ERR from BUFFER-FILES. Resolves error file names relative to CWD directory. Make the file name of ERR absolute. If the absolute file name of ERR is in BUFFER-FILES, replace it with the value of variable `buffer-file-name'." (flycheck-error-with-buffer err (when-let (filename (flycheck-error-filename err)) (when (seq-some (apply-partially #'flycheck-same-files-p (expand-file-name filename cwd)) buffer-files) (setf (flycheck-error-filename err) buffer-file-name) (when (and buffer-file-name (flycheck-error-message err)) (setf (flycheck-error-message err) (replace-regexp-in-string (regexp-quote filename) buffer-file-name (flycheck-error-message err) 'fixed-case 'literal)))))) err) ;;; Error parsers for command syntax checkers (defun flycheck-parse-xml-region (beg end) "Parse the xml region between BEG and END. Wrapper around `xml-parse-region' which transforms the return value of this function into one compatible to `libxml-parse-xml-region' by simply returning the first element from the node list." (ignore-errors (car (xml-parse-region beg end)))) (defun flycheck-parse-xml-region-with-fallback (beg end) "Parse the xml region between BEG and END. Try parsing with libxml first; if that fails, revert to `flycheck-parse-xml-region'. Failures can be caused by incorrect XML (see URL `https://github.com/flycheck/flycheck/issues/1298'), or on Windows by a missing libxml DLL with a libxml-enabled Emacs \(see URL `https://github.com/flycheck/flycheck/issues/1330')." ;; FIXME use `libxml-available-p' when it gets implemented. (or (and (fboundp 'libxml-parse-xml-region) (libxml-parse-xml-region beg end)) (flycheck-parse-xml-region beg end))) (defvar flycheck-xml-parser 'flycheck-parse-xml-region-with-fallback "Function used to parse an xml string from a region. The default uses libxml if available, and falls back to `flycheck-parse-xml-region' otherwise.") (defun flycheck-parse-xml-string (xml) "Parse an XML string. Return the document tree parsed from XML in the form `(ROOT ATTRS BODY...)'. ROOT is a symbol identifying the name of the root element. ATTRS is an alist of the attributes of the root node. BODY is zero or more body elements, either as strings (in case of text nodes) or as XML nodes, in the same for as the root node." (with-temp-buffer (insert xml) (funcall flycheck-xml-parser (point-min) (point-max)))) (defun flycheck-parse-checkstyle (output checker buffer) "Parse Checkstyle errors from OUTPUT. Parse Checkstyle-like XML output. Use this error parser for checkers that have an option to output errors in this format. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://checkstyle.sourceforge.net/' for information about Checkstyle." (pcase (flycheck-parse-xml-string output) (`(checkstyle ,_ . ,file-nodes) (let (errors) (dolist (node file-nodes) (pcase node (`(file ,file-attrs . ,error-nodes) (dolist (node error-nodes) (pcase node (`(error ,error-attrs . ,_) (let-alist error-attrs (push (flycheck-error-new-at (flycheck-string-to-number-safe .line) (flycheck-string-to-number-safe .column) (pcase .severity (`"error" 'error) (`"warning" 'warning) (`"info" 'info) ;; Default to error for unknown .severity (_ 'error)) .message :checker checker :id .source :buffer buffer :filename (cdr (assq 'name file-attrs))) errors)))))))) (nreverse errors))))) (defun flycheck-parse-cppcheck (output checker buffer) "Parse Cppcheck errors from OUTPUT. Parse Cppcheck XML v2 output. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://cppcheck.sourceforge.net/' for more information about Cppcheck." (pcase (flycheck-parse-xml-string output) (`(results ,_ . ,body) (let (errors) (dolist (node body) (pcase node (`(errors ,_ . ,error-nodes) (dolist (node error-nodes) (pcase node (`(error ,error-attrs . ,loc-nodes) (let ((id (cdr (assq 'id error-attrs))) (message (cdr (assq 'verbose error-attrs))) (level (pcase (cdr (assq 'severity error-attrs)) (`"error" 'error) (`"style" 'info) (`"information" 'info) (_ 'warning)))) (dolist (node loc-nodes) (pcase node (`(location ,loc-attrs . ,_) (let-alist loc-attrs (push (flycheck-error-new-at (flycheck-string-to-number-safe .line) nil level ;; cppcheck return newline characters as "\012" (replace-regexp-in-string "\\\\012" "\n" message) :id id :checker checker :buffer buffer :filename .file) errors)))))))))))) (nreverse errors))))) (defun flycheck-parse-phpmd (output checker buffer) "Parse phpmd errors from OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://phpmd.org/' for more information about phpmd." (pcase (flycheck-parse-xml-string output) (`(pmd ,_ . ,body) (let (errors) (dolist (node body) (pcase node (`(file ,file-attrs . ,violation-nodes) (let ((filename (cdr (assq 'name file-attrs)))) (dolist (node violation-nodes) (pcase node (`(violation ,vio-attrs ,(and message (pred stringp))) (let-alist vio-attrs (push (flycheck-error-new-at (flycheck-string-to-number-safe .beginline) nil 'warning (string-trim message) ;; Ignore .endline (phpmd marks giant spans as errors) ;; :end-line (flycheck-string-to-number-safe .endline) :id .rule :checker checker :buffer buffer :filename filename) errors))))))))) (nreverse errors))))) (defun flycheck-parse-reek (output checker buffer) "Parse Reek warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://github.com/troessner/reek' for more information about Reek." (let ((errors nil)) (dolist (message (car (flycheck-parse-json output))) (let-alist message (dolist (line (delete-dups .lines)) (push (flycheck-error-new-at line nil 'warning (concat .context " " .message) :id .smell_type :checker checker :buffer buffer :filename .source) errors)))) (nreverse errors))) (defun flycheck-parse-go-staticcheck (output checker buffer) "Parse staticheck warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://staticcheck.io/docs/formatters' for more information about staticheck." (let ((errors nil)) (dolist (msg (flycheck-parse-json output)) (let-alist msg (push (flycheck-error-new-at .location.line .location.column (pcase .severity (`"error" 'error) (`"warning" 'warning) (`"ignored" 'info) ;; Default to warning for unknown .severity (_ 'warning)) .message :id .code :checker checker :buffer buffer :filename .location.file) errors))) (nreverse errors))) (defun flycheck-parse-tslint (output checker buffer) "Parse TSLint errors from JSON OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://palantir.github.io/tslint/' for more information about TSLint." (seq-map (lambda (message) (let-alist message (flycheck-error-new-at (+ 1 .startPosition.line) (+ 1 .startPosition.character) (pcase .ruleSeverity ("ERROR" 'error) ("WARNING" 'warning) (_ 'warning)) .failure :id .ruleName :checker checker :buffer buffer :filename .name :end-line (+ 1 .endPosition.line) :end-column (+ 1 .endPosition.character)))) (car (flycheck-parse-json output)))) (defun flycheck-parse-rust-collect-spans (span) "Return a list of spans contained in a SPAN object." (let ((spans)) (let-alist span ;; With macro expansion errors, some spans will point to phony file names ;; to indicate an error inside the std rust lib. We skip these spans as ;; they won't appear in flycheck anyway. (unless (string= .file_name "") (push span spans)) ;; Macro expansion errors will have a span in the 'expansion' field, so we ;; recursively collect it. (if .expansion.span (append (flycheck-parse-rust-collect-spans .expansion.span) spans) spans)))) (defun flycheck-parse-rustc-diagnostic (diagnostic checker buffer) "Turn a rustc DIAGNOSTIC into a `flycheck-error'. CHECKER and BUFFER denote the CHECKER that returned DIAGNOSTIC and the BUFFER that was checked respectively. DIAGNOSTIC should be a parsed JSON object describing a rustc diagnostic, following the format described there: https://github.com/rust-lang/rust/blob/master/src/librustc_errors/json.rs#L154" (let ((error-message) (error-level) (error-code) (primary-filename) (primary-line) (primary-column) (primary-end-line) (primary-end-column) (group (make-symbol "group")) (spans) (children) (errors)) ;; The diagnostic format is described in the link above. The gist of it is ;; that a diagnostic can have several causes in the source text; these ;; causes are represented by spans. The diagnostic has a message and a ;; level (error, warning), while the spans have a filename, line, column, ;; and an optional label. The primary span points to the root cause of the ;; error in the source text, while non-primary spans point to related ;; causes. Spans may have an 'expansion' field for macro expansion errors; ;; these expansion fields will contain another span (and so on). In ;; addition, a diagnostic can also have children diagnostics that are used ;; to provide additional information through their message field, but do not ;; seem to contain any spans (yet). ;; ;; We first gather spans in order to turn every span into a flycheck error ;; object, that we collect into the `errors' list. ;; Nested `let-alist' cause compilation warnings, hence we `setq' all ;; these values here first to avoid nesting. (let-alist diagnostic (setq error-message .message error-level (pcase .level (`"error" 'error) (`"warning" 'warning) (`"note" 'info) (_ 'error)) ;; The 'code' field of the diagnostic contains the actual error ;; code and an optional explanation that we ignore error-code .code.code ;; Collect all spans recursively spans (seq-mapcat #'flycheck-parse-rust-collect-spans .spans) children .children)) ;; Turn each span into a flycheck error (dolist (span spans) (let-alist span ;; Children may not have filename/line/column information, so we use ;; those from the primary span (when .is_primary (setq primary-filename .file_name primary-line .line_start primary-column .column_start primary-end-line .line_end primary-end-column .column_end)) (push (flycheck-error-new-at .line_start .column_start ;; Non-primary spans are used for notes (if .is_primary error-level 'info) (if .is_primary ;; Primary spans may have labels with additional information (concat error-message (when .label (format " (%s)" .label))) ;; If the label is empty, fallback on the error message, ;; otherwise we won't be able to display anything (or .label error-message)) :id error-code :checker checker :buffer buffer :filename .file_name :group group :end-line .line_end :end-column .column_end) errors))) ;; Then we turn children messages into flycheck errors pointing to the ;; location of the primary span. (dolist (child children) (let ((message (let-alist child .message))) (let-alist (car (let-alist child .spans)) (push (flycheck-error-new-at ;; Use the line/column from the first span if there is one, or ;; fallback to the line/column information from the primary span of ;; the diagnostic. (or .line_start primary-line) (or .column_start primary-column) 'info ;; Messages from `cargo clippy' may suggest replacement code. In ;; these cases, the `message' field itself is an unhelpful `try' or ;; `change this to'. We add the `suggested_replacement' field in ;; these cases. (if .suggested_replacement (format "%s: `%s`" message .suggested_replacement) message) :id error-code :checker checker :buffer buffer :filename primary-filename :group group :end-line (or .line_end primary-end-line) :end-column (or .column_end primary-end-column)) errors)))) ;; If there are no spans, the error is not associated with a specific ;; file but with the project as a whole. We still need to report it to ;; the user by emitting a corresponding flycheck-error object. ;; Check whether the code is non-nil because Rust≥1.44 includes the ;; warning count upon completion. (when (and error-code (not spans)) (push (flycheck-error-new-at ;; We have no specific position to attach the error to, so ;; let's use the top of the file. 1 1 error-level error-message :id error-code :checker checker :buffer buffer :group group) errors)) (nreverse errors))) (defconst flycheck--json-parser (if (and (functionp 'json-parse-buffer) ;; json-parse-buffer only supports keyword arguments in Emacs 27+ (>= emacs-major-version 27)) (lambda () (json-parse-buffer :object-type 'alist :array-type 'list :null-object nil :false-object nil)) #'json-read) "Function to use to parse JSON strings.") (defun flycheck-parse-json (output) "Return parsed JSON data from OUTPUT. OUTPUT is a string that contains JSON data. Each line of OUTPUT may be either plain text, a JSON array (starting with `['), or a JSON object (starting with `{'). This function ignores the plain text lines, parses the JSON lines, and returns the parsed JSON lines in a list." (let ((objects nil) (json-array-type 'list) (json-false nil)) (with-temp-buffer (insert output) (goto-char (point-min)) (while (not (eobp)) (when (memq (char-after) '(?\{ ?\[)) (push (funcall flycheck--json-parser) objects)) (forward-line))) (nreverse objects))) (defun flycheck-parse-rustc (output checker buffer) "Parse rustc errors from OUTPUT and return a list of `flycheck-error'. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. The expected format for OUTPUT is a mix of plain text lines and JSON lines. This function ignores the plain text lines and parses only JSON lines. Each JSON line is expected to be a JSON object that corresponds to a diagnostic from the compiler. The expected diagnostic format is described there: https://github.com/rust-lang/rust/blob/master/src/libsyntax/json.rs#L67-L139" (seq-mapcat (lambda (msg) (flycheck-parse-rustc-diagnostic msg checker buffer)) (flycheck-parse-json output))) (defun flycheck-parse-cargo-rustc (output checker buffer) "Parse Cargo errors from OUTPUT and return a list of `flycheck-error'. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. The expected format for OUTPUT is a mix of plain text lines and JSON lines. This function ignores the plain text lines and parses only JSON lines. Each JSON line is expected to be a JSON object that represents a message from Cargo. The format of messages emitted by Cargo is described in cargo's machine_message.rs at URL `https://git.io/vh24R'." (let ((errors)) (dolist (msg (flycheck-parse-json output)) (let-alist msg ;; Errors and warnings from rustc are wrapped by cargo, so we filter and ;; unwrap them, and delegate the actual construction of `flycheck-error' ;; objects to `flycheck-parse-rustc-diagnostic'. ;; We put the error record with nil code since flycheck regards ;; the case of nonzero return code without any error report ;; as abnormal result. (when (string= .reason "compiler-message") (push (flycheck-parse-rustc-diagnostic .message checker buffer) errors)))) (apply #'nconc errors))) ;; Some checkers output ANSI terminal colors, which don't match up ;; with :error-patterns, so we strip those color codes from the output ;; here before passing it along to the default behavior. This is ;; originally only used in the rebar3 checker, but the systemd checker ;; now also makes use of it. ;; ;; The relevant discussion can be found at ;; https://github.com/flycheck/flycheck/pull/1144 (defun flycheck-parse-with-patterns-without-color (output checker buffer) "Strip color codes from OUTPUT before passing it to the default behavior. CHECKER and BUFFER are passed along as well." (flycheck-parse-with-patterns (and (fboundp 'ansi-color-filter-apply) (ansi-color-filter-apply output)) checker buffer)) ;;; Error parsing with regular expressions (defun flycheck-get-regexp (patterns) "Create a single regular expression from PATTERNS." (rx-to-string `(or ,@(seq-map (lambda (p) (list 'regexp (car p))) patterns)) 'no-group)) (defun flycheck-tokenize-output-with-patterns (output patterns) "Tokenize OUTPUT with PATTERNS. Split the output into error tokens, using all regular expressions from the error PATTERNS. An error token is simply a string containing a single error from OUTPUT. Such a token can then be parsed into a structured error by applying the PATTERNS again, see `flycheck-parse-error-with-patterns'. Return a list of error tokens." (let ((regexp (flycheck-get-regexp patterns)) (last-match 0) errors) (while (string-match regexp output last-match) (push (match-string 0 output) errors) (setq last-match (match-end 0))) (reverse errors))) (defun flycheck-try-parse-error-with-pattern (err pattern checker) "Try to parse a single ERR with a PATTERN for CHECKER. Return the parsed error if PATTERN matched ERR, or nil otherwise. `end-line' defaults to the value of `line' when `end-column' is set, since checkers often omit redundant end lines (as in ::-)." (let ((regexp (car pattern)) (level (cdr pattern))) (when (string-match regexp err) (let ((filename (match-string 1 err)) (line (flycheck-string-to-number-safe (match-string 2 err))) (column (flycheck-string-to-number-safe (match-string 3 err))) (message (match-string 4 err)) (id (match-string 5 err)) (end-line (flycheck-string-to-number-safe (match-string 6 err))) (end-column (flycheck-string-to-number-safe (match-string 7 err)))) (flycheck-error-new-at line column level (unless (string-empty-p message) message) :id (unless (string-empty-p id) id) :checker checker :filename (if (or (null filename) (string-empty-p filename)) (buffer-file-name) filename) :end-line (or end-line (and end-column line)) :end-column end-column))))) (defun flycheck-parse-error-with-patterns (err patterns checker) "Parse a single ERR with error PATTERNS for CHECKER. Apply each pattern in PATTERNS to ERR, in the given order, and return the first parsed error." ;; Try to parse patterns in the order of declaration to make sure that the ;; first match wins. (let (parsed-error) (while (and patterns (not (setq parsed-error (flycheck-try-parse-error-with-pattern err (car patterns) checker)))) (setq patterns (cdr patterns))) parsed-error)) (defun flycheck-parse-with-patterns (output checker buffer) "Parse OUTPUT from CHECKER with error patterns. Uses the error patterns of CHECKER to tokenize the output and tries to parse each error token with all patterns, in the order of declaration. Hence an error is never matched twice by two different patterns. The pattern declared first always wins. _BUFFER is ignored. Return a list of parsed errors and warnings (as `flycheck-error' objects)." (with-current-buffer buffer (let ((patterns (flycheck-checker-get checker 'error-patterns))) (seq-map (lambda (err) (flycheck-parse-error-with-patterns err patterns checker)) (flycheck-tokenize-output-with-patterns output patterns))))) ;;; Convenience definition of command-syntax checkers ;; This macro is autoloaded to prevent `with-eval-after-load' from expanding its ;; arguments. See https://github.com/flycheck/flycheck/issues/1398. ;;;###autoload (defmacro flycheck-define-checker (symbol docstring &rest properties) "Define SYMBOL as command syntax checker with DOCSTRING and PROPERTIES. Like `flycheck-define-command-checker', but PROPERTIES must not be quoted. Also, implicitly define the executable variable for SYMBOL with `flycheck-def-executable-var'." (declare (indent 1) (doc-string 2)) (let ((command (plist-get properties :command)) (parser (plist-get properties :error-parser)) (filter (plist-get properties :error-filter)) (explainer (plist-get properties :error-explainer)) (predicate (plist-get properties :predicate)) (enabled-fn (plist-get properties :enabled)) (verify-fn (plist-get properties :verify))) `(progn (flycheck-def-executable-var ,symbol ,(car command)) (flycheck-define-command-checker ',symbol ,docstring :command ',command ,@(when parser `(:error-parser #',parser)) :error-patterns ',(plist-get properties :error-patterns) ,@(when filter `(:error-filter #',filter)) ,@(when explainer `(:error-explainer #',explainer)) :modes ',(plist-get properties :modes) ,@(when predicate `(:predicate #',predicate)) :next-checkers ',(plist-get properties :next-checkers) ,@(when enabled-fn `(:enabled #',enabled-fn)) ,@(when verify-fn `(:verify #',verify-fn)) :standard-input ',(plist-get properties :standard-input) :working-directory ',(plist-get properties :working-directory))))) ;;; Built-in checkers (flycheck-def-args-var flycheck-gnat-args ada-gnat :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gnat-include-path nil ada-gnat "A list of include directories for GNAT. The value of this variable is a list of strings, where each string is a directory to add to the include path of gcc. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gnat-language-standard "2012" ada-gnat "The language standard to use in GNAT. The value of this variable is either a string denoting a language standard, or nil, to use the default standard. When non-nil, pass the language standard via the `-std' option." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gnat-warnings '("wa") ada-gnat "A list of additional Ada warnings to enable in GNAT. The value of this variable is a list of strings, where each string is the name of a warning category to enable. By default, most optional warnings are recommended, as in `-gnata'. Refer to Info Node `(gnat_ugn_unw)Warning Message Control' for more information about GNAT warnings." :type '(repeat :tag "Warnings" (string :tag "Warning name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-define-checker ada-gnat "An Ada syntax checker using GNAT. Uses the GNAT compiler from GCC. See URL `https://www.adacore.com/community/'." :command ("gnatmake" "-c" ; Just compile, don't bind "-f" ; Force re-compilation "-u" ; Compile the main file only "-gnatf" ; Full error information "-gnatef" ; Full source file name "-D" temporary-directory (option-list "-gnat" flycheck-gnat-warnings concat) (option-list "-I" flycheck-gnat-include-path concat) (option "-gnat" flycheck-gnat-language-standard concat) (eval flycheck-gnat-args) source) :error-patterns ((error line-start (message "In file included from") " " (file-name) ":" line ":" column ":" line-end) (info line-start (file-name) ":" line ":" column ": note: " (message) line-end) (warning line-start (file-name) ":" line ":" column ": warning: " (message) line-end) ;; no specific error prefix in Ada (error line-start (file-name) ":" line ":" column ": " (message) line-end)) :modes ada-mode) (flycheck-define-checker asciidoc "A AsciiDoc syntax checker using the AsciiDoc compiler. See URL `https://www.methods.co.nz/asciidoc'." :command ("asciidoc" "-o" null-device "-") :standard-input t :error-patterns ((error line-start "asciidoc: ERROR: : Line " line ": " (message) line-end) (warning line-start "asciidoc: WARNING: : Line " line ": " (message) line-end) (info line-start "asciidoc: DEPRECATED: : Line " line ": " (message) line-end)) :modes adoc-mode) (flycheck-define-checker asciidoctor "An AsciiDoc syntax checker using the Asciidoctor compiler. See URL `https://asciidoctor.org'." :command ("asciidoctor" "-o" null-device "-") :standard-input t :error-patterns ((error line-start "asciidoctor: ERROR: : Line " line ": " (message) line-end) (warning line-start "asciidoctor: WARNING: : Line " line ": " (message) line-end)) :modes adoc-mode) (defun flycheck-awk-gawk-fix-message (err) "Remove the repeated file-name/line from the error message of ERR." (setf (flycheck-error-message err) (replace-regexp-in-string (rx line-start (group (zero-or-more (any " " "\t"))) (group (zero-or-more nonl) "\n") (backref 1)) "\\2" (replace-regexp-in-string (rx "\ngawk: " (zero-or-more (not (any " "))) ":") "\n" (flycheck-error-message err)))) err) (defun flycheck-awk-gawk-error-filter (errors) "Remove repeated file-name/line from ERRORS." (seq-do #'flycheck-awk-gawk-fix-message errors) errors) (flycheck-define-checker awk-gawk "GNU awk's built-in --lint checker." :command ("gawk" ;; Avoid code execution. See https://github.com/w0rp/ale/pull/1411 "--source" "'BEGIN{exit} END{exit 1}'" "-f" source "--lint" "/dev/null") :standard-input nil :error-patterns ((warning line-start "gawk: " (file-name) ":" line ":" (optional column ":") (message (one-or-more not-newline) (optional "\n" (one-or-more not-newline) " ^ " (one-or-more not-newline))) line-end)) :error-filter flycheck-awk-gawk-error-filter :modes awk-mode) (flycheck-define-checker bazel-build-buildifier "A checker for Bazel BUILD and BUILD.bazel files using buildifier. See URL `https://github.com/bazelbuild/buildtools/blob/master/buildifier'." :command ("buildifier" "-lint=warn" "--type=build") :standard-input t :error-patterns ((error line-start ":" line ":" column ": " (message) line-end) (warning line-start ":" line ": " (id (one-or-more (in word "-"))) ": " (message) line-end)) :modes bazel-build-mode) (flycheck-define-checker bazel-module-buildifier "A checker for Bazel MODULE.bazel files using buildifier. See URL `https://github.com/bazelbuild/buildtools/blob/master/buildifier'." :command ("buildifier" "-lint=warn" "--type=default") :standard-input t :error-patterns ((error line-start ":" line ":" column ": " (message) line-end) (warning line-start ":" line ": " (id (one-or-more (in word "-"))) ": " (message) line-end)) :modes bazel-module-mode) (flycheck-define-checker bazel-starlark-buildifier "A checker for Starlark bzl files using buildifier. See URL `https://github.com/bazelbuild/buildtools/blob/master/buildifier'." :command ("buildifier" "-lint=warn" "--type=bzl") :standard-input t :error-patterns ((error line-start ":" line ":" column ": " (message) line-end) (warning line-start ":" line ": " (id (one-or-more (in word "-"))) ": " (message) line-end)) :modes bazel-starlark-mode) (flycheck-define-checker bazel-workspace-buildifier "A checker for Bazel WORKSPACE and WORKSPACE.bazel files using buildifier. See URL `https://github.com/bazelbuild/buildtools/blob/master/buildifier'." :command ("buildifier" "-lint=warn" "--type=workspace") :standard-input t :error-patterns ((error line-start ":" line ":" column ": " (message) line-end) (warning line-start ":" line ": " (id (one-or-more (in word "-"))) ": " (message) line-end)) :modes bazel-workspace-mode) (flycheck-def-args-var flycheck-clang-args c/c++-clang :package-version '(flycheck . "0.22")) (flycheck-def-option-var flycheck-clang-blocks nil c/c++-clang "Enable blocks in Clang. When non-nil, enable blocks in Clang with `-fblocks'. See URL `https://clang.llvm.org/docs/BlockLanguageSpec.html' for more information about blocks." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-clang-definitions nil c/c++-clang "Additional preprocessor definitions for Clang. The value of this variable is a list of strings, where each string is an additional definition to pass to Clang, via the `-D' option." :type '(repeat (string :tag "Definition")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.15")) (flycheck-def-option-var flycheck-clang-include-path nil c/c++-clang "A list of include directories for Clang. The value of this variable is a list of strings, where each string is a directory to add to the include path of Clang. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.14")) (flycheck-def-option-var flycheck-clang-includes nil c/c++-clang "A list of additional include files for Clang. The value of this variable is a list of strings, where each string is a file to include before syntax checking. Relative paths are relative to the file being checked." :type '(repeat (file :tag "Include file")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.15")) (flycheck-def-option-var flycheck-clang-language-standard nil c/c++-clang "The language standard to use in Clang. The value of this variable is either a string denoting a language standard, or nil, to use the default standard. When non-nil, pass the language standard via the `-std' option." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.15")) (make-variable-buffer-local 'flycheck-clang-language-standard) (flycheck-def-option-var flycheck-clang-ms-extensions nil c/c++-clang "Whether to enable Microsoft extensions to C/C++ in Clang. When non-nil, enable Microsoft extensions to C/C++ via `-fms-extensions'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.16")) (flycheck-def-option-var flycheck-clang-no-exceptions nil c/c++-clang "Whether to disable exceptions in Clang. When non-nil, disable exceptions for syntax checks, via `-fno-exceptions'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-clang-no-rtti nil c/c++-clang "Whether to disable RTTI in Clang. When non-nil, disable RTTI for syntax checks, via `-fno-rtti'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.15")) (flycheck-def-option-var flycheck-clang-pedantic nil c/c++-clang "Whether to warn about language extensions in Clang. For ISO C, follows the version specified by any -std option used. When non-nil, disable non-ISO extensions to C/C++ via `-pedantic'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.23")) (flycheck-def-option-var flycheck-clang-pedantic-errors nil c/c++-clang "Whether to error on language extensions in Clang. For ISO C, follows the version specified by any -std option used. When non-nil, disable non-ISO extensions to C/C++ via `-pedantic-errors'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.23")) (flycheck-def-option-var flycheck-clang-standard-library nil c/c++-clang "The standard library to use for Clang. The value of this variable is the name of a standard library as string, or nil to use the default standard library. Refer to the Clang manual at URL `https://clang.llvm.org/docs/UsersManual.html' for more information about the standard library." :type '(choice (const :tag "Default standard library" nil) (const "libc++") (const :tag "GNU libstdc++" "libstdc++") (string :tag "Library name")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.15")) (flycheck-def-option-var flycheck-clang-warnings '("all" "extra") c/c++-clang "A list of additional warnings to enable in Clang. The value of this variable is a list of strings, where each string is the name of a warning category to enable. By default, all recommended warnings and some extra warnings are enabled (as by `-Wall' and `-Wextra' respectively). Refer to the Clang manual at URL `https://clang.llvm.org/docs/UsersManual.html' for more information about warnings." :type '(choice (const :tag "No additional warnings" nil) (repeat :tag "Additional warnings" (string :tag "Warning name"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.14")) (defun flycheck-c/c++-quoted-include-directory () "Get the directory for quoted includes. C/C++ compilers typically look up includes with quotation marks in the directory of the file being compiled. However, since Flycheck uses temporary copies for syntax checking, it needs to explicitly determine the directory for quoted includes. This function determines the directory by looking at function `buffer-file-name', or if that is nil, at `default-directory'." (if-let (fn (buffer-file-name)) (file-name-directory fn) ;; If the buffer has no file name, fall back to its default directory default-directory)) (flycheck-define-checker c/c++-clang "A C/C++ syntax checker using Clang. See URL `https://clang.llvm.org/'." :command ("clang" "-fsyntax-only" "-fno-color-diagnostics" ; Do not include color codes in output "-fno-caret-diagnostics" ; Do not visually indicate the source ; location "-fno-diagnostics-show-option" ; Do not show the corresponding ; warning group "-iquote" (eval (flycheck-c/c++-quoted-include-directory)) (option "-std=" flycheck-clang-language-standard concat) (option-flag "-pedantic" flycheck-clang-pedantic) (option-flag "-pedantic-errors" flycheck-clang-pedantic-errors) (option "-stdlib=" flycheck-clang-standard-library concat) (option-flag "-fms-extensions" flycheck-clang-ms-extensions) (option-flag "-fno-exceptions" flycheck-clang-no-exceptions) (option-flag "-fno-rtti" flycheck-clang-no-rtti) (option-flag "-fblocks" flycheck-clang-blocks) (option-list "-include" flycheck-clang-includes) (option-list "-W" flycheck-clang-warnings concat) (option-list "-D" flycheck-clang-definitions concat) (option-list "-I" flycheck-clang-include-path) (eval flycheck-clang-args) "-x" (eval (pcase major-mode ((or `c++-mode `c++-ts-mode) "c++") ((or `c-mode `c-ts-mode) "c"))) ;; Read from standard input "-") :standard-input t :error-patterns ((info line-start (or "" (file-name)) ":" line ":" column ": note: " (optional (message)) line-end) (warning line-start (or "" (file-name)) ":" line ":" column ": warning: " (optional (message)) line-end) (error line-start (or "" (file-name)) ":" line ":" column ": " (or "fatal error" "error") ": " (optional (message)) line-end)) :error-filter (lambda (errors) (let ((errors (flycheck-sanitize-errors errors))) (dolist (err errors) ;; Clang will output empty messages for #error/#warning pragmas without ;; messages. We fill these empty errors with a dummy message to get ;; them past our error filtering (setf (flycheck-error-message err) (or (flycheck-error-message err) "no message"))) errors)) :modes (c-mode c++-mode c-ts-mode c++-ts-mode) :next-checkers ((warning . c/c++-cppcheck))) (flycheck-def-args-var flycheck-gcc-args c/c++-gcc :package-version '(flycheck . "0.22")) (flycheck-def-option-var flycheck-gcc-definitions nil c/c++-gcc "Additional preprocessor definitions for GCC. The value of this variable is a list of strings, where each string is an additional definition to pass to GCC, via the `-D' option." :type '(repeat (string :tag "Definition")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gcc-include-path nil c/c++-gcc "A list of include directories for GCC. The value of this variable is a list of strings, where each string is a directory to add to the include path of gcc. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gcc-includes nil c/c++-gcc "A list of additional include files for GCC. The value of this variable is a list of strings, where each string is a file to include before syntax checking. Relative paths are relative to the file being checked." :type '(repeat (file :tag "Include file")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gcc-language-standard nil c/c++-gcc "The language standard to use in GCC. The value of this variable is either a string denoting a language standard, or nil, to use the default standard. When non-nil, pass the language standard via the `-std' option." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.20")) (make-variable-buffer-local 'flycheck-gcc-language-standard) (flycheck-def-option-var flycheck-gcc-no-exceptions nil c/c++-gcc "Whether to disable exceptions in GCC. When non-nil, disable exceptions for syntax checks, via `-fno-exceptions'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gcc-no-rtti nil c/c++-gcc "Whether to disable RTTI in GCC. When non-nil, disable RTTI for syntax checks, via `-fno-rtti'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gcc-openmp nil c/c++-gcc "Whether to enable OpenMP in GCC. When non-nil, enable OpenMP for syntax checkers, via `-fopenmp'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.21")) (flycheck-def-option-var flycheck-gcc-pedantic nil c/c++-gcc "Whether to warn about language extensions in GCC. For ISO C, follows the version specified by any -std option used. When non-nil, disable non-ISO extensions to C/C++ via `-pedantic'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.23")) (flycheck-def-option-var flycheck-gcc-pedantic-errors nil c/c++-gcc "Whether to error on language extensions in GCC. For ISO C, follows the version specified by any -std option used. When non-nil, disable non-ISO extensions to C/C++ via `-pedantic-errors'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.23")) (flycheck-def-option-var flycheck-gcc-warnings '("all" "extra") c/c++-gcc "A list of additional warnings to enable in GCC. The value of this variable is a list of strings, where each string is the name of a warning category to enable. By default, all recommended warnings and some extra warnings are enabled (as by `-Wall' and `-Wextra' respectively). Refer to the gcc manual at URL `https://gcc.gnu.org/onlinedocs/gcc/' for more information about warnings." :type '(choice (const :tag "No additional warnings" nil) (repeat :tag "Additional warnings" (string :tag "Warning name"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-define-checker c/c++-gcc "A C/C++ syntax checker using GCC. Requires GCC 4.4 or newer. See URL `https://gcc.gnu.org/'." :command ("gcc" "-fshow-column" "-iquote" (eval (flycheck-c/c++-quoted-include-directory)) (option "-std=" flycheck-gcc-language-standard concat) (option-flag "-pedantic" flycheck-gcc-pedantic) (option-flag "-pedantic-errors" flycheck-gcc-pedantic-errors) (option-flag "-fno-exceptions" flycheck-gcc-no-exceptions) (option-flag "-fno-rtti" flycheck-gcc-no-rtti) (option-flag "-fopenmp" flycheck-gcc-openmp) (option-list "-include" flycheck-gcc-includes) (option-list "-W" flycheck-gcc-warnings concat) (option-list "-D" flycheck-gcc-definitions concat) (option-list "-I" flycheck-gcc-include-path) (eval flycheck-gcc-args) "-x" (eval (pcase major-mode ((or `c++-mode `c++-ts-mode) "c++") ((or `c-mode `c-ts-mode) "c"))) ;; GCC performs full checking only when actually compiling, so ;; `-fsyntax-only' is not enough. Just let it generate assembly ;; code. "-S" "-o" null-device ;; Read from standard input "-") :standard-input t :error-patterns ((info line-start (or "" (file-name)) ":" line (optional ":" column) ": note: " (message) line-end) (warning line-start (or "" (file-name)) ":" line (optional ":" column) ": warning: " (message (one-or-more (not (any "\n[")))) (optional "[" (id (one-or-more not-newline)) "]") line-end) (error line-start (or "" (file-name)) ":" line (optional ":" column) ": " (or "fatal error" "error") ": " (message) line-end)) :modes (c-mode c++-mode c-ts-mode c++-ts-mode) :next-checkers ((warning . c/c++-cppcheck))) (flycheck-def-args-var flycheck-cppcheck-args c/c++-cppcheck :package-version '(flycheck . "35")) (flycheck-def-option-var flycheck-cppcheck-checks '("style") c/c++-cppcheck "Enabled checks for Cppcheck. The value of this variable is a list of strings, where each string is the name of an additional check to enable. By default, all coding style checks are enabled. See section \"Enable message\" in the Cppcheck manual at URL `https://cppcheck.sourceforge.net/manual.pdf', and the documentation of the `--enable' option for more information, including a list of supported checks." :type '(repeat :tag "Additional checks" (string :tag "Check name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.14")) (flycheck-def-option-var flycheck-cppcheck-standards nil c/c++-cppcheck "The standards to use in cppcheck. The value of this variable is either a list of strings denoting the standards to use, or nil to pass nothing to cppcheck. When non-nil, pass the standards via one or more `--std=' options." :type '(choice (const :tag "Default" nil) (repeat :tag "Custom standards" (string :tag "Standard name"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "28")) (make-variable-buffer-local 'flycheck-cppcheck-standards) (flycheck-def-option-var flycheck-cppcheck-suppressions-file nil c/c++-cppcheck "The suppressions file to use in cppcheck. The value of this variable is a file with the suppressions to use, or nil to pass nothing to cppcheck. When non-nil, pass the suppressions file via the `--suppressions-list=' option." :type '(choice (const :tag "Default" nil) (file :tag "Suppressions file")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-cppcheck-suppressions-file) (flycheck-def-option-var flycheck-cppcheck-suppressions nil c/c++-cppcheck "The suppressions to use in cppcheck. The value of this variable is either a list of strings denoting the suppressions to use, or nil to pass nothing to cppcheck. When non-nil, pass the suppressions via one or more `--suppress=' options." :type '(choice (const :tag "Default" nil) (repeat :tag "Additional suppressions" (string :tag "Suppression"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "28")) (flycheck-def-option-var flycheck-cppcheck-inconclusive nil c/c++-cppcheck "Whether to enable Cppcheck inconclusive checks. When non-nil, enable Cppcheck inconclusive checks. This allows Cppcheck to report warnings it's not certain of, but it may result in false positives. This will have no effect when using Cppcheck 1.53 and older." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.19")) (flycheck-def-option-var flycheck-cppcheck-include-path nil c/c++-cppcheck "A list of include directories for cppcheck. The value of this variable is a list of strings, where each string is a directory to add to the include path of cppcheck. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-define-checker c/c++-cppcheck "A C/C++ checker using cppcheck. See URL `https://cppcheck.sourceforge.net/'." :command ("cppcheck" "--quiet" "--xml-version=2" "--inline-suppr" (option "--enable=" flycheck-cppcheck-checks concat flycheck-option-comma-separated-list) (option-flag "--inconclusive" flycheck-cppcheck-inconclusive) (option-list "-I" flycheck-cppcheck-include-path) (option-list "--std=" flycheck-cppcheck-standards concat) (option-list "--suppress=" flycheck-cppcheck-suppressions concat) (option "--suppressions-list=" flycheck-cppcheck-suppressions-file concat) "-x" (eval (pcase major-mode ((or `c++-mode `c++-ts-mode) "c++") ((or `c-mode `c-ts-mode) "c"))) (eval flycheck-cppcheck-args) source) :error-parser flycheck-parse-cppcheck :modes (c-mode c++-mode c-ts-mode c++-ts-mode)) (flycheck-define-checker cfengine "A CFEngine syntax checker using cf-promises. See URL `https://cfengine.com/'." :command ("cf-promises" "-Wall" "-f" ;; We must stay in the same directory to resolve @include source-inplace) :error-patterns ((warning line-start (file-name) ":" line ":" column ": warning: " (message) line-end) (error line-start (file-name) ":" line ":" column ": error: " (message) line-end)) :modes (cfengine-mode cfengine3-mode)) (flycheck-define-checker coffee "A CoffeeScript syntax checker using coffee. See URL `https://coffeescript.org/'." ;; --print suppresses generation of compiled .js files :command ("coffee" "--compile" "--print" "--stdio") :standard-input t :error-patterns ((error line-start "[stdin]:" line ":" column ": error: " (message) line-end)) :modes coffee-mode :next-checkers ((warning . coffee-coffeelint))) (flycheck-def-config-file-var flycheck-coffeelintrc coffee-coffeelint ".coffeelint.json") (flycheck-define-checker coffee-coffeelint "A CoffeeScript style checker using coffeelint. See URL `https://www.coffeelint.org/'." :command ("coffeelint" (config-file "--file" flycheck-coffeelintrc) "--stdin" "--reporter" "checkstyle") :standard-input t :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-remove-error-file-names "stdin" (flycheck-remove-error-ids (flycheck-sanitize-errors errors)))) :modes coffee-mode) (flycheck-define-checker css-csslint "A CSS syntax and style checker using csslint. See URL `https://github.com/CSSLint/csslint'." :command ("csslint" "--format=checkstyle-xml" source) :error-parser flycheck-parse-checkstyle :error-filter flycheck-dequalify-error-ids :modes (css-mode css-ts-mode)) (defconst flycheck-stylelint-args '("--formatter" "json") "Common arguments to stylelint invocations.") ;; Limit the length of the generated docstring by including only the first three ;; checker symbols, otherwise emacs will complain about the docstring length ;; and may refuse to compile the package. (let ((print-length 3)) (flycheck-def-config-file-var flycheck-stylelintrc (css-stylelint scss-stylelint sass-stylelint less-stylelint) nil)) (flycheck-def-option-var flycheck-stylelint-quiet nil (css-stylelint scss-stylelint sass-stylelint less-stylelint) "Whether to run stylelint in quiet mode. When non-nil, enable quiet mode, via `--quiet'." :type 'boolean :safe #'booleanp :package-version '(flycheck . 26)) (defconst flycheck-stylelint-error-re (flycheck-rx-to-string '(: line-start (id (one-or-more word)) ": " (message) line-end))) (defun flycheck-parse-stylelint (output checker buffer) "Parse stylelint errors from OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. The CHECKER usually returns the errors as JSON. If the CHECKER throws an Error it returns an Error message with a stacktrace." (condition-case nil (flycheck-parse-stylelint-json output checker buffer) ;; The output could not be parsed as JSON (json-error ;; Extract a flycheck error from the output (with a regular expression) ;; For match-string 4/5 see flycheck-rx-message/flycheck-rx-id (when (string-match flycheck-stylelint-error-re output) (list (flycheck-error-new-at 1 nil 'error (match-string 4 output) :id (match-string 5 output) :checker checker :buffer buffer :filename (buffer-file-name buffer))))))) (defun flycheck-parse-stylelint-json (output checker buffer) "Parse stylelint JSON errors from OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://stylelint.io/developer-guide/formatters/' for information about the JSON format of stylelint." (let ((json-object-type 'plist)) ;; stylelint returns a vector of result objects ;; Since we only passed one file, the first element is enough (let* ((stylelint-output (elt (json-read-from-string output) 0)) (filename (buffer-file-name buffer)) ;; Turn all deprecations into warnings (deprecations (mapcar (lambda (d) (flycheck-error-new-at 1 nil 'warning (plist-get d :text) :id "Deprecation Warning" :checker checker :buffer buffer :filename filename)) (plist-get stylelint-output :deprecations))) ;; Turn all invalid options into errors (invalid-options (mapcar (lambda (io) (flycheck-error-new-at 1 nil 'error (plist-get io :text) :id "Invalid Option" :checker checker :buffer buffer :filename filename)) (plist-get stylelint-output :invalidOptionWarnings))) ;; Read all linting warnings (warnings (mapcar (lambda (w) (flycheck-error-new-at (plist-get w :line) (plist-get w :column) (pcase (plist-get w :severity) (`"error" 'error) (`"warning" 'warning) ;; Default to info for unknown .severity (_ 'info)) (plist-get w :text) :id (plist-get w :rule) :checker checker :buffer buffer :filename filename)) (plist-get stylelint-output :warnings)))) ;; Return the combined errors (deprecations, invalid options, warnings) (append deprecations invalid-options warnings)))) (defun flycheck--stylelint-config-exists-p (checker) "Whether there is a valid stylelint CHECKER config for the current buffer." (eql 0 (flycheck-call-checker-process checker nil nil nil "--print-config" (or buffer-file-name "index.js")))) (defun flycheck--stylelint-get-major-version (checker) "Return major version of stylelint CHECKER." (let ((cb (current-buffer))) (with-temp-buffer (let ((temp-buffer (current-buffer))) (with-current-buffer cb (flycheck-call-checker-process checker nil temp-buffer nil "--version")) (string-to-number (car (split-string (buffer-string) "\\."))))))) (defun flycheck--stylelint-verify (checker) "Verify stylelint setup for CHECKER." (let ((have-config (flycheck--stylelint-config-exists-p checker))) (list (flycheck-verification-result-new :label "configuration available" :message (if have-config "yes" "no config file found") :face (if have-config 'success '(bold error))) (flycheck-verification-result-new :label "stylecheck version" :message (number-to-string (flycheck--stylelint-get-major-version checker)) :face 'success)))) (flycheck-define-checker css-stylelint "A CSS syntax and style checker using stylelint. See URL `https://stylelint.io/'." :command ("stylelint" (eval flycheck-stylelint-args) (option-flag "--quiet" flycheck-stylelint-quiet) (config-file "--config" flycheck-stylelintrc) "--stdin-filename" (eval (or (buffer-file-name) "style.css"))) :standard-input t :verify (lambda (_) (flycheck--stylelint-verify 'css-stylelint)) :error-parser flycheck-parse-stylelint :predicate flycheck-buffer-nonempty-p :modes (css-mode css-ts-mode) :error-explainer (lambda (err) (let ((error-code (flycheck-error-id err)) (url "https://stylelint.io/user-guide/rules/%s")) (and error-code `(url . ,(format url error-code)))))) (flycheck-def-option-var flycheck-cuda-language-standard nil cuda-nvcc "Our CUDA Language Standard." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-cuda-language-standard) (flycheck-def-option-var flycheck-cuda-compiler-options '("-Wall" "-Wextra") cuda-nvcc "Specify options directly to the compiler/preprocessor." :type '(choice (const :tag "No additional compiler options" nil) (repeat :tag "Addition compiler options" (string :tag "Compiler option"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "35")) (flycheck-def-option-var flycheck-cuda-gencodes nil cuda-nvcc "Our real and virtual GPU architectures to pass to nvcc." :type '(repeat (file :tag "GPU architecture")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-cuda-includes nil cuda-nvcc "Our include directories to pass to nvcc." :type '(repeat (file :tag "Include file")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-cuda-definitions nil cuda-nvcc "Additional preprocessor definitions for nvcc. A list of strings to pass to cuda, a la flycheck-clang" :type '(repeat (string :tag "Definitions")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-cuda-include-path nil cuda-nvcc "A list of include directories for nvcc." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-cuda-relaxed-constexpr nil cuda-nvcc "Enable calling host constexpr from device function for nvcc. When non-nil, enable experimental calling of a constexpr __host__ function from a __device__ function." :type 'boolean :safe #'booleanp :package-version '(flycheck . "35")) (flycheck-def-option-var flycheck-cuda-extended-lambda nil cuda-nvcc "Enable annotating lambda functions with __host__ or __device__. When non-nil, enable experimental compilation of __host__ and __device__ lambda functions." :type 'boolean :safe #'booleanp :package-version '(flycheck . "35")) (flycheck-define-checker cuda-nvcc "A CUDA C/C++ syntax checker using nvcc. See URL `https://developer.nvidia.com/cuda-llvm-compiler'." :command ("nvcc" "-c" ;; Compile Only "--output-file" "/dev/null" ;; avoid creating output .o "--x=cu" ;; explicitly specify it's a CUDA language file "-rdc=true" ;; Allow linking with external cuda funcions (option "-std=" flycheck-cuda-language-standard concat) (option-flag "--expt-relaxed-constexpr" flycheck-cuda-relaxed-constexpr) (option-flag "--expt-extended-lambda" flycheck-cuda-extended-lambda) (option-list "-include" flycheck-cuda-includes) (option-list "-gencode" flycheck-cuda-gencodes) (option-list "-Xcompiler" flycheck-cuda-compiler-options) (option-list "-D" flycheck-cuda-definitions concat) (option-list "-I" flycheck-cuda-include-path) source) :error-patterns ((error line-start (message "In file included from") " " (or "" (file-name)) ":" line ":" line-end) (error line-start (or "" (file-name)) "(" line "): error" (optional " #" (id (one-or-more digit) (optional "-D"))) ": " (message) line-end) (error line-start (or "" (file-name)) ":" line ":" column ": fatal error" (optional " #" (id (one-or-more digit) (optional "-D"))) ": " (optional (message)) line-end) (warning line-start (or "" (file-name)) "(" line "): warning" (optional " #" (id (one-or-more digit) (optional "-D"))) ": " (message) line-end)) :modes cuda-mode) (flycheck-def-option-var flycheck-cwl-schema-path nil cwl "A path for the schema file for Common Workflow Language. The value of this variable is a string that denotes a path for the schema file of Common Workflow Language." :type '(choice (const :tag "None" nil) (file :tag "Schema file")) :safe #'flycheck-string-or-nil-p) (flycheck-define-checker cwl "A CWL syntax checker using Schema Salad validator. Requires Schema Salad 2.6.20171101113912 or newer. See URL `https://www.commonwl.org/v1.0/SchemaSalad.html'." :command ("schema-salad-tool" "--quiet" "--print-oneline" (eval flycheck-cwl-schema-path) source-inplace) :error-patterns ((error line-start (file-name) ":" line ":" column ":" (zero-or-more blank) (message (one-or-more not-newline)) line-end)) :modes cwl-mode) (defconst flycheck-d-module-re (rx "module" (one-or-more (syntax whitespace)) (group (one-or-more (not (syntax whitespace)))) (zero-or-more (syntax whitespace)) ";") "Regular expression to match a D module declaration.") (defun flycheck-d-base-directory () "Get the relative base directory path for this module." (let* ((file-name (buffer-file-name)) (module-file (if (and file-name (string= (file-name-nondirectory file-name) "package.d")) (directory-file-name (file-name-directory file-name)) file-name))) (flycheck-module-root-directory (flycheck-find-in-buffer flycheck-d-module-re) module-file))) (flycheck-def-option-var flycheck-dmd-include-path nil d-dmd "A list of include directories for dmd. The value of this variable is a list of strings, where each string is a directory to add to the include path of dmd. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.18")) (flycheck-def-args-var flycheck-dmd-args d-dmd :package-version '(flycheck . "0.24")) (flycheck-define-checker d-dmd "A D syntax checker using the DMD compiler. Requires DMD 2.066 or newer. See URL `https://dlang.org/'." :command ("dmd" "-debug" ; Compile in debug mode "-o-" ; Don't generate an object file "-vcolumns" ; Add columns in output "-wi" ; Compilation will continue even if there are warnings (eval (concat "-I" (flycheck-d-base-directory))) (option-list "-I" flycheck-dmd-include-path concat) (eval flycheck-dmd-args) (source ".d")) :error-patterns ((error line-start (file-name) "(" line "," column "): Error: " (message) line-end) (warning line-start (file-name) "(" line "," column "): " (or "Warning" "Deprecation") ": " (message) line-end) (info line-start (file-name) "(" line "," column "): " (one-or-more " ") (message) line-end)) :modes d-mode) (flycheck-define-checker dockerfile-hadolint "A Dockerfile syntax checker using the hadolint. See URL `https://github.com/hadolint/hadolint/'." :command ("hadolint" "--no-color" "-") :standard-input t :error-patterns ((error line-start (file-name) ":" line " " (id (one-or-more alnum)) " error: " (message) line-end) (warning line-start (file-name) ":" line " " (id (one-or-more alnum)) " warning: " (message) line-end) (info line-start (file-name) ":" line " " (id (one-or-more alnum)) " info: " (message) line-end) (error line-start (file-name) ":" line ":" column " " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "-" errors))) :modes (dockerfile-mode dockerfile-ts-mode)) (defun flycheck-credo--working-directory (&rest _ignored) "Check if `credo' is installed as dependency in the application." (and buffer-file-name (locate-dominating-file buffer-file-name "deps/credo"))) (flycheck-def-option-var flycheck-elixir-credo-strict nil elixir-credo "Enable strict mode in `credo'. When non-nil, pass the `--strict' flag to credo." :type 'boolean :safe #'booleanp :package-version '(flycheck . "32")) (flycheck-define-checker elixir-credo "An Elixir checker for static code analysis using Credo. See `https://credo-ci.org/'." :command ("mix" "credo" (option-flag "--strict" flycheck-elixir-credo-strict) "--format" "flycheck" "--read-from-stdin" source-original) :standard-input t :working-directory flycheck-credo--working-directory :enabled flycheck-credo--working-directory :error-patterns ((info line-start (file-name) ":" line (optional ":" column) ": " (or "F" "R" "C") ": " (message) line-end) (warning line-start (file-name) ":" line (optional ":" column) ": " (or "D" "W") ": " (message) line-end)) :modes elixir-mode) (defconst flycheck-this-emacs-executable (concat invocation-directory invocation-name) "The path to the currently running Emacs executable.") (defconst flycheck-emacs-args '("-Q" "--batch") "Common arguments to Emacs invocations.") (defmacro flycheck-prepare-emacs-lisp-form (&rest body) "Prepare BODY for use as check form in a subprocess." (declare (indent 0)) `(flycheck-sexp-to-string '(progn (defvar jka-compr-inhibit) (unwind-protect ;; Flycheck inhibits compression of temporary files, thus we ;; must not attempt to decompress. (let ((jka-compr-inhibit t)) ;; Strip option-argument separator from arguments, if present (when (equal (car command-line-args-left) "--") (setq command-line-args-left (cdr command-line-args-left))) ,@body) ;; Prevent Emacs from processing the arguments on its own, see ;; https://github.com/flycheck/flycheck/issues/319 (setq command-line-args-left nil))))) (defun flycheck-emacs-lisp-bytecomp-config-form () "Prepare an Emacs Lisp form to set byte-compiler variables." (flycheck-sexp-to-string `(progn (require 'bytecomp) (setq byte-compile-root-dir ,(if buffer-file-name (file-name-directory buffer-file-name) default-directory))))) (defconst flycheck-emacs-lisp-check-form (flycheck-prepare-emacs-lisp-form ;; Keep track of the generated bytecode files, to delete them after byte ;; compilation. (require 'bytecomp) (defvar flycheck-byte-compiled-files nil) (let ((byte-compile-dest-file-function (lambda (source) (let ((temp-file (make-temp-file (file-name-nondirectory source)))) (push temp-file flycheck-byte-compiled-files) temp-file)))) (unwind-protect (byte-compile-file (car command-line-args-left)) (mapc (lambda (f) (ignore-errors (delete-file f))) flycheck-byte-compiled-files)) (when (bound-and-true-p flycheck-emacs-lisp-check-declare) (check-declare-file (car command-line-args-left)))))) (flycheck-def-option-var flycheck-emacs-lisp-load-path nil emacs-lisp "Load path to use in the Emacs Lisp syntax checker. When set to `inherit', use the `load-path' of the current Emacs session during syntax checking. When set to a list of strings, add each directory in this list to the `load-path' before invoking the byte compiler. Relative paths in this list are expanded against the `default-directory' of the buffer to check. When nil, do not explicitly set the `load-path' during syntax checking. The syntax check only uses the built-in `load-path' of Emacs in this case. Note that changing this variable can lead to wrong results of the syntax check, e.g. if an unexpected version of a required library is used." :type '(choice (const :tag "Inherit current `load-path'" inherit) (repeat :tag "Load path" directory)) :risky t :package-version '(flycheck . "0.14")) (flycheck-def-option-var flycheck-emacs-lisp-initialize-packages 'auto emacs-lisp "Whether to initialize packages in the Emacs Lisp syntax checker. When nil, never initialize packages. When `auto', initialize packages only when checking `user-init-file' or files from `user-emacs-directory'. For any other non-nil value, always initialize packages. When initializing packages is enabled the `emacs-lisp' syntax checker calls `package-initialize' before byte-compiling the file to be checked. It also sets `package-user-dir' according to `flycheck-emacs-lisp-package-user-dir'." :type '(choice (const :tag "Do not initialize packages" nil) (const :tag "Initialize packages for configuration only" auto) (const :tag "Always initialize packages" t)) :risky t :package-version '(flycheck . "0.14")) (defconst flycheck-emacs-lisp-package-initialize-form (flycheck-sexp-to-string '(with-demoted-errors "Error during package initialization: %S" (package-initialize))) "Form used to initialize packages.") (defun flycheck-option-emacs-lisp-package-initialize (value) "Option VALUE filter for `flycheck-emacs-lisp-initialize-packages'." (let ((shall-initialize (if (eq value 'auto) (or (flycheck-in-user-emacs-directory-p (or buffer-file-name default-directory)) ;; `user-init-file' is nil in non-interactive sessions. Now, ;; no user would possibly use Flycheck in a non-interactive ;; session, but our unit tests run non-interactively, so we ;; have to handle this case anyway (and user-init-file buffer-file-name (flycheck-same-files-p buffer-file-name user-init-file))) value))) (when shall-initialize ;; If packages shall be initialized, return the corresponding form, ;; otherwise make Flycheck ignore the option by returning nil. flycheck-emacs-lisp-package-initialize-form))) (flycheck-def-option-var flycheck-emacs-lisp-package-user-dir nil emacs-lisp "Package directory for the Emacs Lisp syntax checker. If set to a string set `package-user-dir' to the value of this variable before initializing packages. If set to nil just inherit the value of `package-user-dir' from the running Emacs session. This variable has no effect, if `flycheck-emacs-lisp-initialize-packages' is nil." :type '(choice (const :tag "Default package directory" nil) (directory :tag "Custom package directory")) :risky t :package-version '(flycheck . "0.14")) (defun flycheck-option-emacs-lisp-package-user-dir (value) "Option VALUE filter for `flycheck-emacs-lisp-package-user-dir'." ;; Inherit the package directory from our Emacs session (let ((value (or value (bound-and-true-p package-user-dir)))) (when value (flycheck-sexp-to-string `(setq package-user-dir ,value))))) (flycheck-def-option-var flycheck-emacs-lisp-check-declare nil emacs-lisp "If non-nil, check ‘declare-function’ forms using ‘check-declare-file’." :type '(choice (const :tag "Do not check declare forms" nil) (const :tag "Check declare forms" t)) :risky t :package-version '(flycheck . "31")) (defun flycheck-option-emacs-lisp-check-declare (value) "Option VALUE filter for `flycheck-emacs-lisp-check-declare'." (when value (flycheck-sexp-to-string `(progn (defvar flycheck-emacs-lisp-check-declare) (setq flycheck-emacs-lisp-check-declare ,value))))) (defun flycheck--emacs-lisp-enabled-p () "Check whether to enable Emacs Lisp checker in the current buffer." (not (or ;; Do not check buffers used for autoloads generation during package ;; installation. These buffers are too short-lived for being checked, and ;; doing so causes spurious errors. See ;; https://github.com/flycheck/flycheck/issues/45 and ;; https://github.com/bbatsov/prelude/issues/248. We must also not check ;; compilation buffers, but as these are ephemeral, Flycheck won't check ;; them anyway. (flycheck-autoloads-file-p) ;; Cask/Carton and dir-locals files contain data, not code, and don't need ;; to follow Checkdoc conventions either. (and (buffer-file-name) (member (file-name-nondirectory (buffer-file-name)) '("Cask" "Carton" ".dir-locals.el" ".dir-locals-2.el")))))) (defun flycheck--emacs-lisp-checkdoc-enabled-p () "Check whether to enable Emacs Lisp Checkdoc in the current buffer." (and (flycheck--emacs-lisp-enabled-p) ;; These files are valid Lisp, but don't contain "standard" comments. (not (member (buffer-file-name) '("Eldev" "Eldev-local"))))) (flycheck-define-checker emacs-lisp "An Emacs Lisp syntax checker using the Emacs Lisp Byte compiler. See Info Node `(elisp)Byte Compilation'." :command ("emacs" (eval flycheck-emacs-args) (eval (let ((path (pcase flycheck-emacs-lisp-load-path (`inherit load-path) (p (seq-map #'expand-file-name p))))) (flycheck-prepend-with-option "--directory" path))) (option "--eval" flycheck-emacs-lisp-package-user-dir nil flycheck-option-emacs-lisp-package-user-dir) (option "--eval" flycheck-emacs-lisp-initialize-packages nil flycheck-option-emacs-lisp-package-initialize) (option "--eval" flycheck-emacs-lisp-check-declare nil flycheck-option-emacs-lisp-check-declare) "--eval" (eval (flycheck-emacs-lisp-bytecomp-config-form)) "--eval" (eval flycheck-emacs-lisp-check-form) "--" source-inplace) :error-patterns ((error line-start (file-name) ":" line ":" column ":" (zero-or-more whitespace) "Error:" (zero-or-more whitespace) (message (zero-or-more not-newline) (zero-or-more "\n " (zero-or-more not-newline))) line-end) (warning line-start (file-name) ":" line ":" column ":" (zero-or-more whitespace) "Warning:" (zero-or-more whitespace) (message (zero-or-more not-newline) (zero-or-more "\n " (zero-or-more not-newline))) line-end) (warning line-start (file-name) ":" line (optional ":" column) ":" (zero-or-more whitespace) "Warning (check-declare): said\n" (message (zero-or-more " " (zero-or-more not-newline)) (zero-or-more "\n " (zero-or-more not-newline))) line-end) ;; The following is for Emacs 24 ‘check-declare-file’, which uses a ;; less informative format. (warning line-start "Warning (check-declare): " (file-name) " said " (message (zero-or-more not-newline)) line-end)) :error-filter (lambda (errors) (flycheck-fill-empty-line-numbers (flycheck-collapse-error-message-whitespace (flycheck-sanitize-errors errors)))) :modes (emacs-lisp-mode lisp-interaction-mode) :enabled flycheck--emacs-lisp-enabled-p :predicate (lambda () ;; Do not check buffers that should not be byte-compiled. The checker ;; process will refuse to compile these, which would confuse Flycheck (not (bound-and-true-p no-byte-compile))) :next-checkers (emacs-lisp-checkdoc)) (defconst flycheck-emacs-lisp-checkdoc-form (flycheck-prepare-emacs-lisp-form (unless (require 'elisp-mode nil 'no-error) ;; TODO: Fallback for Emacs 24, remove when dropping support for 24 (require 'lisp-mode)) (require 'checkdoc) (let ((source (car command-line-args-left)) ;; Remember the default directory of the process (process-default-directory default-directory)) ;; Note that we deliberately use our custom approach even despite of ;; `checkdoc-file' which was added to Emacs 25.1. While it's conceptually ;; the better thing, its implementation has too many flaws to be of use ;; for us. (with-temp-buffer (insert-file-contents source 'visit) (setq buffer-file-name source) ;; And change back to the process default directory to make file-name ;; back-substutition work (setq default-directory process-default-directory) (with-demoted-errors "Error in checkdoc: %S" ;; Checkdoc needs the Emacs Lisp syntax table and comment syntax to ;; parse sexps and identify docstrings correctly; see ;; https://github.com/flycheck/flycheck/issues/833 (delay-mode-hooks (emacs-lisp-mode)) (setq delayed-mode-hooks nil) (checkdoc-current-buffer t) (with-current-buffer checkdoc-diagnostic-buffer (princ (buffer-substring-no-properties (point-min) (point-max))) (kill-buffer))))))) (defconst flycheck-emacs-lisp-checkdoc-variables `(checkdoc-symbol-words checkdoc-arguments-in-order-flag checkdoc-force-history-flag checkdoc-permit-comma-termination-flag checkdoc-force-docstrings-flag checkdoc-package-keywords-flag checkdoc-spellcheck-documentation-flag checkdoc-verb-check-experimental-flag checkdoc-max-keyref-before-warn sentence-end-double-space ,@(and (>= emacs-major-version 28) '(checkdoc-column-zero-backslash-before-paren))) "Variables inherited by the checkdoc subprocess.") (defun flycheck-emacs-lisp-checkdoc-variables-form () "Make a sexp to pass relevant variables to a checkdoc subprocess. Variables are taken from `flycheck-emacs-lisp-checkdoc-variables'." `(progn ,@(seq-map (lambda (opt) `(setq-default ,opt ',(symbol-value opt))) (seq-filter #'boundp flycheck-emacs-lisp-checkdoc-variables)))) (flycheck-define-checker emacs-lisp-checkdoc "An Emacs Lisp style checker using CheckDoc. The checker runs `checkdoc-current-buffer'." :command ("emacs" (eval flycheck-emacs-args) "--eval" (eval (flycheck-sexp-to-string (flycheck-emacs-lisp-checkdoc-variables-form))) "--eval" (eval flycheck-emacs-lisp-checkdoc-form) "--" source) :error-patterns ((info line-start (file-name) ":" line ": " (message) line-end)) :modes (emacs-lisp-mode) :enabled flycheck--emacs-lisp-checkdoc-enabled-p) (dolist (checker '(emacs-lisp emacs-lisp-checkdoc)) (setf (car (flycheck-checker-get checker 'command)) flycheck-this-emacs-executable)) (defun flycheck-ember-template--check-for-config (&rest _ignored) "Check the required config file is available up the file system." (and buffer-file-name (locate-dominating-file buffer-file-name ".template-lintrc.js"))) (defun flycheck-ember-template--parse-error (output checker buffer) "Parse Ember-template-lint errors/warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at .line .column (pcase .severity (2 'error) (1 'warning) (_ 'warning)) .message :id .rule :checker checker :buffer buffer :filename (buffer-file-name buffer)))) (cdr (car (car (flycheck-parse-json output)))))) (flycheck-def-config-file-var flycheck-ember-template-lintrc ember-template ".template-lintrc.js") (flycheck-define-checker ember-template "An Ember template checker using ember-template-lint." :command ("ember-template-lint" (config-file "--config-path" flycheck-ember-template-lintrc) "--filename" source-original "--format=json") :standard-input t :error-parser flycheck-ember-template--parse-error :modes web-mode :enabled flycheck-ember-template--check-for-config :working-directory flycheck-ember-template--check-for-config) (flycheck-def-option-var flycheck-erlang-include-path nil erlang "A list of include directories for Erlang. The value of this variable is a list of strings, where each string is a directory to add to the include path of erlc. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-def-option-var flycheck-erlang-library-path nil erlang "A list of library directories for Erlang. The value of this variable is a list of strings, where each string is a directory to add to the library path of erlc. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Library directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-define-checker erlang "An Erlang syntax checker using the Erlang interpreter. See URL `https://www.erlang.org/'." :command ("erlc" "-o" temporary-directory (option-list "-I" flycheck-erlang-include-path) (option-list "-pa" flycheck-erlang-library-path) "-Wall" source) :error-patterns ((warning line-start (file-name) ":" line ":" (optional column ":") " Warning:" (message) line-end) (error line-start (file-name) ":" line ":" (optional column ":") " " (message) line-end)) :modes erlang-mode :enabled (lambda () (string-suffix-p ".erl" (buffer-file-name)))) (defun flycheck--contains-rebar-config (dir-name) "Return DIR-NAME if rebar config file exists in DIR-NAME, nil otherwise." (when (or (file-exists-p (expand-file-name "rebar.config" dir-name)) (file-exists-p (expand-file-name "rebar.config.script" dir-name))) dir-name)) (defun flycheck--locate-rebar3-project-root (file-name &optional prev-file-name acc) "Find the top-most rebar project root for source FILE-NAME. A project root directory is any directory containing a rebar.config file. Find the top-most directory to move out of any nested dependencies. FILE-NAME is a source file for which to find the project. PREV-FILE-NAME helps us prevent infinite looping ACC is an accumulator that keeps the list of results, the first non-nil of which will be our project root. Return the absolute path to the directory" (if (string= file-name prev-file-name) (car (remove nil acc)) (let ((current-dir (file-name-directory file-name))) (flycheck--locate-rebar3-project-root (directory-file-name current-dir) file-name (cons (flycheck--contains-rebar-config current-dir) acc))))) (defun flycheck-rebar3-project-root (&optional _checker) "Return directory where rebar.config is located." (flycheck--locate-rebar3-project-root buffer-file-name)) (flycheck-def-option-var flycheck-erlang-rebar3-profile nil erlang-rebar3 "The rebar3 profile to use. The profile used when compiling, if VALUE is nil \"test\" will be used when the file is located in test directory, otherwise \"default\" will be used as profile." :type '(choice (const :tag "Automatic" nil) (string :tag "Profile")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (defun flycheck-erlang-rebar3-get-profile () "Return rebar3 profile. Use flycheck-erlang-rebar3-profile if set, otherwise use test or eqc profile if directory name is \"test\" or \"eqc\", or else \"default\"." (or flycheck-erlang-rebar3-profile (with-no-warnings ;; `seq-contains-p' is only in seq >= 2.21 (seq-contains '("test" "eqc") (and buffer-file-name (file-name-base (directory-file-name (file-name-directory buffer-file-name)))))) "default")) (flycheck-define-checker erlang-rebar3 "An Erlang syntax checker using the rebar3 build tool." :command ("rebar3" "as" (eval (flycheck-erlang-rebar3-get-profile)) "compile") :error-parser flycheck-parse-with-patterns-without-color :error-patterns ((warning line-start (file-name) ":" line ":" (optional column ":") " Warning:" (message) line-end) (error line-start (file-name) ":" line ":" (optional column ":") " " (message) line-end)) :modes erlang-mode :enabled flycheck-rebar3-project-root :predicate flycheck-buffer-saved-p :working-directory flycheck-rebar3-project-root) (flycheck-define-checker eruby-erubis "An eRuby syntax checker using the `erubis' command. See URL `https://www.kuwata-lab.com/erubis/'." :command ("erubis" "-z" source) :error-patterns ((error line-start (file-name) ":" line ": " (message) line-end)) :modes (html-erb-mode rhtml-mode) :next-checkers ((warning . eruby-ruumba))) (flycheck-def-config-file-var flycheck-ruumbarc eruby-ruumba ".ruumba.yml") (flycheck-def-option-var flycheck-ruumba-lint-only nil eruby-ruumba "Whether to only report code issues in Ruumba. When non-nil, only report code issues in Ruumba, via `--lint'. Otherwise report style issues as well." :safe #'booleanp :type 'boolean :package-version '(flycheck . "32")) (flycheck-define-checker eruby-ruumba "An eRuby syntax and style checker using the Ruumba tool. You need at least Ruumba 0.1.7 for this syntax checker. See URL `https://github.com/ericqweinstein/ruumba'." :command ("ruumba" "--display-cop-names" "--force-exclusion" "--format" "emacs" "--cache" "false" (config-file "--config" flycheck-ruumbarc) (option-flag "--lint" flycheck-ruumba-lint-only) ;; Ruumba takes the original file name as argument when reading ;; from standard input "--stdin" source-original) :standard-input t :working-directory flycheck-ruby--find-project-root :error-patterns ((info line-start (file-name) ":" line ":" column ": C: " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end) (warning line-start (file-name) ":" line ":" column ": W: " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end) (error line-start (file-name) ":" line ":" column ": " (or "E" "F") ": " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end)) :modes (html-erb-mode rhtml-mode)) (flycheck-def-args-var flycheck-gfortran-args fortran-gfortran :package-version '(flycheck . "0.22")) (flycheck-def-option-var flycheck-gfortran-include-path nil fortran-gfortran "A list of include directories for GCC Fortran. The value of this variable is a list of strings, where each string is a directory to add to the include path of gcc. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gfortran-language-standard "f95" fortran-gfortran "The language standard to use in GFortran. The value of this variable is either a string denoting a language standard, or nil, to use the default standard. When non-nil, pass the language standard via the `-std' option." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :package-version '(flycheck . "0.20")) (flycheck-def-option-var flycheck-gfortran-layout nil fortran-gfortran "The source code layout to use in GFortran. The value of this variable is one of the following symbols: nil Let gfortran determine the layout from the extension `free' Use free form layout `fixed' Use fixed form layout In any other case, an error is signaled." :type '(choice (const :tag "Guess layout from extension" nil) (const :tag "Free form layout" free) (const :tag "Fixed form layout" fixed)) :safe (lambda (value) (or (not value) (memq value '(free fixed)))) :package-version '(flycheck . "0.20")) (defun flycheck-option-gfortran-layout (value) "Option VALUE filter for `flycheck-gfortran-layout'." (pcase value (`nil nil) (`free "free-form") (`fixed "fixed-form") (_ (error "Invalid value for flycheck-gfortran-layout: %S" value)))) (flycheck-def-option-var flycheck-gfortran-warnings '("all" "extra") fortran-gfortran "A list of warnings for GCC Fortran. The value of this variable is a list of strings, where each string is the name of a warning category to enable. By default, all recommended warnings and some extra warnings are enabled (as by `-Wall' and `-Wextra' respectively). Refer to the gfortran manual at URL `https://gcc.gnu.org/onlinedocs/gfortran/' for more information about warnings" :type '(choice (const :tag "No additional warnings" nil) (repeat :tag "Additional warnings" (string :tag "Warning name"))) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.20")) (flycheck-define-checker fortran-gfortran "An Fortran syntax checker using GCC. Uses GCC's Fortran compiler gfortran. See URL `https://gcc.gnu.org/onlinedocs/gfortran/'." :command ("gfortran" "-fsyntax-only" "-fshow-column" ;; Do not visually indicate the source location "-fno-diagnostics-show-caret" ;; Do not show the corresponding warning group "-fno-diagnostics-show-option" ;; Fortran has similar include processing as C/C++ "-iquote" (eval (flycheck-c/c++-quoted-include-directory)) (option "-std=" flycheck-gfortran-language-standard concat) (option "-f" flycheck-gfortran-layout concat flycheck-option-gfortran-layout) (option-list "-W" flycheck-gfortran-warnings concat) (option-list "-I" flycheck-gfortran-include-path concat) (eval flycheck-gfortran-args) source) :error-patterns ((error line-start (file-name) ":" line (or ":" ".") column (or ": " ":\n") (or (= 3 (zero-or-more not-newline) "\n") "") (or "Error" "Fatal Error") ": " (message) line-end) (warning line-start (file-name) ":" line (or ":" ".") column (or ": " ":\n") (or (= 3 (zero-or-more not-newline) "\n") "") "Warning: " (message) line-end)) :modes (fortran-mode f90-mode)) (flycheck-define-checker yaml-actionlint "A YAML syntax checker using actionlint. See URL https://github.com/rhysd/actionlint/." :command ("actionlint" "-oneline" source) :error-patterns ((error line-start (file-name) ":" line ":" column ": " (message) line-end)) :modes (yaml-mode yaml-ts-mode) :predicate (lambda () (string-match-p (rx (or ".github/workflows" ".github\\workflows")) (buffer-file-name)))) (flycheck-define-checker go-gofmt "A Go syntax and style checker using the gofmt utility. See URL `https://golang.org/cmd/gofmt/'." :command ("gofmt") :standard-input t :error-patterns ((error line-start ":" line ":" column ": " (message) line-end)) :modes (go-mode go-ts-mode) :next-checkers ((warning . go-vet) ;; Fall back, if go-vet doesn't exist (warning . go-build) (warning . go-test) (warning . go-errcheck) (warning . go-unconvert) (warning . go-staticcheck))) (flycheck-def-option-var flycheck-go-vet-print-functions nil go-vet "A list of print-like functions for `go vet'. Go vet will check these functions for format string problems and issues, such as a mismatch between the number of formats used, and the number of arguments given. Each entry is in the form Name:N where N is the zero-based argument position of the first argument involved in the print: either the format or the first print argument for non-formatted prints. For example, if you have Warn and Warnf functions that take an io.Writer as their first argument, like Fprintf, -printfuncs=Warn:1,Warnf:1 " :type '(repeat :tag "print-like functions" (string :tag "function")) :safe #'flycheck-string-list-p) (flycheck-define-checker go-vet "A Go syntax checker using the `go vet' command. See URL `https://golang.org/cmd/go/' and URL `https://golang.org/cmd/vet/'." :command ("go" "vet" (option "-printf.funcs=" flycheck-go-vet-print-functions concat flycheck-option-comma-separated-list) (source ".go")) :error-patterns ((warning line-start (file-name) ":" line ": " (message) line-end)) :modes (go-mode go-ts-mode) :next-checkers (go-build go-test ;; Fall back if `go build' or `go test' can be used go-errcheck go-unconvert go-staticcheck) :verify (lambda (_) (let* ((go (flycheck-checker-executable 'go-vet)) (have-vet (member "vet" (ignore-errors (process-lines go "tool"))))) (list (flycheck-verification-result-new :label "go tool vet" :message (if have-vet "present" "missing") :face (if have-vet 'success '(bold error))))))) (flycheck-def-option-var flycheck-go-build-install-deps nil (go-build go-test) "Whether to install dependencies in `go build' and `go test'. If non-nil automatically install dependencies with `go build' while syntax checking." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.25")) (flycheck-def-option-var flycheck-go-build-tags nil (go-build go-test go-errcheck go-staticcheck) "A list of tags for `go build'. Each item is a string with a tag to be given to `go build'." :type '(repeat (string :tag "Tag")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.25")) (flycheck-def-option-var flycheck-go-version nil go-staticcheck "The version of go that should be targeted by `staticcheck'. Should be a string representing a version, like 1.6 or 1.11.4. See `https://staticcheck.io/docs/#targeting-go-versions' for details." :type '(choice (const :tag "Unspecified" nil) (string :tag "Version")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.32")) (flycheck-define-checker go-build "A Go syntax and type checker using the `go build' command. Requires Go 1.6 or newer. See URL `https://golang.org/cmd/go'." :command ("go" "build" (option-flag "-i" flycheck-go-build-install-deps) ;; multiple tags are listed as "dev debug ..." (option-list "-tags=" flycheck-go-build-tags concat) "-o" null-device) :error-patterns ((error line-start (file-name) ":" line ":" (optional column ":") " " (message (one-or-more not-newline) (zero-or-more "\n\t" (one-or-more not-newline))) line-end) ;; Catch error message about multiple packages in a directory, which doesn't ;; follow the standard error message format. (info line-start (message "can't load package: package " (one-or-more (not (any ?: ?\n))) ": found packages " (one-or-more not-newline)) line-end)) :error-filter (lambda (errors) (dolist (error errors) (unless (flycheck-error-line error) ;; Flycheck ignores errors without line numbers, but the error ;; message about multiple packages in a directory doesn't come with a ;; line number, so inject a fake one. (setf (flycheck-error-line error) 1))) errors) :modes (go-mode go-ts-mode) :predicate (lambda () (and (flycheck-buffer-saved-p) (not (string-suffix-p "_test.go" (buffer-file-name))))) :next-checkers ((warning . go-errcheck) (warning . go-unconvert) (warning . go-staticcheck))) (flycheck-define-checker go-test "A Go syntax and type checker using the `go test' command. Requires Go 1.6 or newer. See URL `https://golang.org/cmd/go'." :command ("go" "test" (option-flag "-i" flycheck-go-build-install-deps) (option-list "-tags=" flycheck-go-build-tags concat) "-c" "-o" null-device) :error-patterns ((error line-start (file-name) ":" line ":" (optional column ":") " " (message (one-or-more not-newline) (zero-or-more "\n\t" (one-or-more not-newline))) line-end)) :modes (go-mode go-ts-mode) :predicate (lambda () (and (flycheck-buffer-saved-p) (string-suffix-p "_test.go" (buffer-file-name)))) :next-checkers ((warning . go-errcheck) (warning . go-unconvert) (warning . go-staticcheck))) (flycheck-define-checker go-errcheck "A Go checker for unchecked errors. Requires errcheck newer than commit 8515d34 (Aug 28th, 2015). See URL `https://github.com/kisielk/errcheck'." :command ("errcheck" "-abspath" (option-list "-tags=" flycheck-go-build-tags concat) ".") :error-patterns ((warning line-start (file-name) ":" line ":" column (or (one-or-more "\t") ": " ":\t") (message) line-end)) :error-filter (lambda (errors) (let ((errors (flycheck-sanitize-errors errors))) (dolist (err errors) (when-let (message (flycheck-error-message err)) ;; Improve the messages reported by errcheck to make them more clear. (setf (flycheck-error-message err) (format "Ignored `error` returned from `%s`" message))))) errors) :modes (go-mode go-ts-mode) :predicate (lambda () (flycheck-buffer-saved-p)) :next-checkers ((warning . go-unconvert) (warning . go-staticcheck))) (flycheck-define-checker go-unconvert "A Go checker looking for unnecessary type conversions. See URL `https://github.com/mdempsky/unconvert'." :command ("unconvert" ".") :error-patterns ((warning line-start (file-name) ":" line ":" column ": " (message) line-end)) :modes (go-mode go-ts-mode) :predicate (lambda () (flycheck-buffer-saved-p))) (flycheck-define-checker go-staticcheck "A Go checker that performs static analysis and linting using the `staticcheck' command. `staticcheck' is explicitly fully compatible with \"the last two versions of go\". `staticheck' can target earlier versions (with limited features) if `flycheck-go-version' is set. See URL `https://staticcheck.io/'." :command ("staticcheck" "-f" "json" (option-list "-tags" flycheck-go-build-tags concat) (option "-go" flycheck-go-version)) :error-parser flycheck-parse-go-staticcheck :modes (go-mode go-ts-mode)) (flycheck-define-checker groovy "A groovy syntax checker using groovy compiler API. See URL `https://www.groovy-lang.org'." :command ("groovy" "-e" "import org.codehaus.groovy.control.* unit = new CompilationUnit() unit.addSource(\"input\", System.in) try { unit.compile(Phases.CONVERSION) } catch (MultipleCompilationErrorsException e) { e.errorCollector.write(new PrintWriter(System.out, true), null) }") :standard-input t :error-patterns ((error line-start "input: " line ":" (message) " @ line " line ", column " column "." line-end)) :modes groovy-mode) (flycheck-define-checker haml "A Haml syntax checker using the Haml compiler. See URL `https://haml.info'." :command ("haml" "-c" "--stdin") :standard-input t :error-patterns ((error line-start "Syntax error on line " line ": " (message) line-end) (error line-start ":" line ": syntax error, " (message) line-end)) :modes haml-mode) (flycheck-define-checker haml-lint "HAML-Lint style checker. See URL `https://github.com/sds/haml-lint'." :command ("haml-lint" "--no-color" "--no-summary" source) :error-patterns ((error line-start (file-name) ":" line " [E]" (message) line-end) (warning line-start (file-name) ":" line " [W]" (message) line-end)) :modes haml-mode) (flycheck-define-checker handlebars "A Handlebars syntax checker using the Handlebars compiler. See URL `https://handlebarsjs.com/'." :command ("handlebars" "-i-") :standard-input t :error-patterns ((error line-start "Error: Parse error on line " line ":" (optional "\r") "\n" (zero-or-more not-newline) "\n" (zero-or-more not-newline) "\n" (message) line-end)) :modes (handlebars-mode handlebars-sgml-mode web-mode) :predicate (lambda () (if (eq major-mode 'web-mode) ;; Check if this is a handlebars file since web-mode does not store the ;; non-canonical engine name (let* ((regexp-alist (bound-and-true-p web-mode-engine-file-regexps)) (pattern (cdr (assoc "handlebars" regexp-alist)))) (and pattern (buffer-file-name) (string-match-p pattern (buffer-file-name)))) t))) (defconst flycheck-haskell-module-re (rx line-start (zero-or-more (or "\n" (any space))) "module" (one-or-more (or "\n" (any space))) (group (one-or-more (not (any space "(" "\n"))))) "Regular expression for a Haskell module name.") (flycheck-def-args-var flycheck-ghc-args (haskell-stack-ghc haskell-ghc) :package-version '(flycheck . "0.22")) (flycheck-def-option-var flycheck-ghc-stack-use-nix nil haskell-stack-ghc "Whether to enable nix support in stack. When non-nil, stack will append '--nix' flag to any call." :type 'boolean :safe #'booleanp :package-version '(flycheck . "26")) (flycheck-def-option-var flycheck-ghc-stack-project-file nil haskell-stack-ghc "Override project stack.yaml file. The value of this variable is a file path that refers to a yaml file for the current stack project. Relative file paths are resolved against the checker's working directory. When non-nil, stack will get overridden value via `--stack-yaml'." :type '(choice (const :tag "Unspecified" nil) (file :tag "Project file")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-ghc-no-user-package-database nil haskell-ghc "Whether to disable the user package database in GHC. When non-nil, disable the user package database in GHC, via `-no-user-package-db'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.16")) (flycheck-def-option-var flycheck-ghc-package-databases nil haskell-ghc "Additional module databases for GHC. The value of this variable is a list of strings, where each string is a directory of a package database. Each package database is given to GHC via `-package-db'." :type '(repeat (directory :tag "Package database")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.16")) (flycheck-def-option-var flycheck-ghc-search-path nil (haskell-stack-ghc haskell-ghc) "Module search path for (Stack) GHC. The value of this variable is a list of strings, where each string is a directory containing Haskell modules. Each directory is added to the GHC search path via `-i'." :type '(repeat (directory :tag "Module directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.16")) (flycheck-def-option-var flycheck-ghc-language-extensions nil (haskell-stack-ghc haskell-ghc) "Language extensions for (Stack) GHC. The value of this variable is a list of strings, where each string is a Haskell language extension, as in the LANGUAGE pragma. Each extension is enabled via `-X'." :type '(repeat (string :tag "Language extension")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.19")) (defvar flycheck-haskell-ghc-cache-directory nil "The cache directory for `ghc' output.") (defun flycheck-haskell-ghc-cache-directory () "Get the cache location for `ghc' output. If no cache directory exists yet, create one and return it. Otherwise return the previously used cache directory." (setq flycheck-haskell-ghc-cache-directory (or flycheck-haskell-ghc-cache-directory (make-temp-file "flycheck-haskell-ghc-cache" 'directory)))) (defun flycheck--locate-dominating-file-matching (directory regexp) "Search for a file in directory hierarchy starting at DIRECTORY. Look up the directory hierarchy from DIRECTORY for a directory containing a file that matches REGEXP." (locate-dominating-file directory (lambda (dir) (directory-files dir nil regexp t)))) (defun flycheck-haskell--find-stack-default-directory () "Find a directory to run haskell-stack-ghc. Return a parent directory with a stack*.y[a]ml file, or the directory returned by \"stack path --project-root\"." (or (when (buffer-file-name) (flycheck--locate-dominating-file-matching (file-name-directory (buffer-file-name)) (rx "stack" (* any) "." (or "yml" "yaml") eos))) (when-let* ((stack (funcall flycheck-executable-find "stack")) (output (ignore-errors (process-lines stack "--no-install-ghc" "path" "--project-root"))) (stack-dir (car output))) (and (file-directory-p stack-dir) stack-dir)))) (defun flycheck-haskell--ghc-find-default-directory (_checker) "Find a parent directory containing a cabal or package.yaml file." (when (buffer-file-name) (flycheck--locate-dominating-file-matching (file-name-directory (buffer-file-name)) "\\.cabal\\'\\|\\`package\\.yaml\\'"))) (flycheck-define-checker haskell-stack-ghc "A Haskell syntax and type checker using `stack ghc'. See URL `https://github.com/commercialhaskell/stack'." :command ("stack" "--no-install-ghc" (option "--stack-yaml" flycheck-ghc-stack-project-file) (option-flag "--nix" flycheck-ghc-stack-use-nix) "ghc" "--" "-Wall" "-no-link" "-outputdir" (eval (flycheck-haskell-ghc-cache-directory)) (option-list "-X" flycheck-ghc-language-extensions concat) (option-list "-i" flycheck-ghc-search-path concat) (eval (concat "-i" (flycheck-module-root-directory (flycheck-find-in-buffer flycheck-haskell-module-re)))) (eval flycheck-ghc-args) "-x" (eval (pcase major-mode (`haskell-mode "hs") (`haskell-literate-mode "lhs"))) source) :error-patterns ((warning line-start (file-name) ":" line ":" column ":" (or " " "\n ") (in "Ww") "arning:" (optional " " "[" (id (one-or-more not-newline)) "]") (optional "\n") (message (one-or-more " ") (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more (not (any ?\n ?|))))) line-end) (error line-start (file-name) ":" line ":" column ":" (optional " error:") (optional " " "[" (id (one-or-more not-newline)) "]") (or (message (one-or-more not-newline)) (and "\n" (message (one-or-more " ") (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more (not (any ?\n ?|))))))) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-dedent-error-messages errors))) :modes (haskell-mode haskell-literate-mode) :next-checkers ((warning . haskell-hlint)) :working-directory (lambda (_) (flycheck-haskell--find-stack-default-directory)) :enabled flycheck-haskell--find-stack-default-directory :verify (lambda (_) (let* ((stack (flycheck-haskell--find-stack-default-directory))) (list (flycheck-verification-result-new :label "stack config" :message (or stack "Not found") :face (if stack 'success '(bold error))))))) (flycheck-define-checker haskell-ghc "A Haskell syntax and type checker using ghc. See URL `https://www.haskell.org/ghc/'." :command ("ghc" "-Wall" "-no-link" "-outputdir" (eval (flycheck-haskell-ghc-cache-directory)) (option-flag "-no-user-package-db" flycheck-ghc-no-user-package-database) (option-list "-package-db" flycheck-ghc-package-databases) (option-list "-i" flycheck-ghc-search-path concat) ;; Include the parent directory of the current module tree, to ;; properly resolve local imports (eval (concat "-i" (flycheck-module-root-directory (flycheck-find-in-buffer flycheck-haskell-module-re)))) (option-list "-X" flycheck-ghc-language-extensions concat) (eval flycheck-ghc-args) "-x" (eval (pcase major-mode (`haskell-mode "hs") (`haskell-literate-mode "lhs"))) source) :error-patterns ((warning line-start (file-name) ":" line ":" column ":" (or " " "\n ") (in "Ww") "arning:" (optional " " "[" (id (one-or-more not-newline)) "]") (optional "\n") (message (one-or-more " ") (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more (not (any ?\n ?|))))) line-end) (error line-start (file-name) ":" line ":" column ":" (optional " error:") (optional " " "[" (id (one-or-more not-newline)) "]") (or (message (one-or-more not-newline)) (and "\n" (message (one-or-more " ") (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more (not (any ?\n ?|))))))) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-dedent-error-messages errors))) :modes (haskell-mode haskell-literate-mode) :next-checkers ((warning . haskell-hlint)) :working-directory flycheck-haskell--ghc-find-default-directory) (flycheck-def-config-file-var flycheck-hlintrc haskell-hlint ".hlint.yaml") (flycheck-def-args-var flycheck-hlint-args haskell-hlint :package-version '(flycheck . "0.25")) (flycheck-def-option-var flycheck-hlint-language-extensions nil haskell-hlint "Extensions list to enable for hlint. The value of this variable is a list of strings, where each string is a name of extension to enable in hlint (e.g. \"QuasiQuotes\")." :type '(repeat :tag "Extensions" (string :tag "Extension")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-def-option-var flycheck-hlint-ignore-rules nil haskell-hlint "Ignore rules list for hlint checks. The value of this variable is a list of strings, where each string is an ignore rule (e.g. \"Use fmap\")." :type '(repeat :tag "Ignore rules" (string :tag "Ignore rule")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-def-option-var flycheck-hlint-hint-packages nil haskell-hlint "Hint packages to include for hlint checks. The value of this variable is a list of strings, where each string is a default hint package (e.g. (\"Generalise\" \"Default\" \"Dollar\"))." :type '(repeat :tag "Hint packages" (string :tag "Hint package")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-define-checker haskell-hlint "A Haskell style checker using hlint. See URL `https://github.com/ndmitchell/hlint'." :command ("hlint" "--no-exit-code" (option-list "-X" flycheck-hlint-language-extensions concat) (option-list "-i=" flycheck-hlint-ignore-rules concat) (option-list "-h" flycheck-hlint-hint-packages concat) (config-file "-h" flycheck-hlintrc) (eval flycheck-hlint-args) source-inplace) :error-patterns ((info line-start (file-name) ":" (or (seq line ":" column (optional "-" end-column)) (seq "(" line "," column ")-(" end-line "," end-column ")")) ": Suggestion: " (message (one-or-more (and (one-or-more (not (any ?\n))) ?\n))) line-end) (warning line-start (file-name) ":" (or (seq line ":" column (optional "-" end-column)) (seq "(" line "," column ")-(" end-line "," end-column ")")) ": Warning: " (message (one-or-more (and (one-or-more (not (any ?\n))) ?\n))) line-end) (error line-start (file-name) ":" (or (seq line ":" column (optional "-" end-column)) (seq "(" line "," column ")-(" end-line "," end-column ")")) ": Error: " (message (one-or-more (and (one-or-more (not (any ?\n))) ?\n))) line-end)) :modes (haskell-mode haskell-literate-mode)) (flycheck-def-config-file-var flycheck-tidyrc html-tidy ".tidyrc") (flycheck-define-checker html-tidy "A HTML syntax and style checker using Tidy. See URL `https://github.com/htacg/tidy-html5'." :command ("tidy" (config-file "-config" flycheck-tidyrc) "-lang" "en" "-e" "-q") :standard-input t :error-patterns ((error line-start "line " line " column " column " - Error: " (message) line-end) (warning line-start "line " line " column " column " - Warning: " (message) line-end)) :modes (html-mode mhtml-mode nxhtml-mode)) (flycheck-def-config-file-var flycheck-jshintrc javascript-jshint ".jshintrc") (flycheck-def-option-var flycheck-jshint-extract-javascript nil javascript-jshint "Whether jshint should extract Javascript from HTML. If nil no extract rule is given to jshint. If `auto' only extract Javascript if a HTML file is detected. If `always' or `never' extract Javascript always or never respectively. Refer to the jshint manual at the URL `https://jshint.com/docs/cli/#flags' for more information." :type '(choice (const :tag "No extraction rule" nil) (const :tag "Try to extract Javascript when detecting HTML files" auto) (const :tag "Always try to extract Javascript" always) (const :tag "Never try to extract Javascript" never)) :safe #'symbolp :package-version '(flycheck . "26")) (flycheck-define-checker javascript-jshint "A Javascript syntax and style checker using jshint. See URL `https://www.jshint.com'." :command ("jshint" "--reporter=checkstyle" "--filename" source-original (config-file "--config" flycheck-jshintrc) (option "--extract=" flycheck-jshint-extract-javascript concat flycheck-option-symbol) "-") :standard-input t :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-remove-error-file-names "stdin" (flycheck-dequalify-error-ids errors))) :modes (js-mode js2-mode js3-mode rjsx-mode js-ts-mode)) (flycheck-def-args-var flycheck-eslint-args javascript-eslint :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-eslint-rules-directories nil javascript-eslint "A list of directories with custom rules for ESLint. The value of this variable is a list of strings, where each string is a directory with custom rules for ESLint. Refer to the ESLint manual at URL `https://eslint.org/docs/user-guide/command-line-interface#--rulesdir' for more information about the custom directories." :type '(repeat (directory :tag "Custom rules directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "29")) (defun flycheck-eslint-config-exists-p () "Whether there is a valid eslint config for the current buffer." (eql 0 (flycheck-call-checker-process 'javascript-eslint nil nil nil "--print-config" (or buffer-file-name "index.js")))) (defun flycheck-parse-eslint (output checker buffer) "Parse ESLint errors/warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://eslint.org' for more information about ESLint." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at .line .column (pcase .severity (2 'error) (1 'warning) (_ 'warning)) .message :id .ruleId :checker checker :buffer buffer :filename (buffer-file-name buffer) :end-line .endLine :end-column .endColumn))) (let-alist (caar (flycheck-parse-json output)) .messages))) (defun flycheck-eslint--find-working-directory (_checker) "Look for a working directory to run ESLint CHECKER in. This will be the directory that contains the `node_modules' directory. If no such directory is found in the directory hierarchy, it looks first for `.eslintignore' and then for `.eslintrc' files to detect the project root." (let* ((regex-config (concat "\\`\\.eslintrc" "\\(\\.\\(js\\|ya?ml\\|json\\)\\)?\\'"))) (when buffer-file-name (or (locate-dominating-file buffer-file-name "node_modules") (locate-dominating-file buffer-file-name ".eslintignore") (locate-dominating-file (file-name-directory buffer-file-name) (lambda (directory) (> (length (directory-files directory nil regex-config t)) 0))))))) (flycheck-define-checker javascript-eslint "A Javascript syntax and style checker using eslint. See URL `https://eslint.org/'." :command ("eslint" "--format=json" (option-list "--rulesdir" flycheck-eslint-rules-directories) (eval flycheck-eslint-args) "--stdin" "--stdin-filename" source-original) :standard-input t :error-parser flycheck-parse-eslint :enabled (lambda () (flycheck-eslint-config-exists-p)) :modes (js-mode js-jsx-mode js2-mode js2-jsx-mode js3-mode rjsx-mode typescript-mode js-ts-mode typescript-ts-mode tsx-ts-mode) :working-directory flycheck-eslint--find-working-directory :verify (lambda (_) (let* ((default-directory (flycheck-compute-working-directory 'javascript-eslint)) (have-config (flycheck-eslint-config-exists-p))) (list (flycheck-verification-result-new :label "config file" :message (if have-config "found" "missing or incorrect") :face (if have-config 'success '(bold error)))))) :error-explainer (lambda (err) (let ((error-code (flycheck-error-id err)) (url "https://eslint.org/docs/rules/%s")) (and error-code ;; skip non-builtin rules (not ;; `seq-contains-p' is only in seq >= 2.21 (with-no-warnings (seq-contains error-code ?/))) `(url . ,(format url error-code)))))) (flycheck-define-checker javascript-standard "A Javascript code and style checker for the (Semi-)Standard Style. This checker works with `standard' and `semistandard', defaulting to the former. To use it with the latter, set `flycheck-javascript-standard-executable' to `semistandard'. See URL `https://github.com/standard/standard' and URL `https://github.com/Flet/semistandard'." :command ("standard" "--stdin") :standard-input t :error-patterns ((error line-start " :" line ":" column ":" (message) line-end)) :modes (js-mode js-jsx-mode js2-mode js2-jsx-mode js3-mode rjsx-mode js-ts-mode)) (flycheck-define-checker json-jsonlint "A JSON syntax and style checker using jsonlint. See URL `https://github.com/zaach/jsonlint'." ;; We can't use standard input for jsonlint, because it doesn't output errors ;; anymore when using -c -q with standard input :/ :command ("jsonlint" "-c" "-q" source) :error-patterns ((error line-start (file-name) ": line " line ", col " column ", " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-increment-error-columns errors))) :modes (json-mode js-json-mode json-ts-mode)) (flycheck-define-checker json-python-json "A JSON syntax checker using Python json.tool module. See URL `https://docs.python.org/3.5/library/json.html#command-line-interface'." :command ("python3" "-m" "json.tool" source ;; Send the pretty-printed output to the null device null-device) :error-patterns ((error line-start (message) ": line " line " column " column ;; Ignore the rest of the line which shows the char position. (one-or-more not-newline) line-end)) :modes (json-mode js-json-mode json-ts-mode) ;; The JSON parser chokes if the buffer is empty and has no JSON inside :predicate flycheck-buffer-nonempty-p) (flycheck-define-checker json-jq "JSON checker using the jq tool. This checker accepts multiple consecutive JSON values in a single input, which is useful for jsonlines data. See URL `https://stedolan.github.io/jq/'." :command ("jq" "." source null-device) ;; Example error message: ;; parse error: Expected another key-value pair at line 3, column 1 :error-patterns ((error line-start (optional "parse error: ") (message) "at line " line ", column " column (zero-or-more not-newline) line-end)) :modes (json-mode js-json-mode json-ts-mode)) (flycheck-def-option-var flycheck-jsonnet-include-paths nil jsonnet "a list of include paths to specify to the jsonnet binary, via -J . For example (\"./lib\") ." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "35.0")) (flycheck-def-args-var flycheck-jsonnet-command-args jsonnet :package-version '(flycheck . "35.0")) (flycheck-define-checker jsonnet "A Jsonnet syntax checker using the jsonnet binary. See URL `https://jsonnet.org'." :command ("jsonnet" (option-list "-J" flycheck-jsonnet-include-paths) (eval flycheck-jsonnet-command-args) source-inplace) :error-patterns ((error line-start "STATIC ERROR: " (file-name) ":" (or (seq line ":" column (zero-or-one (seq "-" end-column))) (seq "(" line ":" column ")" "-" "(" end-line ":" end-column ")")) ": " (message) line-end) (error line-start "RUNTIME ERROR: " (message) "\n" (? "\t" (file-name) ":" ;; first line of the backtrace (or (seq line ":" column (zero-or-one (seq "-" end-column))) (seq "(" line ":" column ")" "-" "(" end-line ":" end-column ")"))))) :error-filter (lambda (errs) ;; Some errors are missing line numbers. See URL ;; `https://github.com/google/jsonnet/issues/786'. (dolist (err errs) (unless (flycheck-error-line err) (setf (flycheck-error-line err) 1))) (flycheck-sanitize-errors errs)) :modes jsonnet-mode) (flycheck-define-checker less "A LESS syntax checker using lessc. Requires lessc 1.4 or newer. See URL `https://lesscss.org'." :command ("lessc" "--lint" "--no-color" "-") :standard-input t :error-patterns ((error line-start (one-or-more word) ":" (message) " in - on line " line ", column " column ":" line-end)) :modes less-css-mode) (flycheck-define-checker less-stylelint "A LESS syntax and style checker using stylelint. See URL `https://stylelint.io/'." :command ("stylelint" (eval flycheck-stylelint-args) (option-flag "--quiet" flycheck-stylelint-quiet) (config-file "--config" flycheck-stylelintrc)) :standard-input t :verify (lambda (_) (flycheck--stylelint-verify 'less-stylelint)) :error-parser flycheck-parse-stylelint :predicate flycheck-buffer-nonempty-p :modes (less-css-mode)) (flycheck-define-checker llvm-llc "Flycheck LLVM IR checker using llc. See URL `https://llvm.org/docs/CommandGuide/llc.html'." :command ("llc" "-o" null-device source) :error-patterns ((error line-start ;; llc prints the executable path (zero-or-one (minimal-match (one-or-more not-newline)) ": ") (file-name) ":" line ":" column ": error: " (message) line-end)) :error-filter (lambda (errors) ;; sanitize errors occurring in inline assembly (flycheck-sanitize-errors (flycheck-remove-error-file-names "" errors))) :modes llvm-mode) (flycheck-def-config-file-var flycheck-luacheckrc lua-luacheck ".luacheckrc") (flycheck-def-option-var flycheck-luacheck-standards nil lua-luacheck "The standards to use in luacheck. The value of this variable is either a list of strings denoting the standards to use, or nil to pass nothing to luacheck. When non-nil, pass the standards via one or more `--std' options." :type '(choice (const :tag "Default" nil) (repeat :tag "Custom standards" (string :tag "Standard name"))) :safe #'flycheck-string-list-p) (make-variable-buffer-local 'flycheck-luacheck-standards) (flycheck-define-checker lua-luacheck "A Lua syntax checker using luacheck. See URL `https://github.com/mpeterv/luacheck'." :command ("luacheck" "--formatter" "plain" "--codes" ; Show warning codes "--no-color" (option-list "--std" flycheck-luacheck-standards) (config-file "--config" flycheck-luacheckrc) "--filename" source-original ;; Read from standard input "-") :standard-input t :error-patterns ((warning line-start (optional (file-name)) ":" line ":" column ": (" (id "W" (one-or-more digit)) ") " (message) line-end) (error line-start (optional (file-name)) ":" line ":" column ":" ;; `luacheck' before 0.11.0 did not output codes for errors, hence ;; the ID is optional here (optional " (" (id "E" (one-or-more digit)) ") ") (message) line-end)) :modes (lua-mode lua-ts-mode)) (flycheck-define-checker lua "A Lua syntax checker using the Lua compiler. See URL `https://www.lua.org/'." :command ("luac" "-p" "-") :standard-input t :error-patterns ((error line-start ;; Skip the name of the luac executable. (minimal-match (zero-or-more not-newline)) ": stdin:" line ": " (message) line-end)) :modes (lua-mode lua-ts-mode)) (flycheck-define-checker opam "A Opam syntax and style checker using opam lint. See URL `https://opam.ocaml.org/doc/man/opam-lint.html'." :command ("opam" "lint" "-") :standard-input t :error-patterns ((error line-start ; syntax error (one-or-more space) "error " (id ?2) ": File format error" (or (and " at line " line ", column " column ": " (message)) (and ": " (message))) line-end) (error line-start (one-or-more space) "error " (id ?3) (minimal-match (zero-or-more not-newline)) "at line " line ", column " column ": " (message) line-end) (error line-start (one-or-more space) "error " (id (one-or-more num)) ": " (message (one-or-more not-newline)) line-end) (warning line-start (one-or-more space) "warning " (id (one-or-more num)) ": " (message) line-end)) :error-filter (lambda (errors) (flycheck-increment-error-columns (flycheck-fill-empty-line-numbers errors))) :modes tuareg-opam-mode) (flycheck-def-option-var flycheck-perl-include-path nil perl "A list of include directories for Perl. The value of this variable is a list of strings, where each string is a directory to add to the include path of Perl. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-def-option-var flycheck-perl-module-list nil perl "A list of modules to use for Perl. The value of this variable is a list of strings, where each string is a module to `use' in Perl." :type '(repeat :tag "Module") :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-define-checker perl "A Perl syntax checker using the Perl interpreter. See URL `https://www.perl.org'." :command ("perl" "-w" "-c" (option-list "-I" flycheck-perl-include-path) (option-list "-M" flycheck-perl-module-list concat)) :standard-input t :error-patterns ((error line-start (minimal-match (message)) " at - line " line (or "." (and ", " (zero-or-more not-newline))) line-end)) :modes (perl-mode cperl-mode) :next-checkers (perl-perlcritic)) (flycheck-def-option-var flycheck-perlcritic-severity nil perl-perlcritic "The message severity for Perl Critic. The value of this variable is a severity level as integer, for the `--severity' option to Perl Critic." :type '(integer :tag "Severity level") :safe #'integerp :package-version '(flycheck . "0.18")) (flycheck-def-option-var flycheck-perlcritic-theme nil perl-perlcritic "The theme expression for Perl Critic. The value of this variable is passed as the `--theme' option to `Perl::Critic'. See the documentation of `Perl::Critic' for details." :type '(choice (const :tag "None" nil) (string :tag "Theme expression")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32-csv")) (flycheck-def-config-file-var flycheck-perlcriticrc perl-perlcritic ".perlcriticrc" :package-version '(flycheck . "26")) (flycheck-define-checker perl-perlcritic "A Perl syntax checker using Perl::Critic. See URL `https://metacpan.org/pod/Perl::Critic'." :command ("perlcritic" "--no-color" "--verbose" "%f/%l/%c/%s/%p/%m (%e)\n" (config-file "--profile" flycheck-perlcriticrc) (option "--severity" flycheck-perlcritic-severity nil flycheck-option-int) (option "--theme" flycheck-perlcritic-theme)) :standard-input t :error-patterns ((info line-start "STDIN/" line "/" column "/" (any "1") "/" (id (one-or-more (not (any "/")))) "/" (message) line-end) (warning line-start "STDIN/" line "/" column "/" (any "234") "/" (id (one-or-more (not (any "/")))) "/" (message) line-end) (error line-start "STDIN/" line "/" column "/" (any "5") "/" (id (one-or-more (not (any "/")))) "/" (message) line-end)) :modes (cperl-mode perl-mode) :next-checkers (perl-perlimports) :error-explainer (lambda (err) (let ((error-code (flycheck-error-id err)) (url "https://metacpan.org/pod/Perl::Critic::Policy::%s")) (and error-code `(url . ,(format url error-code)))))) (defun flycheck-perl-perlimports-parse-errors (output checker buffer) "Parse perlimports json output errors from OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://metacpan.org/dist/App-perlimports/view/script/perlimports' for more information about perlimports." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at .location.start.line .location.start.column 'info (concat .module " " .reason ":" (with-temp-buffer (insert (substring .diff (string-match-p "\n" .diff))) (diff-mode) (font-lock-ensure) (buffer-string))) :end-line .location.end.line :end-column .location.end.column :checker checker :buffer buffer))) (flycheck-parse-json output))) (flycheck-define-checker perl-perlimports "A checker for cleaning up Perl import statements. See URL `https://metacpan.org/dist/App-perlimports/view/script/perlimports'." :command ("perlimports" "--filename" source "--json" "--lint" "--no-preserve-duplicates" "--no-preserve-unused" "--no-tidy-whitespace" "--read-stdin") :standard-input t :error-parser flycheck-perl-perlimports-parse-errors :modes (cperl-mode perl-mode)) (flycheck-define-checker php "A PHP syntax checker using the PHP command line interpreter. See URL `https://php.net/manual/en/features.commandline.php'." :command ("php" "-l" "-d" "error_reporting=E_ALL" "-d" "display_errors=1" "-d" "log_errors=0" source) :error-patterns ((error line-start (or "Parse" "Fatal" "syntax") " error" (any ":" ",") " " (message) " in " (file-name) " on line " line line-end)) :modes (php-mode php-ts-mode php+-mode) :next-checkers ((warning . php-phpmd) (warning . php-phpcs))) (flycheck-def-option-var flycheck-phpmd-rulesets '("cleancode" "codesize" "controversial" "design" "naming" "unusedcode") php-phpmd "The rule sets for PHP Mess Detector. Set default rule sets and custom rule set files. See section \"Using multiple rule sets\" in the PHP Mess Detector manual at URL `https://phpmd.org/documentation/index.html'." :type '(repeat :tag "rule sets" (string :tag "A filename or rule set")) :safe #'flycheck-string-list-p) (flycheck-define-checker php-phpmd "A PHP style checker using PHP Mess Detector. See URL `https://phpmd.org/'." :command ("phpmd" source "xml" (eval (flycheck-option-comma-separated-list flycheck-phpmd-rulesets))) :error-parser flycheck-parse-phpmd :modes (php-mode php-ts-mode php+-mode) :next-checkers (php-phpcs)) (flycheck-def-option-var flycheck-phpcs-standard nil php-phpcs "The coding standard for PHP CodeSniffer. When nil, use the default standard from the global PHP CodeSniffer configuration. When set to a string, pass the string to PHP CodeSniffer which will interpret it as name as a standard, or as path to a standard specification." :type '(choice (const :tag "Default standard" nil) (string :tag "Standard name or file")) :safe #'flycheck-string-or-nil-p) (flycheck-define-checker php-phpcs "A PHP style checker using PHP Code Sniffer. Needs PHP Code Sniffer 2.6 or newer. See URL `https://pear.php.net/package/PHP_CodeSniffer/'." :command ("phpcs" "--report=checkstyle" ;; Use -q flag to force quiet mode ;; Quiet mode prevents errors from extra output when phpcs has ;; been configured with show_progress enabled "-q" (option "--standard=" flycheck-phpcs-standard concat) ;; Some files are not detected correctly ;; so it is necessary to pass the extension. (eval (when-let* ((fname buffer-file-name) (ext (file-name-extension fname))) (concat "--extensions=" ext))) ;; Pass original file name to phpcs. We need to concat explicitly ;; here, because phpcs really insists to get option and argument as ;; a single command line argument :| (eval (when (buffer-file-name) (concat "--stdin-path=" (buffer-file-name)))) ;; Read from standard input "-") :standard-input t :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "STDIN" errors))) :modes (php-mode php-ts-mode php+-mode) ;; phpcs seems to choke on empty standard input, hence skip phpcs if the ;; buffer is empty, see https://github.com/flycheck/flycheck/issues/907 :predicate flycheck-buffer-nonempty-p) (flycheck-define-checker php-phpcs-changed "A PHP style checker using PHPCS-Changed. Needs PHP Code Sniffer 2.6 or newer. See `https://github.com/sirbrillig/phpcs-changed'." :command ("phpcs-changed" "--git" "--git-base trunk" "--git-unstaged" (option "--standard=" flycheck-phpcs-standard concat) (eval (buffer-file-name)) ) :standard-input t :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "STDIN" errors))) :modes (php-mode php+-mode) ;; phpcs seems to choke on empty standard input, hence skip phpcs if the ;; buffer is empty, see https://github.com/flycheck/flycheck/issues/907 :predicate flycheck-buffer-nonempty-p) (flycheck-define-checker processing "Processing command line tool. See https://github.com/processing/processing/wiki/Command-Line" :command ("processing-java" "--force" ;; Don't change the order of these arguments, processing is pretty ;; picky (eval (concat "--sketch=" (file-name-directory (buffer-file-name)))) (eval (concat "--output=" (flycheck-temp-dir-system))) "--build") :error-patterns ((error line-start (file-name) ":" line ":" column (zero-or-more (or digit ":")) (message) line-end)) :modes processing-mode ;; This syntax checker needs a file name :predicate (lambda () (buffer-file-name))) (defun flycheck-proselint-parse-errors (output checker buffer) "Parse proselint json output errors from OUTPUT. CHECKER and BUFFER denoted the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://proselint.com/' for more information about proselint." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at-pos .start (pcase .severity (`"suggestion" 'info) (`"warning" 'warning) (`"error" 'error) ;; Default to error (_ 'error)) .message :id .check :buffer buffer :checker checker ;; See https://github.com/amperser/proselint/issues/1048 :end-pos .end))) (let-alist (car (flycheck-parse-json output)) .data.errors))) (flycheck-define-checker proselint "Flycheck checker using Proselint. See URL `https://proselint.com/'." :command ("proselint" "--json" "-") :standard-input t :error-parser flycheck-proselint-parse-errors :modes (text-mode markdown-mode gfm-mode message-mode org-mode)) (flycheck-def-option-var flycheck-protoc-import-path nil protobuf-protoc "A list of directories to resolve import directives. The value of this variable is a list of strings, where each string is a directory to add to the import path. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Import directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (flycheck-define-checker protobuf-protoc "A protobuf syntax checker using the protoc compiler. See URL `https://developers.google.com/protocol-buffers/'." :command ("protoc" "--error_format" "gcc" (eval (concat "--java_out=" (flycheck-temp-dir-system))) ;; Add the current directory to resolve imports (eval (concat "--proto_path=" (file-name-directory (buffer-file-name)))) ;; Add other import paths; this needs to be after the current ;; directory to produce the right output. See URL ;; `https://github.com/flycheck/flycheck/pull/1655' (option-list "--proto_path=" flycheck-protoc-import-path concat) source-inplace) :error-patterns ((info line-start (file-name) ":" line ":" column ": note: " (message) line-end) (error line-start (file-name) ":" line ":" column ": " (message) line-end) (error line-start (message "In file included from") " " (file-name) ":" line ":" column ":" line-end)) :modes protobuf-mode :predicate (lambda () (buffer-file-name))) (defun flycheck-prototool-project-root (&optional _checker) "Return the nearest directory holding the prototool.yaml configuration." (and buffer-file-name (locate-dominating-file buffer-file-name "prototool.yaml"))) (flycheck-define-checker protobuf-prototool "A protobuf syntax checker using prototool. See URL `https://github.com/uber/prototool'." :command ("prototool" "lint" source-original) :error-patterns ((warning line-start (file-name) ":" line ":" column ":" (message) line-end)) :modes protobuf-mode :enabled flycheck-prototool-project-root :predicate flycheck-buffer-saved-p) (flycheck-define-checker pug "A Pug syntax checker using the pug compiler. See URL `https://pugjs.org/'." :command ("pug" "-p" (eval (expand-file-name (buffer-file-name)))) :standard-input t :error-patterns ;; errors with includes/extends (e.g. missing files) ((error "Error: " (message) (zero-or-more not-newline) "\n" (zero-or-more not-newline) "at " (zero-or-more not-newline) " line " line) ;; error when placing anything other than a mixin or ;; block at the top-level of an extended template ;; also unknown filters (error line-start "Error: " (file-name) ":" line ":" column "\n\n" (message) line-end) ;; syntax/runtime errors (e.g. type errors, bad indentation, etc.) (error line-start (optional "Type") "Error: " (file-name) ":" line (optional ":" column) (zero-or-more not-newline) "\n" (one-or-more (or (zero-or-more not-newline) "|" (zero-or-more not-newline) "\n") (zero-or-more "-") (zero-or-more not-newline) "|" (zero-or-more not-newline) "\n") (zero-or-more not-newline) "\n" (one-or-more (zero-or-more not-newline) "|" (zero-or-more not-newline) "\n") (zero-or-more not-newline) "\n" (message) line-end)) :modes pug-mode) (flycheck-define-checker puppet-parser "A Puppet DSL syntax checker using puppet's own parser. See URL `https://puppet.com/'." :command ("puppet" "parser" "validate" "--color=false") :standard-input t :error-patterns ( ;; Patterns for Puppet 4 (error line-start "Error: Could not parse for environment " (one-or-more (in "a-z" "0-9" "_")) ":" (message) "(line: " line ", column: " column ")" line-end) ;; Errors from Puppet < 4 (error line-start "Error: Could not parse for environment " (one-or-more (in "a-z" "0-9" "_")) ":" (message (minimal-match (one-or-more anything))) " at line " line line-end) (error line-start ;; Skip over the path of the Puppet executable (minimal-match (zero-or-more not-newline)) ": Could not parse for environment " (one-or-more word) ": " (message (minimal-match (zero-or-more anything))) " at " (file-name "/" (zero-or-more not-newline)) ":" line line-end)) :modes (puppet-mode puppet-ts-mode) :next-checkers ((warning . puppet-lint))) (flycheck-def-config-file-var flycheck-puppet-lint-rc puppet-lint ".puppet-lint.rc" :package-version '(flycheck . "26")) (flycheck-def-option-var flycheck-puppet-lint-disabled-checks nil puppet-lint "Disabled checkers for `puppet-lint'. The value of this variable is a list of strings, where each string is the name of a check to disable (e.g. \"80chars\" or \"double_quoted_strings\"). See URL `https://puppet-lint.com/checks/' for a list of all checks and their names." :type '(repeat (string :tag "Check Name")) :package-version '(flycheck . "26")) (defun flycheck-puppet-lint-disabled-arg-name (check) "Create an argument to disable a puppetlint CHECK." (concat "--no-" check "-check")) (flycheck-define-checker puppet-lint "A Puppet DSL style checker using puppet-lint. See URL `https://puppet-lint.com/'." ;; We must check the original file, because Puppetlint is quite picky on the ;; names of files and there place in the directory structure, to comply with ;; Puppet's autoload directory layout. For instance, a class foo::bar is ;; required to be in a file foo/bar.pp. Any other place, such as a Flycheck ;; temporary file will cause an error. :command ("puppet-lint" (config-file "--config" flycheck-puppet-lint-rc) "--log-format" "%{path}:%{line}:%{kind}: %{message} (%{check})" (option-list "" flycheck-puppet-lint-disabled-checks concat flycheck-puppet-lint-disabled-arg-name) source-original) :error-patterns ((warning line-start (file-name) ":" line ":warning: " (message) line-end) (error line-start (file-name) ":" line ":error: " (message) line-end)) :modes (puppet-mode puppet-ts-mode) ;; Since we check the original file, we can only use this syntax checker if ;; the buffer is actually linked to a file, and if it is not modified. :predicate flycheck-buffer-saved-p) (defun flycheck-python-run-snippet (checker snippet) "Run a python SNIPPET and return the output. CHECKER's executable is assumed to be a Python REPL." (when-let (output (flycheck-call-checker-process-for-output checker nil nil "-c" snippet)) (string-trim output))) (defun flycheck-python-get-path (checker) "Compute the current Python path (CHECKER is a Python REPL) ." (flycheck-python-run-snippet checker "import sys; print(sys.path[1:])")) (defun flycheck-python-find-module (checker module) "Check if a Python MODULE is available (CHECKER is a Python REPL)." (flycheck-python-run-snippet checker (concat "import sys; sys.path.pop(0);" (format "import %s; print(%s.__file__)" module module)))) (defun flycheck-python-needs-module-p (checker) "Determine whether CHECKER needs to be invoked through Python. Previous versions of Flycheck called pylint and flake8 directly, while new version call them through `python -c'. This check ensures that we don't break existing code; it also allows people who use virtualenvs to run globally-installed checkers." (not (string-match-p (rx (or "pylint" "pylint3" "flake8") (or "-script.pyw" ".exe" ".bat" "") eos) (flycheck-checker-executable checker)))) (defun flycheck-python-verify-module (checker module) "Verify that a Python MODULE is available. Return nil if CHECKER's executable is not a Python REPL. This function's is suitable for a checker's :verify." (when (flycheck-python-needs-module-p checker) (let ((mod-path (flycheck-python-find-module checker module))) (list (flycheck-verification-result-new :label (format "`%s' module" module) :message (if mod-path (format "Found at %S" mod-path) (format "Missing; sys.path is %s" (flycheck-python-get-path checker))) :face (if mod-path 'success '(bold error))))))) (defun flycheck-python-module-args (checker module-name) "Compute arguments to pass to CHECKER's executable to run MODULE-NAME. Return nil if CHECKER's executable is not a Python REPL. Otherwise, return a list starting with -c (-m is not enough because it adds the current directory to Python's path)." (when (flycheck-python-needs-module-p checker) `("-c" ,(concat "import sys;sys.path.pop(0);import runpy;" (format "runpy.run_module(%S, run_name='__main__')" module-name ))))) (defcustom flycheck-python-project-files '("pyproject.toml" "setup.cfg" "mypy.ini" "pyrightconfig.json") "Files used to find where to run Python checkers from. Currently used for pylint, flake8, and pyright. The presence of one in these files indicates the root of the current project; `.pylintrc' is not part of the list because it is commonly found in ~/." :group 'flycheck :type '(repeat (string :tag "File name")) :package-version '(flycheck . "33") :safe #'flycheck-string-list-p) (defun flycheck-python-find-project-root (_checker) "Find the root directory of a Python project. The root directory is assumed to be the nearest parent directory that contains one of `flycheck-python-project-files'. If no such file is found, we use the same heuristic as epylint: the nearest parent directory that doesn't have a __init__.py file." (let ((start (if buffer-file-name (file-name-directory buffer-file-name) default-directory))) (or (flycheck--locate-dominating-file-matching start (regexp-opt flycheck-python-project-files)) (locate-dominating-file start (lambda (dir) (not (file-exists-p (expand-file-name "__init__.py" dir)))))))) (flycheck-def-config-file-var flycheck-flake8rc python-flake8 '(".flake8" "setup.cfg" "tox.ini")) (flycheck-def-option-var flycheck-flake8-error-level-alist '(("^E9.*$" . error) ; Syntax errors from pep8 ("^F82.*$" . error) ; undefined variables from pyflakes ("^F83.*$" . error) ; Duplicate arguments from flake8 ("^D.*$" . info) ; Docstring issues from flake8-pep257 ("^N.*$" . info) ; Naming issues from pep8-naming ) python-flake8 "An alist mapping flake8 error IDs to Flycheck error levels. Each item in this list is a cons cell `(PATTERN . LEVEL)' where PATTERN is a regular expression matched against the error ID, and LEVEL is a Flycheck error level symbol. Each PATTERN is matched in the order of appearance in this list against the error ID. If it matches the ID, the level of the corresponding error is set to LEVEL. An error that is not matched by any PATTERN defaults to warning level. The default value of this option matches errors from flake8 itself and from the following flake8 plugins: - pep8-naming - flake8-pep257 You may add your own mappings to this option in order to support further flake8 plugins." :type '(repeat (cons (regexp :tag "Error ID pattern") (symbol :tag "Error level"))) :package-version '(flycheck . "0.22")) (flycheck-def-option-var flycheck-flake8-maximum-complexity nil python-flake8 "The maximum McCabe complexity of methods. If nil, do not check the complexity of methods. If set to an integer, report any complexity greater than the value of this variable as warning. If set to an integer, this variable overrules any similar setting in the configuration file denoted by `flycheck-flake8rc'." :type '(choice (const :tag "Do not check McCabe complexity" nil) (integer :tag "Maximum complexity")) :safe #'integerp) (flycheck-def-option-var flycheck-flake8-maximum-line-length nil python-flake8 "The maximum length of lines. If set to an integer, the value of this variable denotes the maximum length of lines, overruling any similar setting in the configuration file denoted by `flycheck-flake8rc'. An error will be reported for any line longer than the value of this variable. If set to nil, use the maximum line length from the configuration file denoted by `flycheck-flake8rc', or the PEP 8 recommendation of 79 characters if there is no configuration with this setting." :type '(choice (const :tag "Default value") (integer :tag "Maximum line length in characters")) :safe #'integerp) (defun flycheck-flake8-fix-error-level (err) "Fix the error level of ERR. Update the error level of ERR according to `flycheck-flake8-error-level-alist'." (pcase-dolist (`(,pattern . ,level) flycheck-flake8-error-level-alist) (when (string-match-p pattern (flycheck-error-id err)) (setf (flycheck-error-level err) level))) err) (defun flycheck-flake8--find-project-root (_checker) "Find setup.cfg in a parent directory of the current buffer." ;; This is a workaround for `https://gitlab.com/pycqa/flake8/issues/517'; see ;; also `https://github.com/flycheck/flycheck/issues/1722' (locate-dominating-file (or buffer-file-name default-directory) "setup.cfg")) (flycheck-define-checker python-flake8 "A Python syntax and style checker using Flake8. Requires Flake8 3.0 or newer. See URL `https://flake8.readthedocs.io/'." ;; Not calling flake8 directly makes it easier to switch between different ;; Python versions; see https://github.com/flycheck/flycheck/issues/1055. :command ("python3" (eval (flycheck-python-module-args 'python-flake8 "flake8")) "--format=default" (config-file "--append-config" flycheck-flake8rc) (option "--max-complexity" flycheck-flake8-maximum-complexity nil flycheck-option-int) (option "--max-line-length" flycheck-flake8-maximum-line-length nil flycheck-option-int) (eval (when buffer-file-name (concat "--stdin-display-name=" buffer-file-name))) "-") :standard-input t :working-directory flycheck-python-find-project-root :error-filter (lambda (errors) (let ((errors (flycheck-sanitize-errors errors))) (seq-map #'flycheck-flake8-fix-error-level errors))) :error-patterns ((warning line-start (file-name) ":" line ":" (optional column ":") " " (id (one-or-more (any alpha)) (one-or-more digit)) " " (message (one-or-more not-newline)) line-end)) :enabled (lambda () (or (not (flycheck-python-needs-module-p 'python-flake8)) (flycheck-python-find-module 'python-flake8 "flake8"))) :verify (lambda (_) (flycheck-python-verify-module 'python-flake8 "flake8")) :modes (python-mode python-ts-mode) :next-checkers ((warning . python-pylint) (warning . python-mypy))) (flycheck-def-config-file-var flycheck-python-ruff-config python-ruff '("pyproject.toml" "ruff.toml" ".ruff.toml")) (flycheck-define-checker python-ruff "A Python syntax and style checker using Ruff. See URL `https://docs.astral.sh/ruff/'." :command ("ruff" "check" (config-file "--config" flycheck-python-ruff-config) "--output-format=concise" (option "--stdin-filename" buffer-file-name) "-") :standard-input t :error-filter (lambda (errors) (let* ((errors (flycheck-sanitize-errors errors)) (errors-with-ids (seq-filter #'flycheck-error-id errors))) (seq-union (seq-difference errors errors-with-ids) (seq-map #'flycheck-flake8-fix-error-level errors-with-ids)))) :error-patterns ((error line-start (or "-" (file-name)) ":" line ":" (optional column ":") " " "SyntaxError: " (message (one-or-more not-newline)) line-end) (warning line-start (or "-" (file-name)) ":" line ":" (optional column ":") " " (id (one-or-more (any alpha)) (one-or-more digit) " ") (message (one-or-more not-newline)) line-end)) :working-directory flycheck-python-find-project-root :modes (python-mode python-ts-mode) :next-checkers ((warning . python-mypy))) (flycheck-def-config-file-var flycheck-pylintrc python-pylint '("pylintrc" ".pylintrc" "pyproject.toml" "setup.cfg")) (flycheck-def-option-var flycheck-pylint-use-symbolic-id t python-pylint "Whether to use pylint message symbols or message codes. A pylint message has both an opaque identifying code (such as `F0401') and a more meaningful symbolic code (such as `import-error'). This option governs which should be used and reported to the user." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.25")) (defun flycheck-parse-pylint (output checker buffer) "Parse JSON OUTPUT of CHECKER on BUFFER as Pylint errors." (mapcar (lambda (err) (let-alist err ;; Pylint can return -1 as a line or a column, hence the call to ;; `max'. See `https://github.com/flycheck/flycheck/issues/1383'. (flycheck-error-new-at (and .line (max .line 1)) (and .column (max (1+ .column) 1)) (pcase .type ;; See "pylint/utils.py" ((or "fatal" "error") 'error) ((or "info" "convention") 'info) ((or "warning" "refactor" _) 'warning)) ;; Drop lines showing the error in context (and (string-match (rx (*? nonl) eol) .message) (match-string 0 .message)) :id (if flycheck-pylint-use-symbolic-id .symbol .message-id) :checker checker :buffer buffer :filename .path))) (car (flycheck-parse-json output)))) (flycheck-define-checker python-pylint "A Python syntax and style checker using Pylint. This syntax checker requires Pylint 1.0 or newer. See URL `https://www.pylint.org/'." ;; --reports=n disables the scoring report. ;; Not calling pylint directly makes it easier to switch between different ;; Python versions; see https://github.com/flycheck/flycheck/issues/1055. :command ("python3" (eval (flycheck-python-module-args 'python-pylint "pylint")) "--reports=n" "--output-format=json" (config-file "--rcfile=" flycheck-pylintrc concat) ;; Need `source-inplace' for relative imports (e.g. `from .foo ;; import bar'), see https://github.com/flycheck/flycheck/issues/280 source-inplace) :error-parser flycheck-parse-pylint :working-directory flycheck-python-find-project-root :enabled (lambda () (or (not (flycheck-python-needs-module-p 'python-pylint)) (flycheck-python-find-module 'python-pylint "pylint"))) :verify (lambda (_) (flycheck-python-verify-module 'python-pylint "pylint")) :error-explainer (lambda (err) (when-let (id (flycheck-error-id err)) (apply #'flycheck-call-checker-process-for-output 'python-pylint nil t (append (flycheck-python-module-args 'python-pylint "pylint") (list (format "--help-msg=%s" id)))))) :modes (python-mode python-ts-mode) :next-checkers ((warning . python-mypy))) (flycheck-define-checker python-pycompile "A Python syntax checker using Python's builtin compiler. See URL `https://docs.python.org/3.4/library/py_compile.html'." :command ("python3" "-m" "py_compile" source) :error-patterns ;; Python 2.7 ((error line-start " File \"" (file-name) "\", line " line "\n" (>= 2 (zero-or-more not-newline) "\n") "SyntaxError: " (message) line-end) (error line-start "Sorry: IndentationError: " (message) "(" (file-name) ", line " line ")" line-end) ;; 2.6 (error line-start "SyntaxError: ('" (message (one-or-more (not (any "'")))) "', ('" (file-name (one-or-more (not (any "'")))) "', " line ", " column ", " (one-or-more not-newline) line-end)) :working-directory flycheck-python-find-project-root :modes (python-mode python-ts-mode) :next-checkers ((warning . python-mypy))) (defun flycheck-pyright--parse-error (output checker buffer) "Parse pyright errors/warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively." (seq-map (lambda (err) (let-alist err (flycheck-error-new-at (+ 1 .range.start.line) (+ 1 .range.start.character) (pcase .severity ("error" 'error) ("warning" 'warning) (_ 'warning)) .message :end-line (+ 1 .range.end.line) :end-column (+ 1 .range.end.character) :checker checker :buffer buffer :filename (buffer-file-name buffer)))) (cdr (nth 2 (car (flycheck-parse-json output)))))) (flycheck-define-checker python-pyright "Static type checker for Python See URL https://github.com/microsoft/pyright." :command ("pyright" "--outputjson" source-inplace) :working-directory flycheck-python-find-project-root :error-parser flycheck-pyright--parse-error :modes (python-mode python-ts-mode)) (define-obsolete-variable-alias 'flycheck-python-mypy-ini 'flycheck-python-mypy-config "32") (flycheck-def-config-file-var flycheck-python-mypy-config python-mypy '("mypy.ini" "pyproject.toml" "setup.cfg")) (flycheck-def-option-var flycheck-python-mypy-cache-dir nil python-mypy "Directory used to write .mypy_cache directories." :type '(choice (const :tag "Write to the working directory" nil) (const :tag "Never write .mypy_cache directories" null-device) (string :tag "Path")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (flycheck-def-option-var flycheck-python-mypy-python-executable nil python-mypy "Python executable to find the installed PEP 561 packages." :type '(choice (const :tag "Same as mypy's" nil) (string :tag "Path")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "33")) (flycheck-define-checker python-mypy "Mypy syntax and type checker. Requires mypy>=0.730. See URL `https://mypy-lang.org/'." :command ("mypy" "--show-column-numbers" "--no-pretty" (config-file "--config-file" flycheck-python-mypy-config) (option "--cache-dir" flycheck-python-mypy-cache-dir) (option "--python-executable" flycheck-python-mypy-python-executable) source-original) :error-patterns ((error line-start (file-name) ":" line (optional ":" column) ": error:" (message) line-end) (warning line-start (file-name) ":" line (optional ":" column) ": warning:" (message) line-end) (info line-start (file-name) ":" line (optional ":" column) ": note:" (message) line-end)) :working-directory flycheck-python-find-project-root :modes (python-mode python-ts-mode) ;; Ensure the file is saved, to work around ;; https://github.com/python/mypy/issues/4746. :predicate flycheck-buffer-saved-p) (flycheck-def-option-var flycheck-lintr-caching t r-lintr "Whether to enable caching in lintr. By default, lintr caches all expressions in a file and re-checks only those that have changed. Setting this option to nil disables caching in case there are problems." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.23")) (flycheck-def-option-var flycheck-lintr-linters "default_linters" r-lintr "Linters to use with lintr. The value of this variable is a string containing an R expression, which selects linters for lintr." :type 'string :risky t :package-version '(flycheck . "0.23")) (defun flycheck-r-has-lintr (checker) "Whether CHECKER (R) has installed the `lintr' library." (eql 0 (flycheck-call-checker-process checker nil nil nil "--slave" "--no-restore" "--no-save" "-e" "library('lintr')"))) (flycheck-define-checker r-lintr "An R style and syntax checker using the lintr package. See URL `https://github.com/jimhester/lintr'." :command ("R" "--slave" "--no-restore" "--no-save" "-e" (eval (concat "library(lintr);" "try(lint(commandArgs(TRUE)" ", cache=" (if flycheck-lintr-caching "TRUE" "FALSE") ", " flycheck-lintr-linters "))")) "--args" source) :error-patterns ((info line-start (file-name) ":" line ":" column ": style: " (message) line-end) (warning line-start (file-name) ":" line ":" column ": warning: " (message) line-end) (error line-start (file-name) ":" line ":" column ": error: " (message) line-end)) :modes (ess-mode ess-r-mode) :predicate ;; Don't check ESS files which do not contain R, and make sure that lintr is ;; actually available (lambda () (and (equal ess-language "S") (flycheck-r-has-lintr 'r-lintr))) :verify (lambda (checker) (let ((has-lintr (flycheck-r-has-lintr checker))) (list (flycheck-verification-result-new :label "lintr library" :message (if has-lintr "present" "missing") :face (if has-lintr 'success '(bold error))))))) (flycheck-define-checker r "An R syntax checker using the builtin `parse' function. See URL: `https://www.r-project.org/'." :command ("R" "--slave" "--no-restore" "--no-save" "-e" "parse(file=file('stdin'), srcfile='')") :standard-input t :error-patterns ((error line-start (zero-or-more space) ":" line ":" column ": " (message) line-end)) :modes (ess-mode ess-r-mode) :predicate ;; Don't check ESS files which do not contain R (lambda () (equal ess-language "S"))) (defun flycheck-racket-has-expand-p (checker) "Whether the executable of CHECKER provides the `expand' command." (eql 0 (flycheck-call-checker-process checker nil nil nil "expand"))) (flycheck-define-checker racket "A Racket syntax checker with `raco expand'. The `compiler-lib' racket package is required for this syntax checker. See URL `https://racket-lang.org/'." :command ("raco" "expand" source-inplace) :predicate (lambda () (and (or (not (eq major-mode 'scheme-mode)) ;; In `scheme-mode' we must check the current Scheme implementation ;; being used (and (boundp 'geiser-impl--implementation) (eq geiser-impl--implementation 'racket))) (flycheck-racket-has-expand-p 'racket))) :verify (lambda (checker) (let ((has-expand (flycheck-racket-has-expand-p checker)) (in-scheme-mode (eq major-mode 'scheme-mode)) (geiser-impl (bound-and-true-p geiser-impl--implementation))) (list (flycheck-verification-result-new :label "compiler-lib package" :message (if has-expand "present" "missing") :face (if has-expand 'success '(bold error))) (flycheck-verification-result-new :label "Geiser Implementation" :message (cond ((not in-scheme-mode) "Using Racket Mode") ((eq geiser-impl 'racket) "Racket") (geiser-impl (format "Other: %s" geiser-impl)) (t "Geiser not active")) :face (cond ((or (not in-scheme-mode) (eq geiser-impl 'racket)) 'success) (t '(bold error))))))) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-increment-error-columns (seq-remove (lambda (err) (string-suffix-p "/share/racket/pkgs/compiler-lib/compiler/commands/expand.rkt" (flycheck-error-filename err))) errors)))) :error-patterns ((error line-start (zero-or-more space) (file-name) ":" line ":" column ":" (message) line-end)) :modes (racket-mode scheme-mode)) (flycheck-define-checker rpm-rpmlint "A RPM SPEC file syntax checker using rpmlint. See URL `https://github.com/rpm-software-management/rpmlint'." :command ("rpmlint" source) :error-patterns ((error line-start (file-name) ":" (optional line ":") " E: " (message) line-end) (warning line-start (file-name) ":" (optional line ":") " W: " (message) line-end)) :error-filter ;; rpmlint 1.1 outputs a spurious error for the temp file created by flycheck (lambda (errors) (dolist (err (seq-remove (lambda (err) (string-suffix-p "(none)" (flycheck-error-filename err))) errors)) ;; Add fake line numbers if they are missing in the lint output (unless (flycheck-error-line err) (setf (flycheck-error-line err) 1))) errors) :error-explainer (lambda (error) (when-let* ((error-message (flycheck-error-message error)) (message-id (save-match-data (string-match "\\([^ ]+\\)" error-message) (match-string 1 error-message)))) (flycheck-call-checker-process-for-output 'rpm-rpmlint nil t "-I" message-id))) :modes (sh-mode rpm-spec-mode) :predicate (lambda () (or (not (eq major-mode 'sh-mode)) ;; In `sh-mode', we need the proper shell (eq sh-shell 'rpm)))) (flycheck-def-config-file-var flycheck-markdown-markdownlint-cli-config markdown-markdownlint-cli '(".markdownlint.json" ".markdownlint.jsonc" ".markdownlint.yaml") :package-version '(flycheck . "33")) (flycheck-def-option-var flycheck-markdown-markdownlint-cli-disable-rules nil markdown-markdownlint-cli "Rules to disable for markdownlint-cli." :type '(repeat :tag "Disabled rule" (string :tag "Rule name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "33")) (flycheck-def-option-var flycheck-markdown-markdownlint-cli-enable-rules nil markdown-markdownlint-cli "Rules to enable for markdownlint-cli." :type '(repeat :tag "Enabled rule" (string :tag "Rule name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "33")) (flycheck-define-checker markdown-markdownlint-cli "Markdown checker using markdownlint-cli. See URL `https://github.com/igorshubovych/markdownlint-cli'." :command ("markdownlint" (config-file "--config" flycheck-markdown-markdownlint-cli-config) (option-list "--disable" flycheck-markdown-markdownlint-cli-disable-rules) (option-list "--enable" flycheck-markdown-markdownlint-cli-enable-rules) "--" source) :error-patterns ((error line-start (file-name) ":" line (? ":" column) " " (id (one-or-more (not (any space)))) " " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "(string)" errors))) :modes (markdown-mode gfm-mode) :error-explainer (lambda (err) (let ((error-code (substring (flycheck-error-id err) 0 5)) (url "https://github.com/DavidAnson/markdownlint/blob/main/doc/Rules.md#%s")) (and error-code `(url . ,(format url error-code)))))) (flycheck-def-config-file-var flycheck-markdown-markdownlint-cli2-config markdown-markdownlint-cli2 '(".markdownlint-cli2.json" ".markdownlint-cli2.jsonc" ".markdownlint-cli2.yaml") :package-version '(flycheck . "35")) (flycheck-define-checker markdown-markdownlint-cli2 "Markdown checker using markdownlint-cli2. See URL `https://github.com/DavidAnson/markdownlint-cli2'." :command ("markdownlint-cli2" (config-file "--config" flycheck-markdown-markdownlint-cli2-config) "--" source) :error-patterns ((error line-start (file-name) ":" line (? ":" column) " " (id (one-or-more (not (any space)))) " " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "(string)" errors))) :modes (markdown-mode gfm-mode) :error-explainer (lambda (err) (let ((error-code (substring (flycheck-error-id err) 0 5)) (url "https://github.com/DavidAnson/markdownlint/blob/main/doc/Rules.md#%s")) (and error-code `(url . ,(format url error-code)))))) (flycheck-def-option-var flycheck-markdown-mdl-rules nil markdown-mdl "Rules to enable for mdl. The value of this variable is a list of strings each of which is the name of a rule to enable. By default all rules are enabled. See URL `https://git.io/vhi2t'." :type '(repeat :tag "Enabled rules" (string :tag "rule name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "27")) (flycheck-def-option-var flycheck-markdown-mdl-tags nil markdown-mdl "Rule tags to enable for mdl. The value of this variable is a list of strings each of which is the name of a rule tag. Only rules with these tags are enabled. By default all rules are enabled. See URL `https://git.io/vhi2t'." :type '(repeat :tag "Enabled tags" (string :tag "tag name")) :safe #'flycheck-string-list-p :package-version '(flycheck . "27")) (flycheck-def-config-file-var flycheck-markdown-mdl-style markdown-mdl nil :package-version '(flycheck . "27")) (flycheck-define-checker markdown-mdl "Markdown checker using mdl. See URL `https://github.com/markdownlint/markdownlint'." :command ("mdl" (config-file "--style" flycheck-markdown-mdl-style) (option "--tags=" flycheck-markdown-mdl-tags concat flycheck-option-comma-separated-list) (option "--rules=" flycheck-markdown-mdl-rules concat flycheck-option-comma-separated-list)) :standard-input t :error-patterns ((error line-start (file-name) ":" line ": " (id (one-or-more alnum)) " " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "(stdin)" errors))) :modes (markdown-mode gfm-mode)) (flycheck-def-config-file-var flycheck-markdown-pymarkdown-config markdown-pymarkdown nil :package-version '(flycheck . "34")) (flycheck-define-checker markdown-pymarkdown "Markdown checker using PyMarkdown. See URL `https://pypi.org/project/pymarkdownlnt/'." :command ("pymarkdown" (config-file "--config" flycheck-markdown-markdownlint-cli-config) "scan" source) :error-patterns ((error line-start (file-name) ":" line (? ":" column) ": " (id (one-or-more alnum)) ": " (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "(string)" errors))) :modes (markdown-mode gfm-mode)) (flycheck-define-checker nix "Nix checker using nix-instantiate. See URL `https://nixos.org/nix/manual/#sec-nix-instantiate'." :command ("nix-instantiate" "--parse" "-") :standard-input t :error-patterns ((error line-start "error: " (message) (one-or-more "\n") (zero-or-more space) "at «stdin»:" line ":" column ":" line-end) (error line-start "at: (" line ":" column ") from stdin" (one-or-more "\n" (zero-or-more space (one-or-more not-newline))) (message) line-end) (error line-start "error: " (message) " at " (file-name) ":" line ":" column line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-remove-error-file-names "(string)" errors))) :next-checkers ((warning . nix-linter)) :modes (nix-mode nix-ts-mode)) (defun flycheck-parse-nix-linter (output checker buffer) "Parse nix-linter warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://github.com/Synthetica9/nix-linter' for more information about nix-linter." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at .pos.spanBegin.sourceLine .pos.spanBegin.sourceColumn 'warning .description :id .offense :checker checker :buffer buffer :filename (buffer-file-name buffer) :end-line .pos.spanEnd.sourceLine :end-column .pos.spanEnd.sourceColumn))) (flycheck-parse-json output))) (flycheck-define-checker nix-linter "Nix checker using nix-linter. See URL `https://github.com/Synthetica9/nix-linter'." :command ("nix-linter" "--json-stream" "-") :standard-input t :error-parser flycheck-parse-nix-linter :error-explainer (lambda (error) (when-let (error-code (flycheck-error-id error)) (flycheck-call-checker-process-for-output 'nix-linter nil t "--help-for" error-code))) :modes (nix-mode nix-ts-mode)) (defun flycheck-parse-statix (output checker buffer) "Parse statix warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://github.com/nerdypepper/statix' for more information about statix." (mapcar (lambda (err) ;; Diagnostic information is a (seemingly always) 1 element array. (let-alist (car (alist-get 'diagnostics err)) (let ((message .message) (start-line .at.from.line) (start-column .at.from.column) (end-line .at.to.line) (end-column .at.to.column)) (let-alist err (flycheck-error-new-at start-line start-column (pcase .severity ("Error" 'error) ("Warn" 'warning) (_ 'warning)) (format "%s: %s" .note message) :id (format "%s%02d" (pcase .severity ("Error" "E") ("Warn" "W") (_ "")) .code) :checker checker :buffer buffer :filename (buffer-file-name buffer) :end-line end-line :end-column end-column))))) (alist-get 'report (car (flycheck-parse-json output))))) (flycheck-define-checker statix "Nix checker using statix. See URL `https://github.com/nerdypepper/statix'." :command ("statix" "check" "-o=json" source) :error-parser flycheck-parse-statix :modes nix-mode) (defun flycheck-locate-sphinx-source-directory () "Locate the Sphinx source directory for the current buffer. Return the source directory, or nil, if the current buffer is not part of a Sphinx project." (when-let* ((filename (buffer-file-name)) (dir (locate-dominating-file filename "conf.py"))) (expand-file-name dir))) (flycheck-define-checker rst "A ReStructuredText (RST) syntax checker using Docutils. See URL `https://docutils.sourceforge.net/'." ;; include:: directives :command ("rst2pseudoxml.py" "--report=2" "--halt=5" ;; Read from standard input and throw output away "-" null-device) :standard-input t :error-patterns ((warning line-start ":" line ": (WARNING/2) " (message) line-end) (error line-start ":" line ": (" (or "ERROR/3" "SEVERE/4") ") " (message) line-end)) :modes rst-mode) (flycheck-def-option-var flycheck-sphinx-warn-on-missing-references t rst-sphinx "Whether to warn about missing references in Sphinx. When non-nil (the default), warn about all missing references in Sphinx via `-n'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.17")) (flycheck-define-checker rst-sphinx "A ReStructuredText (RST) syntax checker using Sphinx. Requires Sphinx 1.2 or newer. See URL `https://sphinx-doc.org'." :command ("sphinx-build" "-b" "pseudoxml" "-q" "-N" ; Reduced output and no colors (option-flag "-n" flycheck-sphinx-warn-on-missing-references) (eval (flycheck-locate-sphinx-source-directory)) temporary-directory ; Redirect the output to a temporary ; directory source-original) ; Sphinx needs the original document :error-patterns ((warning line-start (file-name) ":" line ": WARNING: " (message) line-end) (error line-start (file-name) ":" line ": " (or "ERROR" "SEVERE") ": " (message) line-end)) :modes rst-mode :predicate (lambda () (and (flycheck-buffer-saved-p) (flycheck-locate-sphinx-source-directory)))) (defun flycheck-ruby--find-project-root (_checker) "Compute an appropriate working-directory for flycheck-ruby. This is either a parent directory containing a Gemfile, or nil." (and buffer-file-name (locate-dominating-file buffer-file-name "Gemfile"))) (defun flycheck-ruby--filter-rubocop-errors (errors) "Filter RuboCop ERRORS attributed to dummy stdin filename." (flycheck-remove-error-file-names (flycheck--file-truename (expand-file-name "stdin")) errors)) (flycheck-def-config-file-var flycheck-rubocoprc ruby-rubocop ".rubocop.yml") (flycheck-def-option-var flycheck-rubocop-lint-only nil (ruby-rubocop ruby-standard ruby-chef-cookstyle) "Whether to only report code issues in Rubocop, Cookstyle and Standard. When non-nil, only report code issues, via `--lint'. Otherwise report style issues as well." :safe #'booleanp :type 'boolean :package-version '(flycheck . "0.16")) (defconst flycheck-ruby-rubocop-error-patterns '((info line-start (file-name) ":" line ":" column ": C: " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end) (warning line-start (file-name) ":" line ":" column ": W: " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end) (error line-start (file-name) ":" line ":" column ": " (or "E" "F") ": " (optional (id (one-or-more (not (any ":")))) ": ") (message) line-end))) (flycheck-def-executable-var ruby-rubocop "rubocop") (flycheck-define-command-checker 'ruby-rubocop "A Ruby syntax and style checker using the RuboCop tool. You need at least RuboCop 0.34 for this syntax checker. See URL `https://rubocop.org/'." ;; ruby-standard is defined based on this checker :command '("rubocop" "--display-cop-names" "--force-exclusion" "--format" "emacs" (config-file "--config" flycheck-rubocoprc) (option-flag "--lint" flycheck-rubocop-lint-only) ;; RuboCop takes the original file name as argument when reading ;; from standard input, but it chokes when that name is the empty ;; string, so fall back to "stdin" in order to handle buffers with ;; no backing file (e.g. org-mode snippet buffers) "--stdin" (eval (or (buffer-file-name) "stdin"))) :standard-input t :working-directory #'flycheck-ruby--find-project-root :error-patterns flycheck-ruby-rubocop-error-patterns :error-filter #'flycheck-ruby--filter-rubocop-errors :modes '(enh-ruby-mode ruby-mode ruby-ts-mode) :next-checkers '((warning . ruby-reek) (warning . ruby-chef-cookstyle))) (flycheck-def-executable-var ruby-chef-cookstyle "cookstyle") (flycheck-define-command-checker 'ruby-chef-cookstyle "A Chef (Ruby) syntax and style checker using the Cookstyle tool. Basically Cookstyle is a thin wrapper around RuboCop, so this checker is essentially the same. See URL `https://github.com/chef/cookstyle'." :command '("cookstyle" "--display-cop-names" "--force-exclusion" "--format" "emacs" (config-file "--config" flycheck-rubocoprc) (option-flag "--lint" flycheck-rubocop-lint-only) ;; RuboCop takes the original file name as argument when reading ;; from standard input, but it chokes when that name is the empty ;; string, so fall back to "stdin" in order to handle buffers with ;; no backing file (e.g. org-mode snippet buffers) "--stdin" (eval (or (buffer-file-name) "stdin"))) :standard-input t :working-directory #'flycheck-ruby--find-project-root :error-patterns flycheck-ruby-rubocop-error-patterns :error-filter #'flycheck-ruby--filter-rubocop-errors :modes '(enh-ruby-mode ruby-mode ruby-ts-mode) :predicate (lambda () (let ((parent-dir (file-name-directory (directory-file-name (expand-file-name default-directory))))) (or ;; Chef CookBook ;; https://docs.opscode.com/chef/knife.html#id38 (locate-dominating-file parent-dir "recipes") ;; Knife Solo ;; https://matschaffer.github.io/knife-solo/#label-Init+command (locate-dominating-file parent-dir "cookbooks")))) :next-checkers '((warning . ruby-reek))) (flycheck-def-config-file-var flycheck-ruby-standardrc ruby-standard ".standard.yml") (flycheck-def-executable-var ruby-standard "standardrb") (flycheck-define-command-checker 'ruby-standard "A Ruby syntax and style checker using the StandardRB gem. See URL `https://github.com/testdouble/standard' for more information." ;; This checker is derived from ruby-rubocop; see above :command '("standardrb" "--display-cop-names" "--force-exclusion" "--format" "emacs" "--cache" "false" (config-file "--config" flycheck-ruby-standardrc) (option-flag "--lint" flycheck-rubocop-lint-only) "--stdin" source-original) :standard-input t :working-directory #'flycheck-ruby--find-project-root :error-patterns flycheck-ruby-rubocop-error-patterns :error-filter #'flycheck-ruby--filter-rubocop-errors :modes '(enh-ruby-mode ruby-mode ruby-ts-mode) :next-checkers '((warning . ruby-reek) (warning . ruby-chef-cookstyle))) (flycheck-def-config-file-var flycheck-reekrc ruby-reek ".reek.yml" :safe #'string-or-null-p :package-version '(flycheck . "30")) (flycheck-define-checker ruby-reek "A Ruby smell checker using reek. See URL `https://github.com/troessner/reek'." :command ("reek" "--format" "json" (config-file "--config" flycheck-reekrc) source) :error-parser flycheck-parse-reek :modes (enh-ruby-mode ruby-mode ruby-ts-mode)) (flycheck-define-checker ruby "A Ruby syntax checker using the standard Ruby interpreter. Please note that the output of different Ruby versions and implementations varies wildly. This syntax checker supports current versions of MRI and JRuby, but may break when used with other implementations or future versions of these implementations. Please consider using `ruby-rubocop' or `ruby-reek' instead. See URL `https://www.ruby-lang.org/'." :command ("ruby" "-w" "-c") :standard-input t :error-patterns ;; These patterns support output from JRuby, too, to deal with RVM or Rbenv ((error line-start "SyntaxError in -:" line ": " (message) line-end) (warning line-start "-:" line ":" (optional column ":") " warning: " (message) line-end) ;; Ruby 3.4 includes the interpreter path when emitting syntax errors (error line-start (optional (one-or-more (not (any ":"))) ": ") "-:" line ": " (message) line-end)) :modes (enh-ruby-mode ruby-mode ruby-ts-mode) :next-checkers ((warning . ruby-chef-cookstyle))) (flycheck-define-checker ruby-jruby "A Ruby syntax checker using the JRuby interpreter. This syntax checker is very primitive, and may break on future versions of JRuby. Please consider using `ruby-rubocop' instead. See URL `https://jruby.org/'." :command ("jruby" "-w" "-c") :standard-input t :error-patterns ((error line-start "SyntaxError in -:" line ": " (message) line-end) (warning line-start "-:" line ": warning: " (message) line-end) (error line-start "-:" line ": " (message) line-end)) :modes (enh-ruby-mode ruby-mode ruby-ts-mode)) (flycheck-def-args-var flycheck-cargo-check-args (rust-cargo) :package-version '(flycheck . "32")) (flycheck-def-args-var flycheck-rust-args (rust) :package-version '(flycheck . "0.24")) (flycheck-def-option-var flycheck-rust-check-tests t (rust-cargo rust) "Whether to check test code in Rust. For the `rust' checker: When non-nil, `rustc' is passed the `--test' flag, which will check any code marked with the `#[cfg(test)]' attribute and any functions marked with `#[test]'. Otherwise, `rustc' is not passed `--test' and test code will not be checked. Skipping `--test' is necessary when using `#![no_std]', because compiling the test runner requires `std'. For the `rust-cargo' checker: When non-nil, calls `cargo test --no-run' instead of `cargo check'." :type 'boolean :safe #'booleanp :package-version '("flycheck" . "0.19")) (flycheck-def-option-var flycheck-rust-crate-root nil rust "A path to the crate root for the current buffer. The value of this variable is either a string with the path to the crate root for the current buffer, or nil if the current buffer is a crate. A relative path is relative to the current buffer. If this variable is non nil the current buffer will only be checked if it is not modified, i.e. after it has been saved." :type '(choice (const :tag "Unspecified" nil) (file :tag "Root")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "0.20")) (make-variable-buffer-local 'flycheck-rust-crate-root) (flycheck-def-option-var flycheck-rust-crate-type "lib" (rust-cargo rust) "The type of the Rust Crate to check. For `rust-cargo', the value should be a string denoting the target type passed to Cargo. See `flycheck-rust-valid-crate-type-p' for the list of allowed values. For `rust', the value should be a string denoting the crate type for the `--crate-type' flag of rustc." :type '(choice (const :tag "nil (rust/rust-cargo)" nil) (const :tag "lib (rust/rust-cargo)" "lib") (const :tag "bin (rust/rust-cargo)" "bin") (const :tag "example (rust-cargo)" "example") (const :tag "test (rust-cargo)" "test") (const :tag "bench (rust-cargo)" "bench") (const :tag "rlib (rust)" "rlib") (const :tag "dylib (rust)" "dylib") (const :tag "cdylib (rust)" "cdylib") (const :tag "staticlib (rust)" "staticlib") (const :tag "metadata (rust)" "metadata")) :safe #'stringp :package-version '(flycheck . "0.20")) (make-variable-buffer-local 'flycheck-rust-crate-type) (flycheck-def-option-var flycheck-rust-binary-name nil rust-cargo "The name of the binary to pass to `cargo check --CRATE-TYPE'. The value of this variable is a string denoting the name of the target to check: usually the name of the crate, or the name of one of the files under `src/bin', `tests', `examples' or `benches'. This always requires a non-nil value, unless `flycheck-rust-crate-type' is `lib' or nil, in which case it is ignored." :type '(choice (const :tag "Unspecified" nil) (string :tag "Binary name")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "28")) (make-variable-buffer-local 'flycheck-rust-binary-name) (flycheck-def-option-var flycheck-rust-features nil rust-cargo "List of features to activate during build or check. The value of this variable is a list of strings denoting features that will be activated to build the target to check. Features will be passed to `cargo check --features=FEATURES'." :type '(repeat :tag "Features to activate" (string :tag "Feature")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-rust-features) (flycheck-def-option-var flycheck-rust-library-path nil rust "A list of library directories for Rust. The value of this variable is a list of strings, where each string is a directory to add to the library path of Rust. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Library directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.18")) (defun flycheck--fontify-as-markdown () "Place current buffer in `markdown-view-mode' and fontify it." (when (fboundp 'markdown-view-mode) (let ((markdown-fontify-code-block-default-mode 'rust-mode) (markdown-fontify-code-blocks-natively t) (markdown-hide-markup t)) (markdown-view-mode) (font-lock-flush) (font-lock-ensure)))) (defun flycheck-rust-error-explainer (error) "Return an explanation for the given `flycheck-error' ERROR." (when-let (error-code (flycheck-error-id error)) (lambda () (flycheck-call-checker-process 'rust nil standard-output t "--explain" error-code) (with-current-buffer standard-output (flycheck--fontify-as-markdown))))) (defun flycheck-rust-error-filter (errors) "Filter ERRORS from rustc output that have no explanatory value." (seq-remove (lambda (err) (or ;; Macro errors emit a diagnostic in a phony file, ;; e.g. "". (when-let (filename (flycheck-error-filename err)) (string-match-p (rx "macros>" line-end) filename)) ;; Redundant message giving the number of failed errors (when-let (msg (flycheck-error-message err)) (string-match-p (rx (or (: "aborting due to " (optional (one-or-more num) " ") "previous error") (: "For more information about this error, try `rustc --explain " (one-or-more alnum) "`."))) msg)))) errors)) (defun flycheck-rust-manifest-directory () "Return the nearest directory holding the Cargo manifest. Return the nearest directory containing the `Cargo.toml' manifest file, starting from the current buffer and using `locate-dominating-file'. Return nil if there is no such file, or if the current buffer has no file name." (and buffer-file-name (locate-dominating-file buffer-file-name "Cargo.toml"))) (defun flycheck-rust-cargo-metadata () "Run `cargo metadata' and return the result as parsed JSON object." (car (flycheck-parse-json (flycheck-call-checker-process-for-output 'rust-cargo nil t "metadata" "--no-deps" "--format-version" "1")))) (defun flycheck-rust-cargo-workspace-root () "Return the path to the workspace root of a Rust Cargo project. Return nil if the workspace root does not exist (for Rust versions inferior to 1.25)." (let-alist (flycheck-rust-cargo-metadata) .workspace_root)) (defun flycheck-rust-cargo-has-command-p (command) "Whether Cargo has COMMAND in its list of commands. Execute `cargo --list' to find out whether COMMAND is present." (let ((cargo (funcall flycheck-executable-find "cargo"))) (member command (mapcar (lambda (line) (replace-regexp-in-string "\\s-*\\(\\S-+\\).*\\'" "\\1" line)) (ignore-errors (process-lines cargo "--list")))))) (defun flycheck-rust-valid-crate-type-p (crate-type) "Whether CRATE-TYPE is a valid target type for Cargo. A valid Cargo target type is one of `lib', `bin', `example', `test' or `bench'." (member crate-type '(nil "lib" "bin" "example" "test" "bench"))) (flycheck-define-checker rust-cargo "A Rust syntax checker using Cargo. This syntax checker requires Rust 1.17 or newer. See URL `https://www.rust-lang.org'." :command ("cargo" (eval (if flycheck-rust-check-tests "test" "check")) (eval (when flycheck-rust-check-tests "--no-run")) (eval (when flycheck-rust-crate-type (concat "--" flycheck-rust-crate-type))) ;; All crate targets except "lib" need a binary name (eval (when (and flycheck-rust-crate-type (not (string= flycheck-rust-crate-type "lib"))) flycheck-rust-binary-name)) (option "--features=" flycheck-rust-features concat flycheck-option-comma-separated-list) (eval flycheck-cargo-check-args) "--message-format=json") :error-parser flycheck-parse-cargo-rustc :error-filter (lambda (errors) ;; In Rust 1.25+, filenames are relative to the workspace ;; root. (let ((root (flycheck-rust-cargo-workspace-root))) (seq-do (lambda (err) ;; Some errors are crate level and do not have a ;; filename (when (flycheck-error-filename err) (setf (flycheck-error-filename err) (expand-file-name (flycheck-error-filename err) root)))) (flycheck-rust-error-filter errors)))) :error-explainer flycheck-rust-error-explainer :modes (rust-mode rust-ts-mode) :predicate flycheck-buffer-saved-p :enabled flycheck-rust-manifest-directory :working-directory (lambda (_) (flycheck-rust-manifest-directory)) :verify (lambda (_) (and buffer-file-name (let* ((has-toml (flycheck-rust-manifest-directory)) (valid-crate-type (flycheck-rust-valid-crate-type-p flycheck-rust-crate-type)) (need-binary-name (and flycheck-rust-crate-type (not (string= flycheck-rust-crate-type "lib"))))) (list (flycheck-verification-result-new :label "Cargo.toml" :message (if has-toml "Found" "Missing") :face (if has-toml 'success '(bold warning))) (flycheck-verification-result-new :label "Crate type" :message (if valid-crate-type (format "%s" flycheck-rust-crate-type) (format "%s (invalid, should be one of 'lib', 'bin', \ 'test', 'example' or 'bench')" flycheck-rust-crate-type)) :face (if valid-crate-type 'success '(bold error))) (flycheck-verification-result-new :label "Binary name" :message (cond ((not need-binary-name) "Not required") ((not flycheck-rust-binary-name) "Required") (t (format "%s" flycheck-rust-binary-name))) :face (cond ((not need-binary-name) 'success) ((not flycheck-rust-binary-name) '(bold error)) (t 'success)))))))) (flycheck-define-checker rust "A Rust syntax checker using Rust compiler. This syntax checker needs Rust 1.18 or newer. See URL `https://www.rust-lang.org'." :command ("rustc" (option "--crate-type" flycheck-rust-crate-type) "--emit=mir" "-o" "/dev/null" ; avoid creating binaries "--error-format=json" (option-flag "--test" flycheck-rust-check-tests) (option-list "-L" flycheck-rust-library-path concat) (eval flycheck-rust-args) (eval (or flycheck-rust-crate-root (flycheck-substitute-argument 'source-original 'rust)))) :error-parser flycheck-parse-rustc :error-filter flycheck-rust-error-filter :error-explainer flycheck-rust-error-explainer :modes (rust-mode rust-ts-mode) :predicate flycheck-buffer-saved-p) (flycheck-define-checker rust-clippy "A Rust syntax checker using clippy. See URL `https://github.com/rust-lang-nursery/rust-clippy'." :command ("cargo" "clippy" "--message-format=json") :error-parser flycheck-parse-cargo-rustc :error-filter flycheck-rust-error-filter :error-explainer flycheck-rust-error-explainer :modes (rust-mode rust-ts-mode) :predicate flycheck-buffer-saved-p :enabled (lambda () (and (flycheck-rust-cargo-has-command-p "clippy") (flycheck-rust-manifest-directory))) :working-directory (lambda (_) (flycheck-rust-manifest-directory)) :verify (lambda (_) (and buffer-file-name (let ((has-toml (flycheck-rust-manifest-directory)) (has-clippy (flycheck-rust-cargo-has-command-p "clippy"))) (list (flycheck-verification-result-new :label "Clippy" :message (if has-clippy "Found" "Cannot find the `cargo clippy' command") :face (if has-clippy 'success '(bold warning))) (flycheck-verification-result-new :label "Cargo.toml" :message (if has-toml "Found" "Missing") :face (if has-toml 'success '(bold warning)))))))) (flycheck-define-checker salt-lint "A salt linter which apply common best practices for SaltStack. See URL `https://salt-lint.readthedocs.io/en/latest/'." :command ("python" "-m" "saltlint" "--json") :standard-input t :error-parser flycheck-salt-lint-parser :error-filter (lambda (errors) (flycheck-sanitize-errors errors)) :modes salt-mode) (defun flycheck-salt-lint-parser (output checker buffer) "Parse salt lint JSON errors from OUTPUT. The arguments CHECKER and BUFFER are only passed through." (condition-case nil (let* ((json-array-type 'list) (json-object-type 'plist) (filename (buffer-file-name buffer)) (errors (json-read-from-string output))) (mapcar (lambda (e) (flycheck-error-new :checker checker :buffer buffer :filename filename :level (pcase (plist-get e :severity) ("HIGH" 'error) ("MEDIUM" 'warning) ("LOW" 'warning) ("INFO" 'info) (_ 'info)) :line (plist-get e :linenumber) :column 0 :message (concat (plist-get e :message) (plist-get e :line)) :id (plist-get e :id))) errors)) (json-error nil))) (defvar flycheck-sass-scss-cache-directory nil "The cache directory for `sass' and `scss'.") (defun flycheck-sass-scss-cache-location () "Get the cache location for `sass' and `scss'. If no cache directory exists yet, create one and return it. Otherwise return the previously used cache directory." (setq flycheck-sass-scss-cache-directory (or flycheck-sass-scss-cache-directory (make-temp-file "flycheck-sass-scss-cache" 'directory)))) (flycheck-def-option-var flycheck-sass-compass nil sass "Whether to enable the Compass CSS framework. When non-nil, enable the Compass CSS framework, via `--compass'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.16")) (flycheck-define-checker sass "A Sass syntax checker using the Sass compiler. See URL `https://sass-lang.com'." :command ("sass" "--cache-location" (eval (flycheck-sass-scss-cache-location)) (option-flag "--compass" flycheck-sass-compass) "--check" "--stdin") :standard-input t :error-patterns ((error line-start (or "Syntax error: " "Error: ") (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) (optional "\r") "\n" (one-or-more " ") "on line " line " of standard input" line-end) (warning line-start "WARNING: " (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) (optional "\r") "\n" (one-or-more " ") "on line " line " of " (one-or-more not-newline) line-end)) :modes sass-mode) (flycheck-def-config-file-var flycheck-sass-lintrc sass/scss-sass-lint ".sass-lint.yml" :package-version '(flycheck . "30")) (flycheck-define-checker sass/scss-sass-lint "A SASS/SCSS syntax checker using sass-Lint. See URL `https://github.com/sasstools/sass-lint'." :command ("sass-lint" "--verbose" "--no-exit" "--format" "Checkstyle" (config-file "--config" flycheck-sass-lintrc) source) :error-parser flycheck-parse-checkstyle :modes (sass-mode scss-mode)) (flycheck-define-checker scala "A Scala syntax checker using the Scala compiler. See URL `https://www.scala-lang.org/'." :command ("scalac" "-Ystop-after:parser" source) :error-patterns ((error line-start (file-name) ":" line ": error: " (message) line-end)) :modes scala-mode :next-checkers ((warning . scala-scalastyle))) (flycheck-def-config-file-var flycheck-scalastylerc scala-scalastyle nil :package-version '(flycheck . "0.20")) (flycheck-define-checker scala-scalastyle "A Scala style checker using scalastyle. Note that this syntax checker is not used if `flycheck-scalastylerc' is nil or refers to a non-existing file. See URL `https://www.scalastyle.org'." :command ("scalastyle" (config-file "-c" flycheck-scalastylerc) source) :error-patterns ((error line-start "error file=" (file-name) " message=" (message) " line=" line (optional " column=" column) line-end) (warning line-start "warning file=" (file-name) " message=" (message) " line=" line (optional " column=" column) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-increment-error-columns errors))) :modes scala-mode :predicate ;; Inhibit this syntax checker if the JAR or the configuration are unset or ;; missing (lambda () (and flycheck-scalastylerc (flycheck-locate-config-file flycheck-scalastylerc 'scala-scalastyle))) :verify (lambda (checker) (let ((config-file (and flycheck-scalastylerc (flycheck-locate-config-file flycheck-scalastylerc checker)))) (list (flycheck-verification-result-new :label "Configuration file" :message (cond ((not flycheck-scalastylerc) "`flycheck-scalastyletrc' not set") ((not config-file) (format "file %s not found" flycheck-scalastylerc)) (t (format "found at %s" config-file))) :face (cond ((not flycheck-scalastylerc) '(bold warning)) ((not config-file) '(bold error)) (t 'success))))))) (flycheck-def-args-var flycheck-scheme-chicken-args scheme-chicken :package-version '(flycheck . "32")) (flycheck-define-checker scheme-chicken "A CHICKEN Scheme syntax checker using the CHICKEN compiler `csc'. See URL `https://call-cc.org/'." :command ("csc" "-analyze-only" "-local" (eval flycheck-scheme-chicken-args) source) :error-patterns ((info line-start "Note: " (zero-or-more not-newline) ":\n" (one-or-more (any space)) "(" (file-name) ":" line ") " (message) line-end) (warning line-start "Warning: " (zero-or-more not-newline) ",\n" (one-or-more (any space)) (zero-or-more not-newline) ":\n" (one-or-more (any space)) "(" (file-name) ":" line ") " (message) line-end) (warning line-start "Warning: " (zero-or-more not-newline) ":\n" (one-or-more (any space)) "(" (file-name) ":" line ") " (message) line-end) (error line-start "Error: (line " line ") " (message) line-end) (error line-start "Syntax error: (" (file-name) ":" line ")" (zero-or-more not-newline) " - " (message (one-or-more not-newline) (zero-or-more "\n" (zero-or-more space) (zero-or-more not-newline)) (one-or-more space) "<--") line-end) ;; A of version 4.12.0, the chicken compiler doesn't provide a ;; line number for this error. (error line-start "Syntax error: " (message (one-or-more not-newline) (zero-or-more "\n" (zero-or-more space) (zero-or-more not-newline)) (one-or-more space) "<--") line-end) (error line-start "Error: " (zero-or-more not-newline) ":\n" (one-or-more (any space)) "(" (file-name) ":" line ") " (message) line-end) ;; A of version 4.12.0, the chicken compiler doesn't provide a ;; line number for this error. (error line-start "Error: " (message (one-or-more not-newline) (zero-or-more "\n" (zero-or-more space) (zero-or-more not-newline)) (one-or-more space) "<--"))) :error-filter flycheck-fill-empty-line-numbers :predicate (lambda () ;; In `scheme-mode' we must check the current Scheme implementation ;; being used (and (boundp 'geiser-impl--implementation) (eq geiser-impl--implementation 'chicken))) :verify (lambda (_checker) (let ((geiser-impl (bound-and-true-p geiser-impl--implementation))) (list (flycheck-verification-result-new :label "Geiser Implementation" :message (cond ((eq geiser-impl 'chicken) "Chicken Scheme") (geiser-impl (format "Other: %s" geiser-impl)) (t "Geiser not active")) :face (cond ((eq geiser-impl 'chicken) 'success) (t '(bold error))))))) :modes scheme-mode) (defconst flycheck-scss-lint-checkstyle-re (rx "cannot load such file" (1+ not-newline) "scss_lint_reporter_checkstyle") "Regular expression to parse missing checkstyle error.") (defun flycheck-parse-scss-lint (output checker buffer) "Parse SCSS-Lint OUTPUT from CHECKER and BUFFER. Like `flycheck-parse-checkstyle', but catches errors about missing checkstyle reporter from SCSS-Lint." (if (string-match-p flycheck-scss-lint-checkstyle-re output) (list (flycheck-error-new-at 1 nil 'error "Checkstyle reporter for SCSS-Lint missing. Please run gem install scss_lint_reporter_checkstyle" :checker checker :buffer buffer :filename (buffer-file-name buffer))) (flycheck-parse-checkstyle output checker buffer))) (flycheck-def-config-file-var flycheck-scss-lintrc scss-lint ".scss-lint.yml" :package-version '(flycheck . "0.23")) (flycheck-define-checker scss-lint "A SCSS syntax checker using SCSS-Lint. Needs SCSS-Lint 0.43.2 or newer. See URL `https://github.com/brigade/scss-lint'." :command ("scss-lint" "--require=scss_lint_reporter_checkstyle" "--format=Checkstyle" (config-file "--config" flycheck-scss-lintrc) "--stdin-file-path" source-original "-") :standard-input t ;; We cannot directly parse Checkstyle XML, since for some mysterious reason ;; SCSS-Lint doesn't have a built-in Checkstyle reporter, and instead ships it ;; as an addon which might not be installed. We use a custom error parser to ;; check whether the addon is missing and turn that into a special kind of ;; Flycheck error. :error-parser flycheck-parse-scss-lint :modes scss-mode :verify (lambda (checker) (when-let (output (flycheck-call-checker-process-for-output checker nil nil "--require=scss_lint_reporter_checkstyle")) (let ((reporter-missing (string-match-p flycheck-scss-lint-checkstyle-re output))) (list (flycheck-verification-result-new :label "checkstyle reporter" :message (if reporter-missing "scss_lint_reporter_checkstyle plugin missing" "present") :face (if reporter-missing '(bold error) 'success))))))) (flycheck-define-checker scss-stylelint "A SCSS syntax and style checker using stylelint. See URL `https://stylelint.io/'." :command ("stylelint" (eval flycheck-stylelint-args) (option-flag "--quiet" flycheck-stylelint-quiet) (config-file "--config" flycheck-stylelintrc)) :standard-input t :verify (lambda (_) (flycheck--stylelint-verify 'scss-stylelint)) :error-parser flycheck-parse-stylelint :predicate flycheck-buffer-nonempty-p :modes (scss-mode)) (flycheck-define-checker sass-stylelint "A Sass syntax and style checker using stylelint. See URL `https://stylelint.io/'." :command ("stylelint" (eval flycheck-stylelint-args) (option-flag "--quiet" flycheck-stylelint-quiet) (config-file "--config" flycheck-stylelintrc)) :standard-input t :verify (lambda (_) (flycheck--stylelint-verify 'sass-stylelint)) :error-parser flycheck-parse-stylelint :predicate flycheck-buffer-nonempty-p :modes (sass-mode)) (flycheck-def-option-var flycheck-scss-compass nil scss "Whether to enable the Compass CSS framework. When non-nil, enable the Compass CSS framework, via `--compass'." :type 'boolean :safe #'booleanp :package-version '(flycheck . "0.16")) (flycheck-define-checker scss "A SCSS syntax checker using the SCSS compiler. See URL `https://sass-lang.com'." :command ("scss" "--cache-location" (eval (flycheck-sass-scss-cache-location)) (option-flag "--compass" flycheck-scss-compass) "--check" "--stdin") :standard-input t :error-patterns ((error line-start (or "Syntax error: " "Error: ") (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) (optional "\r") "\n" (one-or-more " ") "on line " line " of standard input" line-end) (warning line-start "WARNING: " (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) (optional "\r") "\n" (one-or-more " ") "on line " line " of an unknown file" line-end)) :modes scss-mode) (flycheck-def-args-var flycheck-sh-bash-args (sh-bash) :package-version '(flycheck . "32")) (flycheck-define-checker sh-bash "A Bash syntax checker using the Bash shell. See URL `https://www.gnu.org/software/bash/'." :command ("bash" "--norc" "-n" (eval flycheck-sh-bash-args) "--") :standard-input t :error-patterns ((error line-start ;; The name/path of the bash executable (one-or-more (not (any ":"))) ":" ;; A label "line", possibly localized (one-or-more (not (any digit))) line (zero-or-more " ") ":" (zero-or-more " ") (message) line-end)) :modes (sh-mode bash-ts-mode) :predicate (lambda () (eq sh-shell 'bash)) :next-checkers ((warning . sh-shellcheck))) (flycheck-define-checker sh-posix-dash "A POSIX Shell syntax checker using the Dash shell. See URL `https://gondor.apana.org.au/~herbert/dash/'." :command ("dash" "-n") :standard-input t :error-patterns ((error line-start (one-or-more (not (any ":"))) ": " line ": " (message))) :modes sh-mode :predicate (lambda () (eq sh-shell 'sh)) :next-checkers ((warning . sh-shellcheck))) (flycheck-define-checker sh-posix-bash "A POSIX Shell syntax checker using the Bash shell. See URL `https://www.gnu.org/software/bash/'." :command ("bash" "--posix" "--norc" "-n" "--") :standard-input t :error-patterns ((error line-start ;; The name/path of the bash executable (one-or-more (not (any ":"))) ":" ;; A label "line", possibly localized (one-or-more (not (any digit))) line (zero-or-more " ") ":" (zero-or-more " ") (message) line-end)) :modes sh-mode :predicate (lambda () (eq sh-shell 'sh)) :next-checkers ((warning . sh-shellcheck))) (flycheck-define-checker sh-zsh "A Zsh syntax checker using the Zsh shell. See URL `https://www.zsh.org/'." :command ("zsh" "--no-exec" "--no-globalrcs" "--no-rcs" source) :error-patterns ((error line-start (file-name) ":" line ": " (message) line-end)) :modes sh-mode :predicate (lambda () (eq sh-shell 'zsh)) :next-checkers ((warning . sh-shellcheck))) (defconst flycheck-shellcheck-supported-shells '(bash ksh88 sh) "Shells supported by ShellCheck.") (flycheck-def-option-var flycheck-shellcheck-excluded-warnings nil sh-shellcheck "A list of excluded warnings for ShellCheck. The value of this variable is a list of strings, where each string is a warning code to be excluded from ShellCheck reports. By default, no warnings are excluded." :type '(repeat :tag "Excluded warnings" (string :tag "Warning code")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.21")) (flycheck-def-option-var flycheck-shellcheck-follow-sources t sh-shellcheck "Whether to follow external sourced files in scripts. Shellcheck will follow and parse sourced files so long as a pre-runtime resolvable path to the file is present. This can either be part of the source command itself: source /full/path/to/file.txt or added as a shellcheck directive before the source command: # shellcheck source=/full/path/to/file.txt." :type 'boolean :safe #'booleanp :package-version '(flycheck . "31")) (flycheck-define-checker sh-shellcheck "A shell script syntax and style checker using Shellcheck. See URL `https://github.com/koalaman/shellcheck/'." :command ("shellcheck" "--format" "checkstyle" "--shell" (eval (symbol-name sh-shell)) (option-flag "--external-sources" flycheck-shellcheck-follow-sources) (option "--exclude" flycheck-shellcheck-excluded-warnings list flycheck-option-comma-separated-list) "-") :standard-input t :error-parser flycheck-parse-checkstyle :error-filter (lambda (errors) (flycheck-remove-error-file-names "-" (flycheck-dequalify-error-ids errors))) :modes (sh-mode bash-ts-mode) :predicate (lambda () (memq sh-shell flycheck-shellcheck-supported-shells)) :verify (lambda (_) (let ((supports-shell (memq sh-shell flycheck-shellcheck-supported-shells))) (list (flycheck-verification-result-new :label (format "Shell %s supported" sh-shell) :message (if supports-shell "yes" "no") :face (if supports-shell 'success '(bold warning)))))) :error-explainer (lambda (err) (let ((error-code (flycheck-error-id err)) (url "https://github.com/koalaman/shellcheck/wiki/%s")) (and error-code `(url . ,(format url error-code)))))) (flycheck-define-checker slim "A Slim syntax checker using the Slim compiler. See URL `https://slim-lang.com'." :command ("slimrb" "--compile") :standard-input t :error-patterns ((error line-start "Slim::Parser::SyntaxError:" (message) (optional "\r") "\n " "STDIN, Line " line (optional ", Column " column) line-end)) :modes slim-mode :next-checkers ((warning . slim-lint))) (flycheck-define-checker slim-lint "A Slim linter. See URL `https://github.com/sds/slim-lint'." :command ("slim-lint" "--reporter=checkstyle" source) :error-parser flycheck-parse-checkstyle :modes slim-mode) (flycheck-define-checker sql-sqlint "A SQL syntax checker using the sqlint tool. See URL `https://github.com/purcell/sqlint'." :command ("sqlint") :standard-input t :error-patterns ((warning line-start "stdin:" line ":" column ":WARNING " (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) line-end) (error line-start "stdin:" line ":" column ":ERROR " (message (one-or-more not-newline) (zero-or-more "\n" (one-or-more " ") (one-or-more not-newline))) line-end)) :modes (sql-mode)) (flycheck-define-checker systemd-analyze "A systemd unit checker using systemd-analyze(1). See URL `https://www.freedesktop.org/software/systemd/man/systemd-analyze.html'." :command ("systemd-analyze" "verify" source) :error-parser flycheck-parse-with-patterns-without-color :error-patterns ((error line-start (file-name) ":" (optional line ":") (message) line-end) (error line-start "[" (file-name) ":" line "]" (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-fill-empty-line-numbers errors))) :modes (systemd-mode)) (flycheck-def-config-file-var flycheck-chktexrc tex-chktex ".chktexrc") (flycheck-define-checker tcl-nagelfar "An extensible tcl syntax checker See URL `https://nagelfar.sourceforge.net/'." :command ("nagelfar" "-H" source) :error-patterns ;; foo.tcl: 29: E Wrong number of arguments (4) to "set" ;; foo.tcl: 29: W Expr without braces ((info line-start (file-name) ": " line ": N " (message) line-end) (warning line-start (file-name) ": " line ": W " (message) line-end) (error line-start (file-name) ": " line ": E " (message) line-end)) :modes tcl-mode) (flycheck-define-checker terraform "A Terraform syntax checker with `terraform fmt'. See URL `https://www.terraform.io/docs/commands/fmt.html'." :command ("terraform" "fmt" "-no-color" "-") :standard-input t :error-patterns ((error line-start "Error: " (one-or-more not-newline) "\n\n on line " line ", in " (one-or-more not-newline) ":" (one-or-more "\n" (zero-or-more space (one-or-more not-newline))) (message (one-or-more (and (one-or-more (not (any ?\n))) ?\n))) line-end) (error line-start "Error: " (one-or-more not-newline) "\n\n on line " line ":\n (source code not available)\n\n" (message (one-or-more (and (one-or-more (not (any ?\n))) ?\n))) line-end)) :next-checkers ((warning . terraform-tflint)) :modes terraform-mode) (flycheck-def-option-var flycheck-tflint-variable-files nil terraform-tflint "A list of files to resolve terraform variables. The value of this variable is a list of strings, where each string is a file to add to the terraform variables files. Relative files are relative to the file being checked." :type '(repeat (directory :tag "Variable file")) :safe #'flycheck-string-list-p :package-version '(flycheck . "32")) (defun flycheck-parse-tflint-linter (output checker buffer) "Parse tflint warnings from JSON OUTPUT. CHECKER and BUFFER denote the CHECKER that returned OUTPUT and the BUFFER that was checked respectively. See URL `https://github.com/terraform-linters/tflint' for more information about tflint." (mapcar (lambda (err) (let-alist err (flycheck-error-new-at .range.start.line .range.start.column (pcase .rule.severity ("error" 'error) ("warning" 'warning) (_ 'error)) .message :end-line .range.end.line :end-column .range.end.column :id .rule.name :checker checker :buffer buffer :filename (buffer-file-name buffer)))) (cdr (assq 'issues (car (flycheck-parse-json output)))))) (flycheck-define-checker terraform-tflint "A Terraform checker using tflint. See URL `https://github.com/terraform-linters/tflint'." :command ("tflint" "--format=json" "--force" (option-list "--var-file=" flycheck-tflint-variable-files concat)) :error-parser flycheck-parse-tflint-linter :predicate flycheck-buffer-saved-p :modes terraform-mode) (flycheck-def-option-var flycheck-chktex-extra-flags nil tex-chktex "A list of extra arguments to give to chktex. This variable works the same way as `tex-chktex-extra-flags': its value is a list of strings, where each string is an argument added to chktex. For example, to ignore warnings 8 and 18, you would set this option to \\='(\"-n8\" \"-n18\")." :type '(repeat string) :safe #'flycheck-string-list-p :package-version '(flycheck . "35")) (flycheck-define-checker tex-chktex "A TeX and LaTeX syntax and style checker using chktex. See URL `https://www.nongnu.org/chktex/'." :command ("chktex" (config-file "--localrc" flycheck-chktexrc) (option-list "" flycheck-chktex-extra-flags concat) ;; Compact error messages, and no version information, and execute ;; \input statements "--verbosity=0" "--quiet" "--inputfiles") :standard-input t :error-patterns ((warning line-start "stdin:" line ":" column ":" (id (one-or-more digit)) ":" (message) line-end)) :error-filter (lambda (errors) (flycheck-sanitize-errors (flycheck-increment-error-columns errors))) :modes (latex-mode LaTeX-mode plain-tex-mode plain-TeX-mode)) (flycheck-define-checker tex-lacheck "A LaTeX syntax and style checker using lacheck. See URL `https://www.ctan.org/pkg/lacheck'." :command ("lacheck" source-inplace) :error-patterns ((warning line-start "\"" (file-name) "\", line " line ": " (message) line-end)) :modes (latex-mode LaTeX-mode)) (flycheck-define-checker texinfo "A Texinfo syntax checker using makeinfo. See URL `https://www.gnu.org/software/texinfo/'." :command ("makeinfo" "-o" null-device "-") :standard-input t :error-patterns ((warning line-start "-:" line (optional ":" column) ": " "warning: " (message) line-end) (error line-start "-:" line (optional ":" column) ": " (message) line-end)) :modes (texinfo-mode Texinfo-mode)) (flycheck-def-config-file-var flycheck-textlint-config textlint "textlintrc.json") ;; This needs to be set because textlint plugins are installed separately, ;; and there is no way to check their installation status -- textlint simply ;; prints a backtrace. (flycheck-def-option-var flycheck-textlint-plugin-alist '((markdown-mode . "@textlint/markdown") (gfm-mode . "@textlint/markdown") (t . "@textlint/text")) textlint "An alist mapping major modes to textlint plugins. Each item is a cons cell `(MAJOR-MODE . PLUGIN)', where MAJOR-MODE is a mode `flycheck-textlint' supports and PLUGIN is a textlint plugin. As a catch-all, when MAJOR-MODE is t, that PLUGIN will be used for any supported mode that isn't specified. See URL `https://npms.io/search?q=textlint-plugin' for all textlint plugins published on NPM." :type '(repeat (choice (cons symbol string) (cons (const t) string)))) (defun flycheck--textlint-get-plugin () "Return the textlint plugin for the current mode." (cdr (seq-find (lambda (arg) (pcase-let ((`(,mode . _) arg)) (or (and (booleanp mode) mode) ; mode is t (derived-mode-p mode)))) flycheck-textlint-plugin-alist))) (flycheck-define-checker textlint "A text prose linter using textlint. See URL `https://textlint.github.io/'." :command ("textlint" (config-file "--config" flycheck-textlint-config) "--format" "json" ;; get the first matching plugin from plugin-alist "--plugin" (eval (flycheck--textlint-get-plugin)) source) ;; textlint seems to say that its json output is compatible with ESLint. ;; https://textlint.github.io/docs/formatter.html :error-parser flycheck-parse-eslint ;; textlint can support different formats with textlint plugins, but ;; only text and markdown formats are installed by default. Ask the ;; user to add mode->plugin mappings manually in ;; `flycheck-textlint-plugin-alist'. :modes (text-mode markdown-mode gfm-mode message-mode adoc-mode mhtml-mode latex-mode LaTeX-mode org-mode rst-mode) :enabled (lambda () (flycheck--textlint-get-plugin)) :verify (lambda (_) (let ((plugin (flycheck--textlint-get-plugin))) (list (flycheck-verification-result-new :label "textlint plugin" :message plugin :face 'success))))) (flycheck-def-config-file-var flycheck-typescript-tslint-config typescript-tslint "tslint.json" :package-version '(flycheck . "27")) (flycheck-def-option-var flycheck-typescript-tslint-rulesdir nil typescript-tslint "The directory of custom rules for TSLint. The value of this variable is either a string containing the path to a directory with custom rules, or nil, to not give any custom rules to TSLint. Refer to the TSLint manual at URL `https://palantir.github.io/tslint/usage/cli/' for more information about the custom directory." :type '(choice (const :tag "No custom rules directory" nil) (directory :tag "Custom rules directory")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "27")) (flycheck-def-args-var flycheck-tslint-args (typescript-tslint) :package-version '(flycheck . "31")) (flycheck-define-checker typescript-tslint "TypeScript style checker using TSLint. Note that this syntax checker is not used if `flycheck-typescript-tslint-config' is nil or refers to a non-existing file. See URL `https://github.com/palantir/tslint'." :command ("tslint" "--format" "json" (config-file "--config" flycheck-typescript-tslint-config) (option "--rules-dir" flycheck-typescript-tslint-rulesdir) (eval flycheck-tslint-args) source-inplace) :error-parser flycheck-parse-tslint :modes (typescript-mode typescript-ts-mode tsx-ts-mode)) (flycheck-def-option-var flycheck-verilator-include-path nil verilog-verilator "A list of include directories for Verilator. The value of this variable is a list of strings, where each string is a directory to add to the include path of Verilator. Relative paths are relative to the file being checked." :type '(repeat (directory :tag "Include directory")) :safe #'flycheck-string-list-p :package-version '(flycheck . "0.24")) (flycheck-define-checker verilog-verilator "A Verilog syntax checker using the Verilator Verilog HDL simulator. See URL `https://www.veripool.org/wiki/verilator'." :command ("verilator" "--lint-only" "-Wall" "--quiet-exit" (option-list "-I" flycheck-verilator-include-path concat) source) :error-patterns ((warning line-start "%Warning" (? "-" (id (+ (any "0-9A-Z_")))) ": " (? (file-name) ":" line ":" (? column ":") " ") (message) line-end) (error line-start "%Error" (? "-" (id (+ (any "0-9A-Z_")))) ": " (? (file-name) ":" line ":" (? column ":") " ") (message) line-end)) :modes verilog-mode) (flycheck-def-option-var flycheck-ghdl-language-standard nil vhdl-ghdl "The language standard to use in GHDL. The value of this variable is either a string denoting a language standard, or nil, to use the default standard. When non-nil, pass the language standard via the `--std' option." :type '(choice (const :tag "Default standard" nil) (string :tag "Language standard")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-ghdl-language-standard) (flycheck-def-option-var flycheck-ghdl-workdir nil vhdl-ghdl "The directory to use for the file library. The value of this variable is either a string with the directory to use for the file library, or nil, to use the default value. When non-nil, pass the directory via the `--workdir' option." :type '(choice (const :tag "Default directory" nil) (string :tag "Directory for the file library")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-ghdl-workdir) (flycheck-def-option-var flycheck-ghdl-ieee-library nil vhdl-ghdl "The standard to use for the IEEE library. The value of this variable is either a string denoting an ieee library standard, or nil, to use the default standard. When non-nil, pass the ieee library standard via the `--ieee' option." :type '(choice (const :tag "Default standard" nil) (const :tag "No IEEE Library" "none") (const :tag "IEEE standard" "standard") (const :tag "Synopsys standard" "synopsys") (const :tag "Mentor standard" "mentor")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "32")) (make-variable-buffer-local 'flycheck-ghdl-ieee-library) (flycheck-define-checker vhdl-ghdl "A VHDL syntax checker using GHDL. See URL `https://github.com/ghdl/ghdl'." :command ("ghdl" "-s" ; only do the syntax checking (option "--std=" flycheck-ghdl-language-standard concat) (option "--workdir=" flycheck-ghdl-workdir concat) (option "--ieee=" flycheck-ghdl-ieee-library concat) source) :error-patterns ((warning line-start (file-name) ":" line ":" column ":warning: " (message) line-end) (error line-start (file-name) ":" line ":" column ":error: " (message) line-end)) :modes vhdl-mode) (flycheck-def-option-var flycheck-xml-xmlstarlet-xsd-path nil xml-xmlstarlet "An XSD schema to validate against." :type '(choice (const :tag "None" nil) (file :tag "XSD schema")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "31")) (flycheck-define-checker xml-xmlstarlet "A XML syntax checker and validator using the xmlstarlet utility. See URL `https://xmlstar.sourceforge.net/'." ;; Validate standard input with verbose error messages, and do not dump ;; contents to standard output :command ("xmlstarlet" "val" "--err" "--quiet" (option "--xsd" flycheck-xml-xmlstarlet-xsd-path) "-") :standard-input t :error-patterns ((error line-start "-:" line "." column ": " (message) line-end)) :modes (xml-mode nxml-mode)) (flycheck-def-option-var flycheck-xml-xmllint-xsd-path nil xml-xmllint "An XSD schema to validate against." :type '(choice (const :tag "None" nil) (file :tag "XSD schema")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "31")) (flycheck-def-option-var flycheck-xml-xmllint-relaxng-path nil xml-xmllint "An RELAX NG schema to validate against." :type '(choice (const :tag "None" nil) (file :tag "RELAX NG schema")) :safe #'flycheck-string-or-nil-p :package-version '(flycheck . "34")) (flycheck-define-checker xml-xmllint "A XML syntax checker and validator using the xmllint utility. The xmllint is part of libxml2, see URL `https://gitlab.gnome.org/GNOME/libxml2/-/wikis/home'." :command ("xmllint" "--noout" (option "--schema" flycheck-xml-xmllint-xsd-path) (option "--relaxng" flycheck-xml-xmllint-relaxng-path) "-") :standard-input t :error-patterns ((error line-start "-:" line ": " (message) line-end)) :modes (xml-mode nxml-mode)) (flycheck-define-checker yaml-jsyaml "A YAML syntax checker using JS-YAML. See URL `https://github.com/nodeca/js-yaml'." :command ("js-yaml") :standard-input t :error-patterns ((error line-start (or "JS-YAML" "YAMLException") ": " (message) " at line " line ", column " column ":" line-end) (error line-start (or "JS-YAML" "YAMLException") ": " (message) " (" line ":" column ")" line-end)) :modes (yaml-mode yaml-ts-mode) :next-checkers ((warning . yaml-yamllint) (warning . cwl))) (flycheck-define-checker yaml-ruby "A YAML syntax checker using Ruby's YAML parser. This syntax checker uses the YAML parser from Ruby's standard library. See URL `https://www.ruby-doc.org/stdlib-2.0.0/libdoc/yaml/rdoc/YAML.html'." :command ("ruby" "-ryaml" "-e" "begin; YAML.load(STDIN); \ rescue Exception => e; \ STDERR.puts \"stdin:#{e}\"; \ end") :standard-input t :error-patterns ((error line-start "stdin:" (zero-or-more not-newline) ":" (message) "at line " line " column " column line-end)) :modes (yaml-mode yaml-ts-mode) :next-checkers ((warning . yaml-yamllint) (warning . cwl))) (flycheck-def-config-file-var flycheck-yamllintrc yaml-yamllint '(".yamllint" ".yamllint.yaml" ".yamllint.yml" "~/.config/yamllint/config")) (flycheck-define-checker yaml-yamllint "A YAML syntax checker using YAMLLint. See URL `https://github.com/adrienverge/yamllint'." :standard-input t :command ("yamllint" "-f" "parsable" "-" (config-file "-c" flycheck-yamllintrc)) :error-patterns ((error line-start "stdin:" line ":" column ": [error] " (message) line-end) (warning line-start "stdin:" line ":" column ": [warning] " (message) line-end)) :modes (yaml-mode yaml-ts-mode) :next-checkers ((warning . cwl))) (provide 'flycheck) ;; Local Variables: ;; coding: utf-8 ;; indent-tabs-mode: nil ;; End: ;;; flycheck.el ends here flycheck-35.0/flycheck.svg000066400000000000000000000074361500215546300155550ustar00rootroot00000000000000 Flycheck Logo image/svg+xml Flycheck Logo Sebastian Wiesner Copyright (C) 2014 Sebastian Wiesner !Flyc flycheck-35.0/maint/000077500000000000000000000000001500215546300143425ustar00rootroot00000000000000flycheck-35.0/maint/Makefile000066400000000000000000000033611500215546300160050ustar00rootroot00000000000000# Copyright (c) 2012-2016 Sebastian Wiesner and Flycheck contributors # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . PYTHON = python3 FLAKE8 = flake8 PIP = pip3 HAVE_PIP := $(shell sh -c "command -v $(PIP)") .DEFAULT_GOAL := help .PHONY: init init: ifndef HAVE_PIP $(error "$(PIP) not available. Please run make help.") endif ifndef VIRTUAL_ENV $(warning "No virtualenv active. Installing globally is not recommended.") ifndef FORCE $(error "Aborted. Run make FORCE=1 init to override or make help.") endif endif pip install -r requirements.txt .PHONY: help help: @echo 'Available targets:' @echo ' init: Install dependencies of maintenance scripts' @echo ' check: Check maintenance scripts' @echo ' release: Make a Flycheck release' @echo '' @echo 'You need Python 3.5 for all maintenance scripts' @echo '' @echo 'Run make init to install required libraries. It is recommended' @echo 'that you use virtualenv (https://virtualenv.pypa.io/en/latest/)' @echo 'to avoid a global installation of Python packages. make init' @echo 'will warn you if you do not.' .PHONY: release release: @./release.py .PHONY: lint lint: $(FLAKE8) .. .PHONY: check check: lint flycheck-35.0/maint/flycheck-checkdoc.el000066400000000000000000000063561500215546300202270ustar00rootroot00000000000000;;; flycheck-checkdoc.el --- Flycheck: Checkdoc runner -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; This file provides checkdoc linting for Flycheck. It's intended for ;; non-interactive use, see "make checkdoc". ;;; Code: (unless (version<= "25" emacs-version) (user-error "Emacs 25 required for checkdoc")) (require 'subr-x) (require 'seq) (require 'f) (require 'checkdoc) (require 'flycheck-maint (expand-file-name "flycheck-maint" (file-name-directory (f-this-file)))) (defconst flycheck/source-dir (locate-dominating-file load-file-name "Cask") "The source directory of Flycheck.") (defun flycheck/checkdoc-get-current-errors () "Get the current checkdoc errors. Return a list of all error messages from checkdoc, and erase the error message buffer, so that the next checkdoc check starts fresh without previous errors. Each error is just a string with the complete human-readable location and error message." (with-current-buffer checkdoc-diagnostic-buffer (unwind-protect (progn (goto-char (point-min)) ;; Skip over the checkdoc header (re-search-forward (rx line-start "***" (1+ not-newline) ": checkdoc-current-buffer")) (forward-line 1) (let ((text (buffer-substring-no-properties (point) (point-max)))) (and (not (string-empty-p text)) (split-string text "\n")))) (kill-buffer)))) (defun flycheck/checkdoc-file (filename) "Run checkdoc on FILENAME and return a list of errors. Each error is just a string with the complete human-readable location and error message." (with-temp-buffer ;; Visit the file to make sure that the filename is set, as some checkdoc ;; lints only apply for buffers with filenames (insert-file-contents filename 'visit) (set-buffer-modified-p nil) ;; Switch to Emacs Lisp mode to give checkdoc the proper syntax table, etc. (delay-mode-hooks (emacs-lisp-mode)) (setq delay-mode-hooks nil) (let ((checkdoc-arguments-in-order-flag nil)) (checkdoc-current-buffer 'take-notes)) (flycheck/checkdoc-get-current-errors))) (defun flycheck/batch-checkdoc () "Run checkdoc on all source files and exit." (let ((errors (seq-mapcat #'flycheck/checkdoc-file (flycheck/all-source-files)))) (seq-do (lambda (err) (message "%s" err)) errors) (kill-emacs (if errors 1 0)))) ;;; flycheck-checkdoc.el ends here flycheck-35.0/maint/flycheck-compile.el000066400000000000000000000065731500215546300201150ustar00rootroot00000000000000;;; flycheck-compile.el --- Flycheck byte compiler -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; This file provides non-interactive byte compilation for Flycheck. ;; ;; It's essentially a wrapper around `batch-byte-compile' which sets some ;; additional byte compiler options for Flycheck. ;;; Code: (require 'warnings) (require 'bytecomp) (unless noninteractive (error "This file must not be used interactively")) (defun flycheck/batch-byte-compile () "Like `batch-byte-compile', but set additional flags. Specifically set `byte-compile-error-on-warn' to t on Emacs 25." ;; Unfortunately `byte-compile-error-on-warn' does not quite what the name ;; suggest because for whatever mysterious reason there's also ;; `byte-compile-log-warning' used throughout Emacs' code which bypasses ;; `byte-compile-error-on-warn' and instead logs an Emacs warning with ;; `display-warning'. These warnings don't trigger errors even if ;; `byte-compile-error-on-warn' is non-nil, which is… well, at least a very ;; _unusual_ design decision, which leads the whole purpose of ;; `byte-compile-error-on-warn' ad absurdum. ;; ;; To work around this mess (I'm sorry) we check the size of ;; `byte-compile-log-buffer' after each file to check if any warnings end up ;; there and exit with a non-zero code if the buffer is not empty. ;; ;; Unfortunately this means that we can't use `batch-byte-compile' (which is ;; the proper API) and instead have to call the undocumented internal function ;; `batch-byte-compile-file'. Yay, so now proper byte compilation of Flycheck ;; depends on Emacs' internals, and much evil is accomplished. Can't get any ;; worse, can it? (let ((byte-compile-error-on-warn (version<= "25" emacs-version))) (while command-line-args-left (let ((filename (pop command-line-args-left))) (unless (batch-byte-compile-file filename) ;; Exit if compilation failed (kill-emacs 1)) (when (and byte-compile-error-on-warn (get-buffer byte-compile-log-buffer) (> (buffer-size (get-buffer byte-compile-log-buffer)) 0)) ;; If there's anything in the log buffer (from the idiocy that is ;; `byte-compile-log-warning') exit as well to _ALL_ warnings, really ;; ALL WARNINGS. Got it, Emacs? Why are making my life so hard? At ;; least we don't have to print the contents explicitly because ;; `display-warnings' writes to standard whatever stream in batch ;; mode. (kill-emacs 1))))) (kill-emacs 0)) ;;; flycheck-compile.el ends here flycheck-35.0/maint/flycheck-format.el000066400000000000000000000127651500215546300177550ustar00rootroot00000000000000;;; flycheck-format.el --- Flycheck: Source code formatter -*- lexical-binding: t; -*- ;; Copyright (C) 2016, 2018 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; This file provides source code formatting for Flycheck. It's mainly intended ;; for non-interactive use, see "make format". ;;; Code: (unless (version<= "25" emacs-version) (user-error "Emacs 25 required for formatting")) (require 'seq) (require 'rx) (require 'f) (require 'whitespace) (require 'elisp-mode) ;; Work around Emacs bug #39761 (require 'cl-lib) (require 'flycheck-maint (expand-file-name "flycheck-maint" (file-name-directory (f-this-file)))) (defun flycheck/eval-and-format-buffer (filename) "Format the current buffer for FILENAME. THIS FUNCTION HAS GLOBAL AND LOCAL SIDE EFFECTS. Evaluate the buffer to make all special indentation rules of local definitions available before formatting. Switch the buffer to Emacs Lisp mode." (let (delayed-mode-hooks) (delay-mode-hooks (emacs-lisp-mode))) ;; Load the file to make indentation rules from local definitions available. ;; We load files instead of evaluating them because some files in our code ;; rely on `load-file-name' and similar stuff. Don't load files which are ;; already loaded, though, to prevent a recursive load of this file. (unless (flycheck/already-loaded-p filename) (let ((load-prefer-newer t)) ; Silence "newer" messages (load filename 'noerror 'nomessage 'nosuffix))) (widen) (let ((indent-tabs-mode nil) (whitespace-style '(empty ; Cleanup empty lines at end indentation::space ; Replace tabs with spaces space-before-tab::space ; Replace tabs with spaces trailing ; Remove trailing spaces ))) (let ((inhibit-message t)) ;; Silence "Indenting region..." progress reporter (indent-region (point-min) (point-max))) (whitespace-cleanup-region (point-min) (point-max)))) (defun flycheck/check-long-lines (filename &optional length) "Check FILENAME for lines longer than LENGTH. Display a message for any line longer than LENGTH. If LENGTH is nil, default to `fill-column'. Return t if FILENAME has no long lines, otherwise return nil. If FILENAME is a package file, return t regardless if there are long lines or not." (let ((long-lines 0) (max-length (or length fill-column))) (save-excursion (goto-char (point-min)) ;; If the file has a Commentary line, then it's a package and we start ;; checking for long lines after the Commentary section. Lines before it ;; may be too long but some are unsplittable. (when (search-forward ";;; Commentary:" nil t) (while (not (eobp)) (end-of-line) (when (> (current-column) max-length) (message "%s:%d: line is over %d characters" filename (line-number-at-pos (point)) max-length) (setq long-lines (1+ long-lines))) (forward-line 1)))) (= long-lines 0))) (defun flycheck/can-have-long-lines (filename) "Whether FILENAME can have arbitrarily long lines. Test files which contain error messages from checkers are allowed to have long lines." (string-match-p (rx (or "languages/test-" "flycheck-test.el")) filename)) (defun flycheck/file-formatted-p (filename) "Check whether FILENAME is properly formatted. Return a non-nil value in this case, otherwise return nil." (with-temp-buffer (insert-file-contents filename) (set-buffer-modified-p nil) (flycheck/eval-and-format-buffer filename) (and (not (buffer-modified-p)) (or (flycheck/can-have-long-lines filename) (flycheck/check-long-lines filename 80))))) (defun flycheck/batch-check-format () "Check formatting of all sources." (let ((bad-files (seq-remove #'flycheck/file-formatted-p (flycheck/all-source-files)))) (if (null bad-files) (kill-emacs 0) (seq-do (lambda (filename) (message "%s: misformatted!" filename)) bad-files) (kill-emacs 1)))) (defun flycheck/format-file (filename) "Format FILENAME. Return a non-nil value if the file was formatted, and nil otherwise." (with-temp-file filename (insert-file-contents filename) (set-buffer-modified-p nil) (flycheck/eval-and-format-buffer filename) (buffer-modified-p))) (defun flycheck/batch-format () "Format all Flycheck source files." (let ((formatted-files (seq-filter #'flycheck/format-file (flycheck/all-source-files)))) (seq-do (lambda (filename) (message "Formatted %s" filename)) formatted-files) (kill-emacs 0))) ;;; flycheck-format.el ends here flycheck-35.0/maint/flycheck-maint.el000066400000000000000000000040321500215546300175610ustar00rootroot00000000000000;;; flycheck-maint.el --- Flycheck: Maintenance library -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; This file provides helper functions for maintenance tools. ;;; Code: (unless noninteractive (error "This file must not be used interactively")) (defconst flycheck/source-dir (locate-dominating-file load-file-name "Cask") "The source directory of Flycheck.") (defun flycheck/collect-el-files (directory &optional recursive) "Collect all Emacs Lisp files in DIRECTORY. If RECURSIVE is given and non-nil collect files recursively." (let ((fn-re (rx ".el" eos))) (if recursive (directory-files-recursively directory fn-re) (directory-files directory 'full fn-re)))) (defun flycheck/all-source-files () "Find all source files of Flycheck." (append (seq-mapcat (lambda (rel-name) (flycheck/collect-el-files (expand-file-name rel-name flycheck/source-dir))) '("." "maint/" "doc/" "test/")) (flycheck/collect-el-files (expand-file-name "test/specs/" flycheck/source-dir) 'recursive))) (defun flycheck/already-loaded-p (filename) "Whether FILENAME is already loaded." (not (null (assoc filename load-history)))) (provide 'flycheck-maint) ;;; flycheck-maint.el ends here flycheck-35.0/maint/release.py000077500000000000000000000152461500215546300163470ustar00rootroot00000000000000#!/usr/bin/env python3 # Copyright (C) 2017 Flycheck contributors # Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors # This file is not part of GNU Emacs. # This program is free software: you can redistribute it and/or modify it under # the terms of the GNU General Public License as published by the Free Software # Foundation, either version 3 of the License, or (at your option) any later # version. # This program is distributed in the hope that it will be useful, but WITHOUT # ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS # FOR A PARTICULAR PURPOSE. See the GNU General Public License for more # details. # You should have received a copy of the GNU General Public License along with # this program. If not, see . import re import sys import subprocess from datetime import date from collections import namedtuple from pathlib import Path import requests from git import Repo SOURCE_DIR = Path(__file__).resolve().parent.parent FLYCHECK_EL = SOURCE_DIR.joinpath('flycheck.el') CHANGELOG = SOURCE_DIR.joinpath('CHANGES.rst') TRAVIS_ENDPOINT = 'https://api.travis-ci.org/repos/flycheck/flycheck' VERSION_HEADER_RE = re.compile( r'^(?P' requested here" :checker c/c++-clang) '(8 9 warning "unknown pragma ignored" :checker c/c++-clang)))) (flycheck-ert-def-checker-test c/c++-clang (c c++) fatal-error (let ((flycheck-disabled-checkers '(c/c++-gcc))) (flycheck-ert-should-syntax-check "language/c_c++/includes.c" 'c-mode '(2 10 error "'library.h' file not found" :checker c/c++-clang)))) (flycheck-ert-def-checker-test c/c++-clang (c c++) warnings (let ((flycheck-disabled-checkers '(c/c++-gcc c/c++-cppcheck))) (flycheck-ert-should-syntax-check "language/c_c++/warning.c" 'c-mode '(5 10 warning "unused variable 'unused'" :checker c/c++-clang) '(7 15 warning "comparison of integers of different signs: 'int' and 'unsigned int'" :checker c/c++-clang) '(8 7 warning "no message" :checker c/c++-clang)))) (flycheck-ert-def-checker-test c/c++-clang (c c++) included-file-warning (let ((flycheck-clang-include-path '("./include")) (flycheck-disabled-checkers '(c/c++-gcc)) (flycheck-relevant-error-other-file-minimum-level 'warning)) (flycheck-ert-should-syntax-check "language/c_c++/in-included-file.cpp" 'c++-mode `(5 10 warning "unused variable 'unused'" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :checker c/c++-clang) `(7 15 warning "comparison of integers of different signs: 'int' and 'unsigned int'" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :checker c/c++-clang) `(8 7 warning "no message" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :checker c/c++-clang)))) (flycheck-ert-def-checker-test c/c++-gcc (c c++) error (let ((flycheck-disabled-checkers '(c/c++-clang))) (flycheck-ert-should-syntax-check "language/c_c++/error.cpp" 'c++-mode '(2 20 error "'struct A' has no member named 'bar'" :checker c/c++-gcc) '(8 nil warning "ignoring #pragma nope" :id "-Wunknown-pragmas" :checker c/c++-gcc)))) (flycheck-ert-def-checker-test c/c++-gcc (c c++) fatal-error (let ((flycheck-disabled-checkers '(c/c++-clang))) (flycheck-ert-should-syntax-check "language/c_c++/includes.c" 'c-mode '(2 10 error "library.h: No such file or directory" :checker c/c++-gcc)))) (flycheck-ert-def-checker-test c/c++-gcc (c c++) warning (let ((flycheck-disabled-checkers '(c/c++-clang c/c++-cppcheck))) (flycheck-ert-should-syntax-check "language/c_c++/warning.c" 'c-mode '(5 10 warning "unused variable 'unused'" :id "-Wunused-variable" :checker c/c++-gcc) '(7 15 warning "comparison of integer expressions of different signedness: 'int' and 'unsigned int'" :id "-Wsign-compare" :checker c/c++-gcc) '(8 7 warning "#warning" :id "-Wcpp" :checker c/c++-gcc)))) (flycheck-ert-def-checker-test c/c++-gcc (c c++) included-file-warning (let ((flycheck-gcc-include-path '("./include")) (flycheck-disabled-checkers '(c/c++-clang)) (flycheck-relevant-error-other-file-minimum-level 'warning)) (flycheck-ert-should-syntax-check "language/c_c++/in-included-file.cpp" 'c++-mode `(5 10 warning "unused variable 'unused'" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :id "-Wunused-variable" :checker c/c++-gcc) `(7 15 warning "comparison of integer expressions of different signedness: 'int' and 'unsigned int'" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :id "-Wsign-compare" :checker c/c++-gcc) `(8 7 warning "#warning" :filename ,(flycheck-ert-resource-filename "language/c_c++/warning.c") :id "-Wcpp" :checker c/c++-gcc)))) (flycheck-ert-def-checker-test c/c++-cppcheck (c c++) nil :tags '(cppcheck-xml) (let ((flycheck-disabled-checkers '(c/c++-clang c/c++-gcc)) (flycheck-cppcheck-inconclusive nil) (flycheck-cppcheck-checks '("style"))) (flycheck-ert-should-syntax-check "language/c_c++/style2.cpp" 'c++-mode '(3 nil info "The scope of the variable 'i' can be reduced. Warning: Be careful when fixing this message, especially when there are inner loops. Here is an example where cppcheck will write that the scope for 'i' can be reduced:\nvoid f(int x)\n{\n int i = 0;\n if (x) {\n // it's safe to move 'int i = 0;' here\n for (int n = 0; n < 10; ++n) {\n // it is possible but not safe to move 'int i = 0;' here\n do_something(&i);\n }\n }\n}\nWhen you see this message it is always safe to reduce the variable scope 1 level." :id "variableScope" :checker c/c++-cppcheck)) (flycheck-ert-should-syntax-check "language/c_c++/style.cpp" 'c-mode '(12 nil error "Code 'std::string' is invalid C code. Use --std or --language to configure the language." :id "syntaxError" :checker c/c++-cppcheck)) (flycheck-ert-should-syntax-check "language/c_c++/style.cpp" 'c++-mode '(3 nil error "Division by zero." :id "zerodiv" :checker c/c++-cppcheck) '(5 nil info "Unused variable: unused" :id "unusedVariable" :checker c/c++-cppcheck) '(9 nil error "Division by zero." :id "zerodiv" :checker c/c++-cppcheck) '(12 nil warning "Parameter 'foo' is passed by value. It could be passed as a const reference which is usually faster and recommended in C++." :id "passedByValue" :checker c/c++-cppcheck)))) (flycheck-ert-def-checker-test cfengine cfengine error (skip-unless (fboundp 'cfengine3-mode)) (flycheck-ert-should-syntax-check "language/cfengine/error.cf" 'cfengine3-mode '(8 21 error "Unknown promise type 'nosuchpromisetype'" :checker cfengine))) (flycheck-ert-def-checker-test cfengine cfengine warning (skip-unless (fboundp 'cfengine3-mode)) (flycheck-ert-should-syntax-check "language/cfengine/warning.cf" 'cfengine3-mode '(3 35 warning "Removed constraint 'host_licenses_paid' in promise type 'common' [-Wremoved]" :checker cfengine))) (flycheck-ert-def-checker-test coffee coffee syntax-error (flycheck-ert-should-syntax-check "language/coffee/syntax-error.coffee" 'coffee-mode '(4 7 error "missing \"" :checker coffee))) (flycheck-ert-def-checker-test coffee-coffeelint coffee error :tags '(checkstyle-xml) (flycheck-ert-should-syntax-check "language/coffee/error.coffee" 'coffee-mode '(4 nil error "Throwing strings is forbidden; context:" :checker coffee-coffeelint))) (flycheck-ert-def-checker-test coffee-coffeelint coffee warning :tags '(checkstyle-xml) (let ((flycheck-coffeelintrc "lint.json")) (flycheck-ert-should-syntax-check "language/coffee/error.coffee" 'coffee-mode '(4 nil warning "Throwing strings is forbidden; context:" :checker coffee-coffeelint)))) (flycheck-ert-def-checker-test css-csslint css nil :tags '(checkstyle-xml) (flycheck-ert-should-syntax-check "language/css/warning.css" 'css-mode '(3 6 warning "Heading (h1) should not be qualified." :id "Disallowqualifiedheadings" :checker css-csslint))) (flycheck-ert-def-checker-test css-csslint css syntax-error :tags '(checkstyle-xml) (flycheck-ert-should-syntax-check "language/css/syntax-error.css" 'css-mode '(4 14 error "Expected a `FUNCTION` or `IDENT` after colon at line 4, col 14." :id "ParsingErrors" :checker css-csslint))) (flycheck-ert-def-checker-test cuda cuda syntax-error (flycheck-ert-should-syntax-check "language/cuda/syntax-error.cu" 'cuda-mode '(5 0 error "error: identifier \"ac\" is undefined" :checker cuda))) (flycheck-ert-def-checker-test cuda cuda syntax-warning (flycheck-ert-should-syntax-check "language/cuda/syntax-warning.cu" 'cuda-mode '(3 0 warning "variable \"b\" was set but never used" :checker cuda))) (flycheck-ert-def-checker-test cwl cwl syntax-error (let ((flycheck-cwl-schema-path "schema/CommonWorkflowLanguage.yml")) (flycheck-ert-should-syntax-check "language/cwl/cwl.cwl" 'cwl-mode '(6 5 error "value is a str, expected null or CommandLineBinding" :checker cwl)))) (ert-deftest flycheck-d-module-re/matches-module-name () :tags '(language-d) (let ((s "module spam.with.eggs ;")) (should (string-match flycheck-d-module-re s)) (should (string= "spam.with.eggs" (match-string 1 s))))) (ert-deftest flycheck-d-base-directory/no-module-declaration () :tags '(language-d) (flycheck-ert-with-resource-buffer "language/d/src/dmd/no_module.d" (should (flycheck-same-files-p (flycheck-d-base-directory) (flycheck-ert-resource-filename "language/d/src/dmd"))))) (ert-deftest flycheck-d-base-directory/with-module-declaration () :tags '(language-d) (flycheck-ert-with-resource-buffer "language/d/src/dmd/warning.d" (should (flycheck-same-files-p (flycheck-d-base-directory) (flycheck-ert-resource-filename "language/d/src"))))) (ert-deftest flycheck-d-base-directory/package-file () :tags '(language-d) (flycheck-ert-with-resource-buffer "language/d/src/dmd/package.d" (should (flycheck-same-files-p (flycheck-d-base-directory) (flycheck-ert-resource-filename "language/d/src"))))) (flycheck-ert-def-checker-test d-dmd d warning-include-path (let ((flycheck-dmd-include-path '("../../lib"))) (flycheck-ert-should-syntax-check "language/d/src/dmd/warning.d" 'd-mode '(9 5 warning "statement is not reachable" :checker d-dmd) '(20 17 warning "function `dmd.warning.bar` is deprecated" :checker d-dmd)))) (flycheck-ert-def-checker-test d-dmd d missing-import (flycheck-ert-should-syntax-check "language/d/src/dmd/warning.d" 'd-mode '(4 8 error "module `external_library` is in file 'external_library.d' which cannot be read" :checker d-dmd))) (flycheck-ert-def-checker-test d-dmd d continuation-line (flycheck-ert-should-syntax-check "language/d/src/dmd/continuation.d" 'd-mode '(5 12 error "undefined identifier `invalid`" :checker d-dmd) '(10 12 error "template instance `continuation.T!()` error instantiating" :checker d-dmd) '(13 1 info "instantiated from here: `U!()`" :checker d-dmd))) (flycheck-ert-def-checker-test d-dmd d non-d-extension (skip-unless (fboundp 'd-mode)) (flycheck-ert-with-temp-buffer (insert "!invalid") (d-mode) (flycheck-ert-buffer-sync) (flycheck-ert-should-errors '(1 1 error "declaration expected, not `!`" :checker d-dmd)))) (flycheck-ert-def-checker-test dockerfile-hadolint dockerfile error (flycheck-ert-should-syntax-check "language/dockerfile/Dockerfile.error" 'dockerfile-mode '(2 1 error "unexpected 'I' expecting '#', '\\', ADD, ARG, CMD, COPY, ENTRYPOINT, ENV, EXPOSE, FROM, HEALTHCHECK, LABEL, MAINTAINER, ONBUILD, RUN, SHELL, STOPSIGNAL, USER, VOLUME, WORKDIR, at least one space, or end of input" :checker dockerfile-hadolint))) (flycheck-ert-def-checker-test dockerfile-hadolint dockerfile warnings (flycheck-ert-should-syntax-check "language/dockerfile/Dockerfile.warning" 'dockerfile-mode '(1 nil warning "Always tag the version of an image explicitly" :id "DL3006" :checker dockerfile-hadolint) '(2 nil error "Do not use apt-get upgrade or dist-upgrade" :id "DL3005" :checker dockerfile-hadolint) '(2 nil info "Delete the apt-get lists after installing something" :id "DL3009" :checker dockerfile-hadolint) '(3 nil error "Use absolute WORKDIR" :id "DL3000" :checker dockerfile-hadolint))) (flycheck-ert-def-checker-test elixir-credo elixir infos-without-strict-mode (flycheck-ert-should-syntax-check "language/elixir/lib/infos.ex" 'elixir-mode '(1 11 info "Modules should have a @moduledoc tag." :checker elixir-credo))) (flycheck-ert-def-checker-test elixir-credo elixir infos-with-strict-mode (let ((flycheck-elixir-credo-strict t)) (flycheck-ert-should-syntax-check "language/elixir/lib/infos.ex" 'elixir-mode '(1 11 info "Modules should have a @moduledoc tag." :checker elixir-credo) '(2 nil info "Do not use parentheses when defining a function which has no arguments." :checker elixir-credo)))) (flycheck-ert-def-checker-test elixir-credo elixir warnings (flycheck-ert-should-syntax-check "language/elixir/lib/warnings.ex" 'elixir-mode '(5 nil warning "There are identical sub-expressions to the left and to the right of the '&&' operator." :checker elixir-credo) '(8 8 warning "length(list) == 0 is expensive. Prefer Enum.empty?/1 or list == []" :checker elixir-credo))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp nil (flycheck-ert-should-syntax-check "language/emacs-lisp/warnings.el" 'emacs-lisp-mode '(12 nil info "First sentence should end with punctuation" :checker emacs-lisp-checkdoc) '(16 6 warning "foobar called with 1 argument, but accepts only 0" :checker emacs-lisp) '(21 1 warning "the function `dummy-package-foo' is not known to be defined." :checker emacs-lisp ))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp uses-right-major-mode (flycheck-ert-should-syntax-check "language/emacs-lisp/checkdoc-elisp-mode-regression.el" 'emacs-lisp-mode '(11 nil info "All variables and subroutines might as well have a documentation string" :checker emacs-lisp-checkdoc))) (flycheck-ert-def-checker-test (emacs-lisp-checkdoc) emacs-lisp inherits-checkdoc-variables (flycheck-ert-should-syntax-check "language/emacs-lisp/local-checkdoc-variables.el" 'emacs-lisp-mode)) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp checks-compressed-file (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/emacs-lisp/warnings.el.gz" 'emacs-lisp-mode '(12 nil info "First sentence should end with punctuation" :checker emacs-lisp-checkdoc) '(16 6 warning "foobar called with 1 argument, but accepts only 0" :checker emacs-lisp) '(21 1 warning "the function `dummy-package-foo' is not known to be defined." :checker emacs-lisp)))) (flycheck-ert-def-checker-test emacs-lisp emacs-lisp syntax-error (let ((flycheck-disabled-checkers '(emacs-lisp-checkdoc))) (flycheck-ert-should-syntax-check "language/emacs-lisp/syntax-error.el" 'emacs-lisp-mode '(3 1 error "End of file during parsing" :checker emacs-lisp)))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp without-file-name ;; Regression test for checkdoc in buffers without file names. See ;; https://github.com/flycheck/flycheck/issues/73 and ;; https://github.com/bbatsov/prelude/issues/259 (flycheck-ert-with-resource-buffer "language/emacs-lisp/warnings.el" (set-visited-file-name nil 'no-query) (emacs-lisp-mode) (should-not (buffer-file-name)) (flycheck-ert-buffer-sync) ;; TODO: Consider whether checkdoc is really useful in buffers without file ;; names… (should flycheck-current-errors))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp does-not-check-autoloads-buffers ;; Regression test ensuring that Emacs Lisp won't check autoload buffers. ;; These buffers are temporary buffers created during package installation to ;; collect the autoloads of newly installed packages before writing the ;; autoloads file. See `https://github.com/flycheck/flycheck/issues/45' and ;; `https://github.com/bbatsov/prelude/issues/253' for details. (flycheck-ert-with-file-buffer (locate-library "shut-up-autoloads") (should-not (flycheck-may-use-checker 'emacs-lisp)) (should-not (flycheck-may-use-checker 'emacs-lisp-checkdoc)))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp checkdoc-does-not-check-cask-files (flycheck-ert-with-file-buffer (expand-file-name "Cask" flycheck-test-source-directory) (should-not (flycheck-may-use-checker 'emacs-lisp-checkdoc)))) (flycheck-ert-def-checker-test (emacs-lisp emacs-lisp-checkdoc) emacs-lisp does-not-check-with-no-byte-compile ;; We need to use a hook here, because `no-byte-compile' seems to be ;; explicitly changed when loading Emacs Lisp files (let ((disable-byte-comp (lambda () (setq-local no-byte-compile t)))) (add-hook 'emacs-lisp-mode-hook disable-byte-comp) (unwind-protect (flycheck-ert-should-syntax-check "language/emacs-lisp/warnings.el" 'emacs-lisp-mode '(12 nil info "First sentence should end with punctuation" :checker emacs-lisp-checkdoc)) (remove-hook 'emacs-lisp-mode-hook disable-byte-comp)))) (flycheck-ert-def-checker-test emacs-lisp emacs-lisp check-declare-warnings (let ((flycheck-emacs-lisp-check-declare t)) (flycheck-ert-should-syntax-check "language/emacs-lisp/check-declare-warnings.el" 'emacs-lisp-mode (cond ((version< emacs-version "25") '(0 nil warning "`this-function-is-not-declared' was defined in this-file-does-not-exist.el: file not found" :checker emacs-lisp)) ((version< emacs-version "26") '(9 1 warning "`this-function-is-not-declared' was defined in this-file-does-not-exist.el: file not found" :checker emacs-lisp)) (t '(9 nil warning "`this-function-is-not-declared' was defined in this-file-does-not-exist.el: file not found" :checker emacs-lisp)))))) (flycheck-ert-def-checker-test emacs-lisp emacs-lisp disable-check-declare (let ((flycheck-emacs-lisp-check-declare nil)) (flycheck-ert-should-syntax-check "language/emacs-lisp/check-declare-warnings.el" 'emacs-lisp-mode))) (flycheck-ert-def-checker-test ember-template ember-template error (flycheck-ert-should-syntax-check "language/ember-template-lint/ember-template-lint/error.hbs" 'web-mode '(2 16 error "Incorrect indentation for `` beginning at L2:C16. Expected `` to be at an indentation of 2 but was found at 16." :id "block-indentation" :checker ember-template))) (flycheck-ert-def-checker-test ember-template ember-template warning (flycheck-ert-should-syntax-check "language/ember-template-lint/ember-template-lint/warning.hbs" 'web-mode '(1 nil warning "Non-translated string used" :id "no-bare-strings" :checker ember-template))) (defun flycheck-ert-erlang-shows-column (mode-sym) "Return whether Erlang error messages contain columns. MODE-SYM is the Erlang mode name, one of ‘erlang’ and ‘erlang-rebar3’." ;; erl -version shows the version of the "erts" application in the current otp ;; release. This is the "Erlang RunTime System" and has nothing to do with ;; flycheck-ert! (let* ((cmd (cond ((eq mode-sym 'erlang) "erl -version") ((eq mode-sym 'erlang-rebar3) "rebar3 version") (t (error "Unknown erlang mode symbol")))) (erts-version (string-trim (shell-command-to-string cmd))) (version-string (car (last (split-string erts-version))))) ;; The version of erts released with OTP 24 is 12.0. This is the first ;; time columns were added to compile warnings/errors. (version<= "12" version-string))) (flycheck-ert-def-checker-test erlang erlang error (let ((col (flycheck-ert-erlang-shows-column 'erlang))) (shut-up (flycheck-ert-should-syntax-check "language/erlang/erlang/error.erl" 'erlang-mode '(3 (when col 2) warning "export_all flag enabled - all functions will be exported" :checker erlang) '(7 (when col 1) error "head mismatch" :checker erlang))))) (flycheck-ert-def-checker-test erlang erlang warning (let ((col (flycheck-ert-erlang-shows-column 'erlang))) (flycheck-ert-should-syntax-check "language/erlang/erlang/warning.erl" 'erlang-mode '(3 (when col 2) warning "export_all flag enabled - all functions will be exported" :checker erlang) '(6 (when col 37) warning "wrong number of arguments in format call" :checker erlang)))) (flycheck-ert-def-checker-test erlang-rebar3 erlang error (let ((col (flycheck-ert-erlang-shows-column 'erlang-rebar3))) (flycheck-ert-should-syntax-check "language/erlang/rebar3/src/erlang-error.erl" 'erlang-mode '(3 (when col 2) warning "export_all flag enabled - all functions will be exported" :checker erlang-rebar3) '(7 (when col 1) error "head mismatch" :checker erlang-rebar3)))) (flycheck-ert-def-checker-test erlang-rebar3 erlang build (let ((col (flycheck-ert-erlang-shows-column 'erlang-rebar3))) (shut-up (flycheck-ert-should-syntax-check "language/erlang/rebar3/_checkouts/dependency/src/dependency.erl" 'erlang-mode `(7 (when col 1) error "head mismatch" :checker erlang-rebar3 :filename ,(flycheck-ert-resource-filename "language/erlang/rebar3/src/erlang-error.erl")))) ;; Ensure that the dependency file wasn't built as standalone ;; project which would create a separate _build directory (should (not (file-exists-p (flycheck-ert-resource-filename "language/erlang/rebar3/_build/default/lib/dependency/_build")))))) (flycheck-ert-def-checker-test eruby-erubis eruby nil (let ((flycheck-disabled-checkers '(eruby-ruumba))) (flycheck-ert-should-syntax-check "language/eruby.erb" '(html-erb-mode rhtml-mode) '(9 nil error "syntax error, unexpected end-of-input, expecting `end'" :checker eruby-erubis)))) (flycheck-ert-def-checker-test eruby-ruumba eruby syntax-error (let ((flycheck-disabled-checkers '(eruby-erubis))) (flycheck-ert-should-syntax-check "language/eruby.erb" '(html-erb-mode rhtml-mode) '(8 1 error "unexpected token $end (Using Ruby 2.4 parser; configure using `TargetRubyVersion` parameter, under `AllCops`)" :id "Lint/Syntax" :checker eruby-ruumba)))) (flycheck-ert-def-checker-test fortran-gfortran fortran error (flycheck-ert-should-syntax-check "language/fortran/error.f" '(fortran-mode f90-mode) '(1 1 error "Non-numeric character in statement label at (1)" :checker fortran-gfortran) '(2 1 error "Non-numeric character in statement label at (1)" :checker fortran-gfortran) '(3 1 error "Non-numeric character in statement label at (1)" :checker fortran-gfortran))) (flycheck-ert-def-checker-test fortran-gfortran fortran free-form-error (let ((flycheck-gfortran-layout 'free)) (flycheck-ert-should-syntax-check "language/fortran/error.f" '(fortran-mode f90-mode) '(3 3 error "Expecting END PROGRAM statement at (1)" :checker fortran-gfortran)))) (flycheck-ert-def-checker-test fortran-gfortran fortran warning (flycheck-ert-should-syntax-check "language/fortran/warning.f90" '(fortran-mode f90-mode) '(1 20 warning "Unused dummy argument 'p' at (1)" :checker fortran-gfortran) '(18 9 warning "Same actual argument associated with INTENT(IN) argument 'a' and INTENT(OUT) argument 'b' at (1)" :checker fortran-gfortran))) (flycheck-ert-def-checker-test go-gofmt go syntax-error (flycheck-ert-should-syntax-check "language/go/src/syntax/syntax-error.go" 'go-mode '(5 9 error "expected '(', found ta" :checker go-gofmt) '(6 1 error "expected declaration, found '}'" :checker go-gofmt))) (flycheck-ert-def-checker-test (go-build go-vet) go complete-chain (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "language/go"))) (flycheck-ert-should-syntax-check "language/go/src/warnings.go" 'go-mode '(4 2 error "imported and not used: \"fmt\"" :checker go-build) '(8 2 error "undefined: fmt" :checker go-build) '(12 2 error "undefined: fmt" :checker go-build) '(17 2 error "undefined: fmt" :checker go-build) '(19 13 error "cannot use 1 (type untyped int) as type string in argument to Warnf" :checker go-build)))) (flycheck-ert-def-checker-test go-build go handles-packages (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "language/go"))) (flycheck-ert-should-syntax-check "language/go/src/b1/main.go" 'go-mode))) (flycheck-ert-def-checker-test go-build go missing-package (let ((go-root (or (getenv "GOROOT") "/usr/local/go")) (go-path (concat (getenv "HOME") "/go"))) (flycheck-ert-with-env '(("GOPATH" . nil)) (flycheck-ert-should-syntax-check "language/go/src/b1/main.go" 'go-mode `(4 2 error ,(format "cannot find package \"b2\" in any of:\n\t%s/src/b2 (from $GOROOT)\n\t%s/src/b2 (from $GOPATH)" go-root go-path) :checker go-build))))) (flycheck-ert-def-checker-test go-test go nil (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "checkers/go"))) (flycheck-ert-should-syntax-check "language/go/src/test/test-error_test.go" 'go-mode '(8 2 error "undefined: fmt" :checker go-test)))) (flycheck-ert-def-checker-test go-errcheck go nil (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "language/go"))) (flycheck-ert-should-syntax-check "language/go/src/errcheck/errcheck.go" 'go-mode '(7 9 warning "Ignored `error` returned from `f.Close()`" :checker go-errcheck) '(9 9 warning "Ignored `error` returned from `os.Stat(\"enoent\")`" :checker go-errcheck)))) (flycheck-ert-def-checker-test go-unconvert go nil :tags '(language-go external-tool) (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "language/go"))) (flycheck-ert-should-syntax-check "language/go/src/unconvert/unconvert.go" 'go-mode '(7 17 warning "unnecessary conversion" :checker go-unconvert)))) (flycheck-ert-def-checker-test go-staticcheck go nil :tags '(language-go external-tool) (let ((flycheck-disabled-checkers '(go-unconvert))) (flycheck-ert-with-env `(("GOPATH" . ,(flycheck-ert-resource-filename "language/go"))) (flycheck-ert-should-syntax-check "language/go/src/staticcheck/staticcheck1.go" 'go-mode '(8 6 error "unnecessary assignment to the blank identifier" :checker go-staticcheck :id "S1005") '(12 39 error "calling strings.Replace with n == 0 will return no results, did you mean -1?" :checker go-staticcheck :id "SA1018") '(16 6 error "func unused is unused" :checker go-staticcheck :id "U1000"))))) (flycheck-ert-def-checker-test groovy groovy syntax-error ;; Work around ;; https://github.com/Groovy-Emacs-Modes/groovy-emacs-modes/issues/11 (require 'cl) (flycheck-ert-should-syntax-check "language/groovy.groovy" 'groovy-mode '(2 14 error "unexpected token: {" :checker groovy))) (flycheck-ert-def-checker-test haml haml "haml-error" (flycheck-ert-should-syntax-check "language/haml/haml-error.haml" 'haml-mode '(5 nil error "Inconsistent indentation: 3 spaces used for indentation, but the rest of the document was indented using 2 spaces." :checker haml))) (flycheck-ert-def-checker-test haml haml "ruby-error" (flycheck-ert-should-syntax-check "language/haml/ruby-error.haml" 'haml-mode '(1 nil error "unexpected end-of-input" :checker haml))) (flycheck-ert-def-checker-test handlebars handlebars nil (flycheck-ert-should-syntax-check "language/handlebars.hbs" '(handlebars-mode web-mode) '(2 nil error "Expecting 'ID', 'STRING', 'NUMBER', 'BOOLEAN', 'UNDEFINED', 'NULL', 'DATA', got 'INVALID'" :checker handlebars))) (flycheck-ert-def-checker-test haskell-stack-ghc haskell syntax-error (skip-unless (file-exists-p (getenv "HOME"))) (let ((flycheck-disabled-checkers '(haskell-ghc))) (flycheck-ert-should-syntax-check "language/haskell/SyntaxError.hs" 'haskell-mode '(3 1 error "parse error on input `module'" :checker haskell-stack-ghc)))) (flycheck-ert-def-checker-test haskell-stack-ghc haskell type-error (skip-unless (file-exists-p (getenv "HOME"))) (let ((flycheck-disabled-checkers '(haskell-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Error.hs" 'haskell-mode '(4 16 error "* Couldn't match type `Bool' with `[Char]' Expected type: String Actual type: Bool * In the first argument of `putStrLn', namely `True' In the expression: putStrLn True In an equation for `foo': foo = putStrLn True" :checker haskell-stack-ghc)))) (flycheck-ert-def-checker-test (haskell-stack-ghc haskell-hlint) haskell literate (skip-unless (file-exists-p (getenv "HOME"))) (let ((flycheck-disabled-checkers '(haskell-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Literate.lhs" 'haskell-literate-mode '(6 1 warning "Top-level binding with no type signature: foo :: a" :id "-Wmissing-signatures" :checker haskell-stack-ghc)))) (flycheck-ert-def-checker-test (haskell-stack-ghc haskell-hlint) haskell complete-chain (skip-unless (file-exists-p (getenv "HOME"))) (let ((flycheck-disabled-checkers '(haskell-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Warnings.hs" 'haskell-mode '(4 1 warning "Eta reduce Found: spam eggs = map lines eggs Perhaps: spam = map lines" :checker haskell-hlint) '(4 1 warning "Top-level binding with no type signature: spam :: [String] -> [[String]]" :id "-Wmissing-signatures" :checker haskell-stack-ghc) '(7 8 info "Redundant bracket Found: (putStrLn \"hello world\") Perhaps: putStrLn \"hello world\"" :checker haskell-hlint)))) (flycheck-ert-def-checker-test haskell-stack-ghc haskell nonstandard-stack-yaml-file (skip-unless (file-exists-p (getenv "HOME"))) (let* ((flycheck-disabled-checkers '(haskell-ghc)) (proj-dir "language/haskell/stack-project-with-renamed-stack-yaml") (flycheck-ghc-stack-project-file (expand-file-name "stack-nonstandard.yaml" (flycheck-ert-resource-filename proj-dir)))) (flycheck-ert-should-syntax-check (concat proj-dir "/src/Foo.hs") 'haskell-mode))) (flycheck-ert-def-checker-test haskell-ghc haskell syntax-error (let ((flycheck-disabled-checkers '(haskell-stack-ghc))) (flycheck-ert-should-syntax-check "language/haskell/SyntaxError.hs" 'haskell-mode '(3 1 error "parse error on input `module'" :checker haskell-ghc)))) (flycheck-ert-def-checker-test haskell-ghc haskell type-error (let ((flycheck-disabled-checkers '(haskell-stack-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Error.hs" 'haskell-mode '(4 16 error "* Couldn't match type `Bool' with `[Char]' Expected type: String Actual type: Bool * In the first argument of `putStrLn', namely `True' In the expression: putStrLn True In an equation for `foo': foo = putStrLn True" :checker haskell-ghc)))) (flycheck-ert-def-checker-test (haskell-ghc haskell-hlint) haskell literate (let ((flycheck-disabled-checkers '(haskell-stack-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Literate.lhs" 'haskell-literate-mode '(6 1 warning "Top-level binding with no type signature: foo :: a" :id "-Wmissing-signatures" :checker haskell-ghc)))) (flycheck-ert-def-checker-test (haskell-ghc haskell-hlint) haskell complete-chain (let ((flycheck-disabled-checkers '(haskell-stack-ghc))) (flycheck-ert-should-syntax-check "language/haskell/Warnings.hs" 'haskell-mode '(4 1 warning "Eta reduce Found: spam eggs = map lines eggs Perhaps: spam = map lines" :checker haskell-hlint) '(4 1 warning "Top-level binding with no type signature: spam :: [String] -> [[String]]" :id "-Wmissing-signatures" :checker haskell-ghc) '(7 8 info "Redundant bracket Found: (putStrLn \"hello world\") Perhaps: putStrLn \"hello world\"" :checker haskell-hlint)))) (flycheck-ert-def-checker-test html-tidy html nil (flycheck-ert-should-syntax-check "language/html.html" '(html-mode) '(3 1 warning "missing declaration" :checker html-tidy) '(8 5 error " is not recognized!" :checker html-tidy) '(8 5 warning "discarding unexpected " :checker html-tidy))) (defconst flycheck-test-javascript-modes '(js-mode js2-mode js3-mode js2-jsx-mode rjsx-mode)) (when (version<= "25" emacs-version) (add-to-list 'flycheck-test-javascript-modes 'js-jsx-mode)) (flycheck-ert-def-checker-test javascript-jshint javascript syntax-error :tags '(checkstyle-xml) ;; Silence JS2 and JS3 parsers (let ((js2-mode-show-parse-errors nil) (js2-mode-show-strict-warnings nil) (js3-mode-show-parse-errors nil) (inhibit-message t) (flycheck-disabled-checkers '(javascript-eslint javascript-gjslint))) (flycheck-ert-should-syntax-check "language/javascript/syntax-error.js" '(js-mode js2-mode js3-mode rjsx-mode) '(3 1 error "Unrecoverable syntax error. (75% scanned)." :checker javascript-jshint :id "E041") '(3 25 error "Expected an identifier and instead saw ')'." :checker javascript-jshint :id "E030")))) (flycheck-ert-def-checker-test javascript-jshint javascript nil :tags '(checkstyle-xml) (let ((flycheck-jshintrc "jshintrc") (inhibit-message t) (flycheck-disabled-checkers '(javascript-eslint javascript-gjslint))) (flycheck-ert-should-syntax-check "language/javascript/warnings.js" '(js-mode js2-mode js3-mode rjsx-mode) '(4 9 warning "'foo' is defined but never used." :id "W098" :checker javascript-jshint)))) (flycheck-ert-def-checker-test javascript-eslint javascript error (let ((flycheck-disabled-checkers '(javascript-jshint)) (inhibit-message t)) (flycheck-ert-should-syntax-check "language/javascript/syntax-error.js" flycheck-test-javascript-modes '(3 25 error "Parsing error: Unexpected token )" :checker javascript-eslint)))) (flycheck-ert-def-checker-test javascript-eslint javascript warning (let ((flycheck-disabled-checkers '(javascript-jshint)) (inhibit-message t)) (flycheck-ert-should-syntax-check "language/javascript/warnings.js" flycheck-test-javascript-modes '(3 2 warning "Use the function form of 'use strict'." :id "strict" :checker javascript-eslint :end-line 5 :end-column 2) '(4 9 warning "'foo' is assigned a value but never used." :id "no-unused-vars" :checker javascript-eslint :end-line 4 :end-column 12)))) (flycheck-ert-def-checker-test javascript-standard javascript error (let ((flycheck-checker 'javascript-standard) (inhibit-message t)) (flycheck-ert-should-syntax-check "language/javascript/style.js" flycheck-test-javascript-modes '(3 10 error "Missing space before function parentheses." :checker javascript-standard) '(4 1 error "Unexpected tab character." :checker javascript-standard) '(4 1 error "Expected indentation of 2 spaces but found 1 tab." :checker javascript-standard) '(4 2 error "Unexpected var, use let or const instead." :checker javascript-standard) '(4 6 error "'foo' is assigned a value but never used." :checker javascript-standard) '(4 13 error "Strings must use singlequote." :checker javascript-standard) '(4 27 error "Extra semicolon." :checker javascript-standard) '(5 5 error "Extra semicolon." :checker javascript-standard)))) (flycheck-ert-def-checker-test javascript-standard javascript semistandard (let ((flycheck-checker 'javascript-standard) (flycheck-javascript-standard-executable "semistandard") (inhibit-message t)) (flycheck-ert-should-syntax-check "language/javascript/style.js" flycheck-test-javascript-modes '(3 10 error "Missing space before function parentheses." :checker javascript-standard) '(4 1 error "Unexpected tab character." :checker javascript-standard) '(4 1 error "Expected indentation of 2 spaces but found 1 tab." :checker javascript-standard) '(4 2 error "Unexpected var, use let or const instead." :checker javascript-standard) '(4 6 error "'foo' is assigned a value but never used." :checker javascript-standard) '(4 13 error "Strings must use singlequote." :checker javascript-standard)))) (flycheck-ert-def-checker-test json-jsonlint json nil (flycheck-ert-should-syntax-check "language/json.json" 'json-mode '(1 44 error "found: ',' - expected: 'EOF'." :checker json-jsonlint))) (flycheck-ert-def-checker-test json-python-json json nil (let ((flycheck-disabled-checkers '(json-jsonlint))) (flycheck-ert-should-syntax-check "language/json.json" 'json-mode '(1 44 error "Extra data" :checker json-python-json)))) (flycheck-ert-def-checker-test json-jq json nil (let ((flycheck-disabled-checkers '(json-jsonlint json-python-json))) (flycheck-ert-should-syntax-check "language/json.json" 'json-mode '(1 44 error "Expected value before ','" :checker json-jq)))) (flycheck-ert-def-checker-test less less file-error (let* ((candidates (list "no-such-file.less" "npm://no-such-file.less" "no-such-file.less")) (message (string-join candidates ","))) (flycheck-ert-should-syntax-check "language/less/file-error.less" 'less-css-mode `(3 1 error ,(concat "'no-such-file.less' wasn't found. Tried - " message) :checker less)))) (flycheck-ert-def-checker-test less less syntax-error (flycheck-ert-should-syntax-check "language/less/syntax-error.less" 'less-css-mode '(1 1 error "Unrecognised input" :checker less))) (flycheck-ert-def-checker-test llvm-llc llvm nil (flycheck-ert-should-syntax-check "language/llvm.ll" 'llvm-mode '(4 19 error "'%tmp' defined with type 'i32'" :checker llvm-llc))) (flycheck-ert-def-checker-test lua-luacheck lua syntax-error (flycheck-ert-should-syntax-check "language/lua/syntax-error.lua" 'lua-mode '(5 7 error "unfinished string" :id "E011" :checker lua-luacheck))) (flycheck-ert-def-checker-test lua-luacheck lua warnings (flycheck-ert-should-syntax-check "language/lua/warnings.lua" 'lua-mode '(1 1 warning "setting non-standard global variable 'global_var'" :id "W111" :checker lua-luacheck) '(3 16 warning "unused function 'test'" :id "W211" :checker lua-luacheck) '(3 21 warning "unused argument 'arg'" :id "W212" :checker lua-luacheck) '(4 11 warning "variable 'var2' is never set" :id "W221" :checker lua-luacheck))) (flycheck-ert-def-checker-test lua-luacheck lua custom-luacheckrc (let ((flycheck-luacheckrc "custom.luacheckrc")) (flycheck-ert-should-syntax-check "language/lua/warnings.lua" 'lua-mode '(1 1 warning "setting non-standard global variable 'global_var'" :id "W111" :checker lua-luacheck) '(3 16 warning "unused function 'test'" :id "W211" :checker lua-luacheck) '(4 11 warning "variable 'var2' is never set" :id "W221" :checker lua-luacheck)))) (flycheck-ert-def-checker-test lua-luacheck lua custom-standards (let ((flycheck-luacheck-standards '("ngx_lua"))) (flycheck-ert-should-syntax-check "language/lua/ngx_lua.warnings.lua" 'lua-mode '(3 16 warning "unused function 'test'" :id "W211" :checker lua-luacheck) '(3 21 warning "unused argument 'arg'" :id "W212" :checker lua-luacheck) '(4 11 warning "variable 'var2' is never set" :id "W221" :checker lua-luacheck)))) (flycheck-ert-def-checker-test lua lua nil (let ((flycheck-disabled-checkers '(lua-luacheck))) (flycheck-ert-should-syntax-check "language/lua/syntax-error.lua" 'lua-mode '(5 nil error "unfinished string near '\"oh no'" :checker lua)))) (flycheck-ert-def-checker-test opam opam nil (flycheck-ert-should-syntax-check "language/opam.opam" 'tuareg-opam-mode '(0 nil error "Missing field 'maintainer'" :id "23" :checker opam) '(0 nil warning "Missing field 'authors'" :id "25" :checker opam) '(0 nil warning "Missing field 'homepage'" :id "35" :checker opam) '(0 nil warning "Missing field 'bug-reports'" :id "36" :checker opam) '(2 1 error "Invalid field maintainers" :id "3" :checker opam))) (flycheck-ert-def-checker-test (perl perl-perlcritic) perl nil (flycheck-ert-should-syntax-check "language/perl.pl" '(perl-mode cperl-mode) '(6 nil error "Global symbol \"$x\" requires explicit package name (did you forget to declare \"my $x\"?)" :checker perl) '(6 nil error "BEGIN not safe after errors--compilation aborted" :checker perl) '(6 6 error "Glob written as <...> (See page 167 of PBP)" :id "BuiltinFunctions::RequireGlobFunction" :checker perl-perlcritic))) (flycheck-ert-def-checker-test perl perl modules ;; Files that require unlisted modules should fail to check (flycheck-ert-should-syntax-check "language/perl/Script.pl" '(perl-mode cperl-mode) '(3 nil error "Global symbol \"$dependency_a\" requires explicit package name (did you forget to declare \"my $dependency_a\"?)" :checker perl) '(4 nil error "Global symbol \"$dependency_b\" requires explicit package name (did you forget to declare \"my $dependency_b\"?)" :checker perl)) ;; Including those modules should allow them to check (let ((flycheck-perl-include-path '(".")) (flycheck-perl-module-list '("DependencyA"))) (flycheck-ert-should-syntax-check "language/perl/Script.pl" '(perl-mode cperl-mode) '(4 nil error "Global symbol \"$dependency_b\" requires explicit package name (did you forget to declare \"my $dependency_b\"?)" :checker perl))) ;; ;; Multiple modules should be allowed (let ((flycheck-perl-include-path '(".")) (flycheck-perl-module-list '("DependencyA" "DependencyB"))) (flycheck-ert-should-syntax-check "language/perl/Script.pl" '(perl-mode cperl-mode)))) (flycheck-ert-def-checker-test php php syntax-error (when (version<= emacs-version "25") (ert-skip "PHP mode (via CC mode) seems broken on 24.5.")) (flycheck-ert-should-syntax-check "language/php/syntax-error.php" 'php-mode '(8 nil error "Assignments can only happen to writable values" :checker php))) (flycheck-ert-def-checker-test (php php-phpcs php-phpmd) php nil :tags '(phpmd-xml checkstyle-xml) (flycheck-ert-should-syntax-check "language/php/warnings.php" 'php-mode '(1 1 error "Missing file doc comment" :id "PEAR.Commenting.FileComment.Missing" :checker php-phpcs) '(21 nil warning "Avoid unused private fields such as '$FOO'." :id "UnusedPrivateField" :checker php-phpmd) '(21 20 error "Private member variable \"FOO\" must be prefixed with an underscore" :id "PEAR.NamingConventions.ValidVariableName.PrivateNoUnderscore" :checker php-phpcs) '(23 5 error "The open comment tag must be the only content on the line" :id "Generic.Commenting.DocComment.ContentAfterOpen" :checker php-phpcs) '(23 5 error "Doc comment for parameter \"$baz\" missing" :id "PEAR.Commenting.FunctionComment.MissingParamTag" :checker php-phpcs) '(23 9 error "Doc comment short description must be on the first line" :id "Generic.Commenting.DocComment.SpacingBeforeShort" :checker php-phpcs) '(23 29 error "The close comment tag must be the only content on the line" :id "Generic.Commenting.DocComment.ContentBeforeClose" :checker php-phpcs) '(23 29 error "Missing @return tag in function comment" :id "PEAR.Commenting.FunctionComment.MissingReturn" :checker php-phpcs) '(24 nil warning "Avoid unused private methods such as 'bar'." :id "UnusedPrivateMethod" :checker php-phpmd) '(24 nil warning "Avoid unused parameters such as '$baz'." :id "UnusedFormalParameter" :checker php-phpmd) '(24 13 error "Private method name \"A::bar\" must be prefixed with an underscore" :id "PEAR.NamingConventions.ValidFunctionName.PrivateNoUnderscore" :checker php-phpcs) '(26 nil warning "Avoid variables with short names like $i. Configured minimum length is 3." :id "ShortVariable" :checker php-phpmd) '(26 nil warning "Avoid unused local variables such as '$i'." :id "UnusedLocalVariable" :checker php-phpmd) '(26 12 error "TRUE, FALSE and NULL must be lowercase; expected \"false\" but found \"FALSE\"" :id "Generic.PHP.LowerCaseConstant.Found" :checker php-phpcs))) (flycheck-ert-def-checker-test proselint (text markdown) nil ;; Unset LC_ALL which is set to LC_ALL=C for other checkers in ./run.el, ;; because Click, used by ProseLint, when running with python 3 will refuse to ;; work unless an Unicode locale is exported. See: ;; http://click.pocoo.org/5/python3/#python-3-surrogate-handling (let ((flycheck-disabled-checkers '(markdown-markdownlint-cli markdown-markdownlint-cli2 markdown-mdl markdown-pymarkdown))) (flycheck-ert-with-env '(("LC_ALL" . nil)) (flycheck-ert-should-syntax-check "language/text/text.txt" '(text-mode markdown-mode) '(1 7 warning "Substitute 'damn' every time you're inclined to write 'very'; your editor will delete it and the writing will be just as it should be." :id "weasel_words.very" :checker proselint :end-line 1 :end-column 12) '(2 4 warning "Redundancy. Use 'associate' instead of 'associate together'." :id "redundancy.garner" :checker proselint :end-line 3 :end-column 1) '(3 5 warning "Gender bias. Use 'lawyer' instead of 'lady lawyer'." :id "sexism.misc" :checker proselint :end-line 3 :end-column 17))))) (flycheck-ert-def-checker-test processing processing syntax-error (flycheck-ert-should-syntax-check "language/processing/syntax_error/syntax_error.pde" 'processing-mode '(4 2 error "Syntax error, maybe a missing semicolon?" :checker processing))) (flycheck-ert-def-checker-test protobuf-protoc protobuf syntax-error (flycheck-ert-should-syntax-check "language/protobuf/protobuf/syntax-error.proto" 'protobuf-mode '(2 23 error "Missing field number." :checker protobuf-protoc))) (flycheck-ert-def-checker-test protobuf-prototool protobuf warnings (flycheck-ert-should-syntax-check "language/protobuf/prototool/missing_syntax.proto" 'protobuf-mode '(1 1 warning "No syntax specified. Please use 'syntax = \"proto2\";' or 'syntax = \"proto3\";' to specify a syntax version." :checker protobuf-prototool) '(4 3 warning "Expected \"required\", \"optional\", or \"repeated\"." :checker protobuf-prototool))) (flycheck-ert-def-checker-test pug pug syntax-error (flycheck-ert-should-syntax-check "language/pug/pug.pug" 'pug-mode '(2 1 error "unexpected token \"indent\"" :checker pug))) (flycheck-ert-def-checker-test pug pug non-block-or-mixin-at-top-level-of-extended-template-error (flycheck-ert-should-syntax-check "language/pug/foo.pug" 'pug-mode '(9 1 error "Only named blocks and mixins can appear at the top level of an extending template" :checker pug))) (flycheck-ert-def-checker-test pug pug unknown-filter (flycheck-ert-should-syntax-check "language/pug/foo-unknown-filter.pug" 'pug-mode '(1 1 error "unknown filter \":myfilter\"" :checker pug))) (flycheck-ert-def-checker-test pug pug include-extends-error (flycheck-ert-should-syntax-check "language/pug/pug-extends.pug" 'pug-mode '(1 nil error "the \"basedir\" option is required to use includes and extends with \"absolute\" paths" :checker pug))) (flycheck-ert-def-checker-test pug pug type-error (flycheck-ert-should-syntax-check "language/pug/pug-runtime-error.pug" 'pug-mode '(5 nil error "Cannot read property 'bar' of undefined" :checker pug))) ;; N.B. the puppet 4 and 3 tests are mutually exclusive ;; due to one having column and the other not (flycheck-ert-def-checker-test puppet-parser puppet parser-error-puppet-4 (skip-unless (version<= "4" (shell-command-to-string "printf %s \"$(puppet --version)\""))) (flycheck-ert-should-syntax-check "language/puppet/parser-error.pp" 'puppet-mode '(3 9 error "Syntax error at '>'" :checker puppet-parser))) (flycheck-ert-def-checker-test puppet-parser puppet parser-error-puppet-3 (skip-unless (version<= (shell-command-to-string "printf %s \"$(puppet --version)\"") "4")) (flycheck-ert-should-syntax-check "language/puppet/puppet3-parser-error.pp" 'puppet-mode '(4 3 error "Syntax error at 'helloagain'" :checker puppet-parser)) (flycheck-ert-should-syntax-check "language/puppet/puppet3-parser-multiline-error.pp" 'puppet-mode '(4 25 error "Unclosed quote after \"'\" followed by '\\n}\\n...'" :checker puppet-parser))) (flycheck-ert-def-checker-test puppet-lint puppet nil (flycheck-ert-should-syntax-check "language/puppet/warnings.pp" 'puppet-mode '(2 nil error "foo::bar not in autoload module layout (autoloader_layout)" :checker puppet-lint) '(3 nil warning "case statement without a default case (case_without_default)" :checker puppet-lint))) (flycheck-ert-def-checker-test python-flake8 python syntax-error (let ((python-indent-guess-indent-offset nil) ; Silence Python Mode! (flycheck-python-flake8-executable "python3")) (flycheck-ert-should-syntax-check "language/python/syntax-error.py" 'python-mode '(3 7 error "SyntaxError: invalid syntax" :id "E999" :checker python-flake8)))) (flycheck-ert-def-checker-test python-flake8 python nil (let ((flycheck-python-flake8-executable "python3")) (flycheck-ert-should-syntax-check "language/python/test.py" 'python-mode '(5 1 warning "'.antigravit' imported but unused" :id "F401" :checker python-flake8) '(7 1 warning "expected 2 blank lines, found 1" :id "E302" :checker python-flake8) '(12 29 warning "unexpected spaces around keyword / parameter equals" :id "E251" :checker python-flake8) '(12 31 warning "unexpected spaces around keyword / parameter equals" :id "E251" :checker python-flake8) '(22 1 error "undefined name 'antigravity'" :id "F821" :checker python-flake8)))) (flycheck-ert-def-checker-test python-pyright python nil (let ((flycheck-disabled-checkers '(python-mypy)) (flycheck-checkers '(python-pyright))) (flycheck-ert-should-syntax-check "language/python/invalid_type.py" 'python-mode '(2 12 error "Expression of type \"str\" cannot be assigned to return type \"int\"\n  \"str\" is incompatible with \"int\"" :checker python-pyright :end-line 2 :end-column 13)))) (flycheck-ert-def-checker-test python-mypy python nil (let ((flycheck-disabled-checkers '(python-flake8)) (flycheck-checkers '(python-mypy)) (flycheck-python-mypy-cache-dir null-device)) (flycheck-ert-should-syntax-check "language/python/invalid_type.py" 'python-mode '(2 12 error "Incompatible return value type (got \"str\", expected \"int\")" :checker python-mypy)))) (flycheck-ert-def-checker-test python-pylint python nil (let ((flycheck-disabled-checkers '(python-flake8 python-mypy)) (flycheck-python-pylint-executable "python3")) (flycheck-ert-should-syntax-check "language/python/test.py" 'python-mode '(1 1 info "Missing module docstring" :id "missing-module-docstring" :checker python-pylint) '(5 1 error "No name 'antigravit' in module 'python'" :id "no-name-in-module" :checker python-pylint) '(5 1 warning "Unused import antigravit" :id "unused-import" :checker python-pylint) '(7 1 info "Missing class docstring" :id "missing-class-docstring" :checker python-pylint) '(7 1 warning "Class 'Spam' inherits from object, can be safely removed from bases in python3" :id "useless-object-inheritance" :checker python-pylint) '(9 5 info "Method name \"withEggs\" doesn't conform to snake_case naming style" :id "invalid-name" :checker python-pylint) '(9 5 info "Missing function or method docstring" :id "missing-function-docstring" :checker python-pylint) '(9 5 warning "Method could be a function" :id "no-self-use" :checker python-pylint) '(12 5 info "Missing function or method docstring" :id "missing-function-docstring" :checker python-pylint) '(12 5 warning "Either all return statements in a function should return an expression, or none of them should." :id "inconsistent-return-statements" :checker python-pylint) '(12 5 warning "Method could be a function" :id "no-self-use" :checker python-pylint) '(14 16 error "Module 'sys' has no 'python_version' member" :id "no-member" :checker python-pylint) '(22 1 error "Undefined variable 'antigravity'" :id "undefined-variable" :checker python-pylint)))) (flycheck-ert-def-checker-test python-pylint python no-symbolic-id (let ((flycheck-disabled-checkers '(python-flake8 python-mypy)) (flycheck-pylint-use-symbolic-id nil) (flycheck-python-pylint-executable "python3")) (flycheck-ert-should-syntax-check "language/python/test.py" 'python-mode '(1 1 info "Missing module docstring" :id "C0114" :checker python-pylint) '(5 1 error "No name 'antigravit' in module 'python'" :id "E0611" :checker python-pylint) '(5 1 warning "Unused import antigravit" :id "W0611" :checker python-pylint) '(7 1 info "Missing class docstring" :id "C0115" :checker python-pylint) '(7 1 warning "Class 'Spam' inherits from object, can be safely removed from bases in python3" :id "R0205" :checker python-pylint) '(9 5 info "Method name \"withEggs\" doesn't conform to snake_case naming style" :id "C0103" :checker python-pylint) '(9 5 info "Missing function or method docstring" :id "C0116" :checker python-pylint) '(9 5 warning "Method could be a function" :id "R0201" :checker python-pylint) '(12 5 info "Missing function or method docstring" :id "C0116" :checker python-pylint) '(12 5 warning "Either all return statements in a function should return an expression, or none of them should." :id "R1710" :checker python-pylint) '(12 5 warning "Method could be a function" :id "R0201" :checker python-pylint) '(14 16 error "Module 'sys' has no 'python_version' member" :id "E1101" :checker python-pylint) '(22 1 error "Undefined variable 'antigravity'" :id "E0602" :checker python-pylint)))) (flycheck-ert-def-checker-test python-pylint python negative-columns (let ((flycheck-disabled-checkers '(python-flake8 python-mypy)) (python-indent-guess-indent-offset nil) ; Silence Python Mode (flycheck-python-pylint-executable "python3")) (flycheck-ert-should-syntax-check "language/python/gh_1383.py" 'python-mode '(2 1 warning "Unused import sys" :id "unused-import" :checker python-pylint) '(4 1 warning "String statement has no effect" :id "pointless-string-statement" :checker python-pylint)))) (flycheck-ert-def-checker-test python-pycompile python python27 (skip-unless (executable-find "python2")) (let ((flycheck-disabled-checkers '(python-flake8 python-pylint python-mypy)) (flycheck-python-pycompile-executable "python2") (python-indent-guess-indent-offset nil)) (flycheck-ert-should-syntax-check "language/python/syntax-error.py" 'python-mode `(3 nil error "invalid syntax" :checker python-pycompile)))) (flycheck-ert-def-checker-test python-pycompile python has-no-warnings (let ((flycheck-disabled-checkers '(python-flake8 python-pylint python-mypy))) (flycheck-ert-should-syntax-check "language/python/test.py" 'python-mode))) (flycheck-ert-def-checker-test r-lintr r nil ;; Disable caching in lintr tests to make sure that the file is re-checked ;; every time (skip-unless (flycheck-r-has-lintr (flycheck-checker-executable 'r-lintr))) (let ((flycheck-lintr-caching nil)) (flycheck-ert-should-syntax-check "language/r.R" 'R-mode '(1 28 info "Opening curly braces should never go on their own line and should always be followed by a new line." :checker r-lintr) '(1 56 info "Put spaces around all infix operators." :checker r-lintr) '(4 6 warning "Do not use absolute paths." :checker r-lintr) '(7 5 error "unexpected end of input" :checker r-lintr)))) (flycheck-ert-def-checker-test r r nil (let ((flycheck-disabled-checkers '(r-lintr))) (flycheck-ert-should-syntax-check "language/r.R" 'R-mode '(8 0 error "unexpected end of input" :checker r)))) (flycheck-ert-def-checker-test racket racket nil (skip-unless (funcall (flycheck-checker-get 'racket 'predicate))) (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/racket.rkt" 'racket-mode '(4 3 error "read: expected a `)' to close `('" :checker racket)))) (flycheck-ert-def-checker-test rpm-rpmlint rpm nil (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/rpm.spec" '(sh-mode rpm-spec-mode) '(1 nil warning "no-cleaning-of-buildroot %clean" :checker rpm-rpmlint) '(1 nil warning "no-cleaning-of-buildroot %install" :checker rpm-rpmlint) '(1 nil warning "no-buildroot-tag" :checker rpm-rpmlint) '(7 nil error "buildarch-instead-of-exclusivearch-tag x86_64" :checker rpm-rpmlint) '(22 nil warning "macro-in-%changelog %{_bindir}" :checker rpm-rpmlint)))) (flycheck-ert-def-checker-test tcl-nagelfar tcl nil (flycheck-ert-should-syntax-check "language/tcl/test.tcl" 'tcl-mode '(7 nil warning "Expr without braces" :checker tcl-nagelfar) '(8 nil info "Suspicious variable name \"val_${val}\"" :checker tcl-nagelfar) '(9 nil info "Suspicious variable name \"val_${val}\"" :checker tcl-nagelfar) '(12 nil error "Wrong number of arguments \(4\) to \"set\"" :checker tcl-nagelfar))) (flycheck-ert-def-checker-test terraform terraform nil (flycheck-ert-should-syntax-check "language/terraform/terraform/syntax-error.tf" 'terraform-mode '(2 nil error "The \";\" character is not valid. Use newlines to separate arguments and blocks,\nand commas to separate items in collection values." :checker terraform) '(2 nil error "An argument definition must end with a newline." :checker terraform))) (flycheck-ert-def-checker-test terraform-tflint terraform nil (flycheck-ert-should-syntax-check "language/terraform/tflint/error.tf" 'terraform-mode '(2 12 warning "Module source \"git://hashicorp.com/consul.git\" is not pinned" :id "terraform_module_pinned_source" :checker terraform-tflint :end-line 2 :end-column 44) '(7 19 error "\"t1.2xlarge\" is an invalid value as instance_type" :id "aws_instance_invalid_type" :checker terraform-tflint :end-line 7 :end-column 31))) (flycheck-ert-def-checker-test markdown-markdownlint-cli markdown nil (flycheck-ert-should-syntax-check "language/markdown.md" 'markdown-mode '(1 nil error "First line in a file should be a top-level heading [Context: \"## Second Header First\"]" :id "MD041/first-line-heading/first-line-h1" :checker markdown-markdownlint-cli) '(3 nil error "Multiple consecutive blank lines [Expected: 1; Actual: 2]" :id "MD012/no-multiple-blanks" :checker markdown-markdownlint-cli) '(4 15 error "Trailing spaces [Expected: 0 or 2; Actual: 7]" :id "MD009/no-trailing-spaces" :checker markdown-markdownlint-cli))) (flycheck-ert-def-checker-test markdown-mdl markdown nil (let ((flycheck-disabled-checkers '(markdown-markdownlint-cli markdown-markdownlint-cli2 markdown-pymarkdown))) (flycheck-ert-should-syntax-check "language/markdown.md" 'markdown-mode '(1 nil error "First header should be a top level header" :id "MD002" :checker markdown-mdl) '(3 nil error "Multiple consecutive blank lines" :id "MD012" :checker markdown-mdl) '(4 nil error "Trailing spaces" :id "MD009" :checker markdown-mdl)))) (flycheck-ert-def-checker-test markdown-pymarkdown markdown nil (let ((flycheck-disabled-checkers '(markdown-markdownlint-cli markdown-markdownlint-cli2 markdown-mdl))) (flycheck-ert-should-syntax-check "language/markdown.md" 'markdown-mode '(1 nil error "Headings should be surrounded by blank lines. [Expected: 1; Actual: 2; Below] (blanks-around-headings,blanks-around-headers)" :id "MD022" :checker markdown-pymarkdown) '(1 nil error "First line in file should be a top level heading (first-line-heading,first-line-h1)" :id "MD041" :checker markdown-pymarkdown) '(3 nil error "Multiple consecutive blank lines [Expected: 1, Actual: 2] (no-multiple-blanks)" :id "MD012" :checker markdown-pymarkdown) '(4 nil error "Trailing spaces [Expected: 0 or 2; Actual: 7] (no-trailing-spaces)" :id "MD009" :checker markdown-pymarkdown)))) (flycheck-ert-def-checker-test nix nix nil (flycheck-ert-should-syntax-check "language/nix/syntax-error.nix" 'nix-mode '(3 1 error "syntax error, unexpected IN, expecting ';'," :checker nix))) (flycheck-ert-def-checker-test nix-linter nix nil (flycheck-ert-should-syntax-check "language/nix/warnings.nix" 'nix-mode '(1 1 warning "LetInInheritRecset" :id "LetInInheritRecset" :checker nix-linter) '(3 4 warning "Unneeded `rec` on set" :id "UnneededRec" :checker nix-linter))) (ert-deftest flycheck-locate-sphinx-source-directory/not-in-a-sphinx-project () :tags '(language-rst) (flycheck-ert-with-resource-buffer "language/rst/errors.rst" (should-not (flycheck-locate-sphinx-source-directory)))) (ert-deftest flycheck-locate-sphinx-source-directory/in-a-sphinx-project () :tags '(language-rst) (flycheck-ert-with-resource-buffer "language/rst/sphinx/index.rst" (should (string= (flycheck-locate-sphinx-source-directory) (flycheck-ert-resource-filename "language/rst/sphinx/"))))) (flycheck-ert-def-checker-test rst rst nil (flycheck-ert-should-syntax-check "language/rst/errors.rst" 'rst-mode '(8 nil warning "Title underline too short." :checker rst) '(14 nil error "Unexpected section title." :checker rst) '(16 nil error "Unknown target name: \"restructuredtext\"." :checker rst) '(19 nil warning "Title underline too short." :checker rst) '(21 nil error "Unknown target name: \"cool\"." :checker rst) '(26 nil error "Unexpected section title." :checker rst))) (flycheck-ert-def-checker-test rst-sphinx rst nil (flycheck-ert-should-syntax-check "language/rst/sphinx/index.rst" 'rst-mode '(2 nil warning "Title underline too short." :checker rst-sphinx) '(9 nil warning "Unknown target name: \"cool\"." :checker rst-sphinx) '(9 nil warning "'envvar' reference target not found: FOO" :checker rst-sphinx))) (flycheck-ert-def-checker-test rst-sphinx rst not-outside-of-a-sphinx-project (flycheck-ert-with-resource-buffer "language/rst/errors.rst" (rst-mode) (should-not (flycheck-may-use-checker 'rst-sphinx)))) (flycheck-ert-def-checker-test ruby-rubocop ruby syntax-error (flycheck-ert-should-syntax-check "language/ruby/syntax-error.rb" 'ruby-mode '(5 7 error "unexpected token tCONSTANT (Using Ruby 2.4 parser; configure using `TargetRubyVersion` parameter, under `AllCops`)" :id "Lint/Syntax" :checker ruby-rubocop) '(5 24 error "unterminated string meets end of file (Using Ruby 2.4 parser; configure using `TargetRubyVersion` parameter, under `AllCops`)" :id "Lint/Syntax" :checker ruby-rubocop))) (flycheck-ert-def-checker-test ruby-standard ruby syntax-error (let ((flycheck-disabled-checkers '(ruby-rubocop))) (flycheck-ert-should-syntax-check "language/ruby/syntax-error.rb" 'ruby-mode '(5 7 error "unexpected token tCONSTANT (Using Ruby 2.4 parser; configure using `TargetRubyVersion` parameter, under `AllCops`)" :id "Lint/Syntax" :checker ruby-standard) '(5 24 error "unterminated string meets end of file (Using Ruby 2.4 parser; configure using `TargetRubyVersion` parameter, under `AllCops`)" :id "Lint/Syntax" :checker ruby-standard)))) (flycheck-ert-def-checker-test ruby ruby syntax-error (let ((flycheck-disabled-checkers '(ruby-rubocop ruby-reek))) (flycheck-ert-should-syntax-check "language/ruby/syntax-error.rb" 'ruby-mode '(4 nil warning "assigned but unused variable - days" :checker ruby) '(5 nil error "syntax error, unexpected constant, expecting end-of-input" :checker ruby)))) (flycheck-ert-def-checker-test ruby-jruby ruby syntax-error (let ((flycheck-disabled-checkers '(ruby-rubocop ruby-reek ruby))) (flycheck-ert-should-syntax-check "language/ruby/syntax-error.rb" 'ruby-mode '(5 nil error "syntax error, unexpected tCONSTANT" :checker ruby-jruby)))) (flycheck-ert-def-checker-test (ruby-rubocop ruby-reek) ruby warnings (flycheck-ert-should-syntax-check "language/ruby/warnings.rb" 'ruby-mode '(1 1 info "Missing frozen string literal comment." :id "[Correctable] Style/FrozenStringLiteralComment" :checker ruby-rubocop) '(3 nil warning "Person assumes too much for instance variable '@name'" :id "InstanceVariableAssumption" :checker ruby-reek) '(3 1 info "Missing top-level class documentation comment." :id "Style/Documentation" :checker ruby-rubocop) '(5 5 warning "Useless assignment to variable - `arr`." :id "Lint/UselessAssignment" :checker ruby-rubocop) '(5 11 info "Use `%i` or `%I` for an array of symbols." :id "[Correctable] Style/SymbolArray" :checker ruby-rubocop) '(6 10 info "Prefer single-quoted strings when you don't need string interpolation or special symbols." :id "[Correctable] Style/StringLiterals" :checker ruby-rubocop) '(10 5 info "Use a guard clause (`return unless true`) instead of wrapping the code inside a conditional expression." :id "Style/GuardClause":checker ruby-rubocop) '(10 5 info "Favor modifier `if` usage when having a single-line body. Another good alternative is the usage of control flow `&&`/`||`." :id "[Correctable] Style/IfUnlessModifier" :checker ruby-rubocop) '(10 8 warning "Literal `true` appeared as a condition." :id "Lint/LiteralAsCondition" :checker ruby-rubocop) '(10 13 info "Do not use `then` for multi-line `if`." :id "[Correctable] Style/MultilineIfThen" :checker ruby-rubocop) '(11 7 info "Redundant `return` detected." :id "[Correctable] Style/RedundantReturn" :checker ruby-rubocop))) (flycheck-ert-def-checker-test ruby-reek ruby warnings (let ((flycheck-disabled-checkers '(ruby-rubocop))) (flycheck-ert-should-syntax-check "language/ruby/warnings.rb" 'ruby-mode '(3 nil warning "Person assumes too much for instance variable '@name'" :id "InstanceVariableAssumption" :checker ruby-reek)))) (flycheck-ert-def-checker-test ruby ruby warnings (let ((flycheck-disabled-checkers '(ruby-rubocop ruby-reek))) (flycheck-ert-should-syntax-check "language/ruby/warnings.rb" 'ruby-mode '(5 nil warning "assigned but unused variable - arr" :checker ruby) '(16 nil warning "possibly useless use of == in void context" :checker ruby)))) (flycheck-ert-def-checker-test ruby-jruby ruby nil (let ((flycheck-disabled-checkers '(ruby-rubocop ruby-reek ruby))) (flycheck-ert-should-syntax-check "language/ruby/warnings.rb" 'ruby-mode '(16 nil warning "Useless use of == in void context." :checker ruby-jruby)))) (defun flycheck-ert-cargo-clean (manifest-path) "Call `cargo clean` on the manifest at MANIFEST-PATH. The manifest path is relative to `flycheck-test-resources-directory'." ;; `cargo` builds binaries when we call the checker, so we need to start from ;; a clean directory each time we want to test. (call-process "cargo" nil nil nil "clean" "--manifest-path" (expand-file-name manifest-path flycheck-test-resources-directory))) (flycheck-ert-def-checker-test rust-cargo rust warning (let ((flycheck-disabled-checkers '(rust)) (flycheck-rust-crate-type "bin") (flycheck-rust-binary-name "flycheck-test")) (flycheck-ert-cargo-clean "language/rust/flycheck-test/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/warnings.rs" 'rust-mode '(3 4 warning "function is never used: `main`" :checker rust-cargo :id "dead_code" :group 1 :end-line 3 :end-column 8) '(3 4 info "`#[warn(dead_code)]` on by default" :checker rust-cargo :id "dead_code" :group 1 :end-line 3 :end-column 8) '(4 9 warning "unused variable: `x`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 10) '(4 9 info "if this is intentional, prefix it with an underscore: `_x`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 10)))) (flycheck-ert-def-checker-test rust-cargo rust default-target (let ((flycheck-disabled-checkers '(rust)) (flycheck-rust-crate-type nil) (flycheck-rust-binary-name nil)) (flycheck-ert-cargo-clean "language/rust/flycheck-test/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/warnings.rs" 'rust-mode '(3 4 warning "function is never used: `main`" :checker rust-cargo :id "dead_code" :group 1 :end-line 3 :end-column 8) '(3 4 info "`#[warn(dead_code)]` on by default" :checker rust-cargo :id "dead_code" :group 1 :end-line 3 :end-column 8) '(4 9 warning "unused variable: `x`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 10) '(4 9 info "if this is intentional, prefix it with an underscore: `_x`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 10)))) (flycheck-ert-def-checker-test rust-cargo rust lib-main (let ((flycheck-disabled-checkers '(rust)) (flycheck-rust-crate-type "bin") (flycheck-rust-binary-name "lib-main")) (flycheck-ert-should-syntax-check "language/rust/lib-main/src/main.rs" 'rust-mode `(3 12 error "cannot find value `zorglub` in this scope (not found in this scope)" :checker rust-cargo :id "E0425" :filename ,(flycheck-ert-resource-filename "language/rust/lib-main/src/lib.rs") :group 1 :end-line 3 :end-column 19)))) (flycheck-ert-def-checker-test rust-cargo rust conventional-layout (let ((flycheck-disabled-checkers '(rust))) (let ((flycheck-rust-crate-type "lib")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/src/lib.rs" 'rust-mode '(3 4 warning "function is never used: `foo_lib`" :checker rust-cargo :id "dead_code" :group 1 :end-line 3 :end-column 11) '(6 17 warning "unused variable: `foo_lib_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 6 :end-column 29) '(6 17 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 2 :end-line 6 :end-column 29) '(6 17 info "if this is intentional, prefix it with an underscore: `_foo_lib_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 6 :end-column 29))) (let ((flycheck-rust-crate-type "lib")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/src/a.rs" 'rust-mode '(1 4 warning "function is never used: `foo_a`" :checker rust-cargo :id "dead_code" :group 1 :end-line 1 :end-column 9) '(1 4 info "`#[warn(dead_code)]` on by default" :checker rust-cargo :id "dead_code" :group 1 :end-line 1 :end-column 9) '(4 17 warning "unused variable: `foo_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 27) '(4 17 info "if this is intentional, prefix it with an underscore: `_foo_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 27))) (let ((flycheck-rust-crate-type "bin") (flycheck-rust-binary-name "cargo-targets")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/src/main.rs" 'rust-mode '(1 17 warning "unused variable: `foo_main`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(1 17 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(1 17 info "if this is intentional, prefix it with an underscore: `_foo_main`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(4 17 warning "unused variable: `foo_main_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 30) '(4 17 info "if this is intentional, prefix it with an underscore: `_foo_main_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 30))) (let ((flycheck-rust-crate-type "bin") (flycheck-rust-binary-name "a")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/src/bin/a.rs" 'rust-mode '(1 17 warning "unused variable: `foo_bin_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 26) '(1 17 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 26) '(1 17 info "if this is intentional, prefix it with an underscore: `_foo_bin_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 26) '(4 17 warning "unused variable: `foo_bin_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 31) '(4 17 info "if this is intentional, prefix it with an underscore: `_foo_bin_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 31))) (let ((flycheck-rust-crate-type "bench") (flycheck-rust-binary-name "a")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/benches/a.rs" 'rust-mode '(1 17 warning "unused variable: `foo_bench_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 28) '(1 17 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 28) '(1 17 info "if this is intentional, prefix it with an underscore: `_foo_bench_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 28) '(4 17 warning "unused variable: `foo_bench_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 33) '(4 17 info "if this is intentional, prefix it with an underscore: `_foo_bench_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 33))) (let ((flycheck-rust-crate-type "test") (flycheck-rust-binary-name "a")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/tests/a.rs" 'rust-mode '(2 16 warning "unused variable: `foo_test_a_test`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 31) '(2 16 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 31) '(2 16 info "if this is intentional, prefix it with an underscore: `_foo_test_a_test`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 31) '(4 4 warning "function is never used: `foo_test_a`" :checker rust-cargo :id "dead_code" :group 2 :end-line 4 :end-column 14) '(4 4 info "`#[warn(dead_code)]` on by default" :checker rust-cargo :id "dead_code" :group 2 :end-line 4 :end-column 14))) (let ((flycheck-rust-crate-type "example") (flycheck-rust-binary-name "a")) (flycheck-ert-cargo-clean "language/rust/cargo-targets/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/cargo-targets/examples/a.rs" 'rust-mode '(1 17 warning "unused variable: `foo_ex_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(1 17 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(1 17 info "if this is intentional, prefix it with an underscore: `_foo_ex_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 1 :end-column 25) '(4 17 warning "unused variable: `foo_ex_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 30) '(4 17 info "if this is intentional, prefix it with an underscore: `_foo_ex_a_test`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 4 :end-column 30))))) (flycheck-ert-def-checker-test rust-cargo rust workspace-subcrate (let ((flycheck-disabled-checkers '(rust)) (flycheck-rust-crate-type "lib") (flycheck-rust-check-tests t)) (flycheck-ert-cargo-clean "language/rust/workspace/crate1/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/workspace/crate1/src/lib.rs" 'rust-mode '(2 7 warning "unused variable: `a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 8) '(2 7 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 8) '(2 7 info "if this is intentional, prefix it with an underscore: `_a`" :checker rust-cargo :id "unused_variables" :group 1 :end-line 2 :end-column 8)))) (flycheck-ert-def-checker-test rust-cargo rust dev-dependencies (let ((flycheck-disabled-checkers '(rust)) (flycheck-rust-crate-type "lib") (flycheck-rust-check-tests t)) (flycheck-ert-cargo-clean "language/rust/dev-deps/Cargo.toml") (flycheck-ert-should-syntax-check "language/rust/dev-deps/src/lib.rs" 'rust-mode '(2 1 warning "unused `#[macro_use]` import" :checker rust-cargo :id "unused_imports" :group 1 :end-line 2 :end-column 13) '(2 1 info "`#[warn(unused_imports)]` on by default" :checker rust-cargo :id "unused_imports" :group 1 :end-line 2 :end-column 13) '(8 9 warning "unused variable: `foo`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 8 :end-column 12) '(8 9 info "`#[warn(unused_variables)]` on by default" :checker rust-cargo :id "unused_variables" :group 2 :end-line 8 :end-column 12) '(8 9 info "if this is intentional, prefix it with an underscore: `_foo`" :checker rust-cargo :id "unused_variables" :group 2 :end-line 8 :end-column 12)))) (flycheck-ert-def-checker-test rust rust syntax-error (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/syntax-error.rs" 'rust-mode '(4 5 error "cannot find value `bla` in this scope (not found in this scope)" :checker rust :id "E0425" :group 1 :end-line 4 :end-column 8)))) (flycheck-ert-def-checker-test rust rust type-error (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/multiline-error.rs" 'rust-mode '(7 9 error "mismatched types (expected `u8`, found `i8`)" :checker rust :id "E0308" :group 1 :end-line 7 :end-column 10) '(7 9 info "you can convert an `i8` to a `u8` and panic if the converted value doesn't fit: `i.try_into().unwrap()`" :checker rust :id "E0308" :group 1 :end-line 7 :end-column 10)))) (flycheck-ert-def-checker-test rust rust warning (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/warnings.rs" 'rust-mode '(4 9 warning "unused variable: `x`" :checker rust :id "unused_variables" :group 1 :end-line 4 :end-column 10) '(4 9 info "`#[warn(unused_variables)]` on by default" :checker rust :id "unused_variables" :group 1 :end-line 4 :end-column 10) '(4 9 info "if this is intentional, prefix it with an underscore: `_x`" :checker rust :id "unused_variables" :group 1 :end-line 4 :end-column 10)))) (flycheck-ert-def-checker-test rust rust note-and-help (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/note-and-help.rs" 'rust-mode '(10 9 info "move occurs because `_x` has type `NonPOD`, which does not implement the `Copy` trait" :checker rust :id "E0382" :group 1 :end-line 10 :end-column 11) '(11 14 info "value moved here" :checker rust :id "E0382" :group 1 :end-line 11 :end-column 16) '(12 14 error "use of moved value: `_x` (value used here after move)" :checker rust :id "E0382" :group 1 :end-line 12 :end-column 16)))) (flycheck-ert-def-checker-test rust rust crate-root-not-set (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/importing.rs" 'rust-mode '(1 5 error "failed to resolve: there are too many leading `super` keywords (there are too many leading `super` keywords)" :checker rust :id "E0433" :group 2 :end-line 1 :end-column 10) '(4 24 error "failed to resolve: use of undeclared crate or module `imported` (use of undeclared crate or module `imported`)" :checker rust :id "E0433" :group 3 :end-line 4 :end-column 32)))) (flycheck-ert-def-checker-test rust rust macro-error (let ((flycheck-disabled-checkers '(rust-cargo))) (flycheck-ert-should-syntax-check "language/rust/flycheck-test/src/macro-error.rs" 'rust-mode '(2 13 error "1 positional argument in format string, but no arguments were given" :checker rust :group 1 :end-line 2 :end-column 15)))) (flycheck-ert-def-checker-test sass sass nil (let ((flycheck-disabled-checkers '(sass-stylelint sass/scss-sass-lint))) (flycheck-ert-should-syntax-check "language/sass/error.sass" 'sass-mode '(5 nil error "Inconsistent indentation: 3 spaces were used for indentation, but the rest of the document was indented using 2 spaces." :checker sass)))) (flycheck-ert-def-checker-test sass sass warning (let ((flycheck-disabled-checkers '(sass-stylelint sass/scss-sass-lint))) (flycheck-ert-should-syntax-check "language/sass/warning.sass" 'sass-mode '(2 nil warning "this is deprecated" :checker sass)))) (flycheck-ert-def-checker-test scala scala nil (flycheck-ert-should-syntax-check "language/scala/syntax-error.scala" 'scala-mode '(3 nil error "identifier expected but '{' found." :checker scala))) (flycheck-ert-def-checker-test scala-scalastyle scala error (let ((flycheck-scalastylerc "scalastyle.xml")) (flycheck-ert-should-syntax-check "language/scala/style-error.scala" 'scala-mode '(6 5 error "Don't use println" :checker scala-scalastyle)))) (flycheck-ert-def-checker-test scala-scalastyle scala warning (let ((flycheck-scalastylerc "scalastyle.xml")) (flycheck-ert-should-syntax-check "language/scala/style-warning.scala" 'scala-mode '(5 9 warning "Redundant braces after class definition" :checker scala-scalastyle)))) (defvar geiser-impl--implementation) (defun flycheck/chicken-mode () "Enable Scheme and Geiser mode for Chicken scheme." (interactive) (scheme-mode) (setq-local geiser-impl--implementation 'chicken) (geiser-mode)) (flycheck-ert-def-checker-test scheme-chicken scheme error-no-line-number (skip-unless (version<= "25.1" emacs-version)) (flycheck-ert-should-syntax-check "language/chicken/error-no-line-number.scm" 'flycheck/chicken-mode '(0 nil error "(cddr) during expansion of (for-each ...) - bad argument type: ()\n\n\tCall history:\n\n\t\t (##core#begin (for-each))\n\t\t (for-each)\t<--" :checker scheme-chicken))) (flycheck-ert-def-checker-test scheme-chicken scheme syntax-error (skip-unless (version<= "25.1" emacs-version)) (flycheck-ert-should-syntax-check "language/chicken/syntax-error.scm" 'flycheck/chicken-mode '(1 nil error "not enough arguments\n\n\t(define)\n\n\tExpansion history:\n\n\t\t (##core#begin (define))\n\t\t (define)\t<--" :checker scheme-chicken))) (flycheck-ert-def-checker-test scheme-chicken scheme syntax-error-no-line-number (skip-unless (version<= "25.1" emacs-version)) (flycheck-ert-should-syntax-check "language/chicken/syntax-error-no-line-number.scm" 'flycheck/chicken-mode '(0 nil error "illegal atomic form\n\n\t()\n\n\tExpansion history:\n\n\t\t (##core#begin ())\t<--" :checker scheme-chicken))) (flycheck-ert-def-checker-test scheme-chicken scheme syntax-read-error (skip-unless (version<= "25.1" emacs-version)) (flycheck-ert-should-syntax-check "language/chicken/syntax-read-error.scm" 'flycheck/chicken-mode '(1 nil error "invalid sharp-sign read syntax: #\\n" :checker scheme-chicken))) (flycheck-ert-def-checker-test scss-lint scss nil (let ((flycheck-scss-lintrc "scss-lint.yml")) (flycheck-ert-should-syntax-check "language/scss/lint-error.scss" 'scss-mode '(1 1 error "Avoid using id selectors" :checker scss-lint :id "IdSelector") '(3 16 warning "Color `red` should be written in hexadecimal form as `#ff0000`" :checker scss-lint :id "ColorKeyword")))) (flycheck-ert-def-checker-test scss-lint scss syntax-error (flycheck-ert-should-syntax-check "language/scss/error.scss" 'scss-mode '(3 1 error "Syntax Error: Invalid CSS after \"... c olor: red\": expected \"{\", was \";\"" :checker scss-lint :id "Syntax"))) (flycheck-ert-def-checker-test scss scss nil (let ((flycheck-disabled-checkers '(scss-lint scss-stylelint sass/scss-sass-lint))) (flycheck-ert-should-syntax-check "language/scss/error.scss" 'scss-mode '(3 nil error "Invalid CSS after \"... c olor: red\": expected \"{\", was \";\"" :checker scss)))) (flycheck-ert-def-checker-test scss scss warning (let ((flycheck-disabled-checkers '(scss-lint scss-stylelint sass/scss-sass-lint))) (flycheck-ert-should-syntax-check "language/scss/warning.scss" 'scss-mode '(2 nil warning ".container is deprecated" :checker scss)))) (flycheck-ert-def-checker-test sh-bash (sh sh-bash) nil (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/sh/bash-syntax-error.bash" 'sh-mode '(5 nil error "syntax error near unexpected token `fi'" :checker sh-bash) '(5 nil error "`fi'" :checker sh-bash)))) (flycheck-ert-def-checker-test sh-posix-dash (sh sh-posix) nil (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/sh/posix-syntax-error.sh" 'sh-mode '(3 nil error "Syntax error: \"(\" unexpected" :checker sh-posix-dash)))) (flycheck-ert-def-checker-test sh-posix-bash (sh sh-posix) nil (let ((flycheck-disabled-checkers '(sh-posix-dash)) (inhibit-message t)) (flycheck-ert-should-syntax-check "language/sh/posix-syntax-error.sh" 'sh-mode '(3 nil error "syntax error near unexpected token `('" :checker sh-posix-bash) '(3 nil error "`cat <(echo blah)'" :checker sh-posix-bash)))) (flycheck-ert-def-checker-test sh-zsh (sh sh-zsh) nil (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/sh/zsh-syntax-error.zsh" 'sh-mode '(5 nil error "parse error near `fi'" :checker sh-zsh)))) (flycheck-ert-def-checker-test sh-shellcheck sh nil :tags '(checkstyle-xml) (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/sh/shellcheck.sh" 'sh-mode '(2 5 warning "Tilde does not expand in quotes. Use $HOME." :checker sh-shellcheck :id "SC2088") '(3 7 error "Double quote array expansions to avoid re-splitting elements." :checker sh-shellcheck :id "SC2068") '(4 8 warning "Declare and assign separately to avoid masking return values." :checker sh-shellcheck :id "SC2155") '(4 11 info "Use $(...) notation instead of legacy backticked `...`." :checker sh-shellcheck :id "SC2006") '(4 12 info "which is non-standard. Use builtin 'command -v' instead." :checker sh-shellcheck :id "SC2230")))) (flycheck-ert-def-checker-test slim slim nil (flycheck-ert-should-syntax-check "language/slim.slim" 'slim-mode `(2 1 error "Unexpected indentation" :checker slim))) (flycheck-ert-def-checker-test sqlint sql nil (flycheck-ert-should-syntax-check "language/sql.sql" 'sql-mode `(1 15 error "unterminated quoted string at or near \"';\n \"" :checker sql-sqlint))) (flycheck-ert-def-checker-test systemd-analyze systemd nil (flycheck-ert-should-syntax-check "language/systemd-analyze-test.service" 'systemd-mode '(0 nil error "Service has no ExecStart=, ExecStop=, or SuccessAction=. Refusing." :checker systemd-analyze) '(3 nil error "Invalid URL, ignoring: foo://bar" :checker systemd-analyze) '(5 nil error "ListenStream= references a path below legacy directory /var/run/, updating /var/run/dbus/system_bus_socket → /run/dbus/system_bus_socket; please update the unit file accordingly." :filename "/lib/systemd/system/dbus.socket" :checker systemd-analyze) '(6 nil error "Unknown key name 'ExecSmart' in section 'Service', ignoring." :checker systemd-analyze) '(8 nil error "Unknown section 'Dog'. Ignoring." :checker systemd-analyze))) (flycheck-ert-def-checker-test tex-chktex (tex latex) nil (flycheck-ert-should-syntax-check "language/tex.tex" 'latex-mode '(5 29 warning "Intersentence spacing (`\\@') should perhaps be used." :id "13" :checker tex-chktex))) (flycheck-ert-def-checker-test tex-lacheck (tex latex) nil (let ((flycheck-disabled-checkers '(tex-chktex))) (flycheck-ert-should-syntax-check "language/tex.tex" 'latex-mode '(5 nil warning "missing `\\@' before `.' in \"GNU.\"" :checker tex-lacheck) '(7 nil warning "possible unwanted space at \"{\"" :checker tex-lacheck)))) (flycheck-ert-def-checker-test texinfo texinfo nil (flycheck-ert-should-syntax-check "language/texinfo.texi" 'texinfo-mode '(3 nil warning "@settitle missing argument" :checker texinfo) '(7 nil error "unknown command `bold'" :checker texinfo) '(7 nil error "misplaced {" :checker texinfo) '(7 nil error "misplaced }" :checker texinfo) '(9 nil warning "printindex before document beginning: @printindex cp" :checker texinfo))) (flycheck-ert-def-checker-test textlint (text markdown) nil (let ((flycheck-disabled-checkers '(proselint markdown-markdownlint-cli markdown-markdownlint-cli2 markdown-mdl)) (flycheck-textlint-config "language/text/textlintrc.json")) (flycheck-ert-should-syntax-check "language/text/text.txt" '(text-mode markdown-mode) '(1 7 error "\"very\" is a weasel word and can weaken meaning" :id "write-good" :checker textlint)))) (flycheck-ert-def-checker-test typescript-tslint typescript nil (let ((flycheck-disabled-checkers '(javascript-eslint))) (flycheck-ert-should-syntax-check "language/typescript/sample.ts" 'typescript-mode '(2 23 warning "Module 'chai' is not listed as dependency in package.json" :checker typescript-tslint :id "no-implicit-dependencies" :end-line 2 :end-column 29) '(5 3 warning "Forbidden 'var' keyword, use 'let' or 'const' instead" :checker typescript-tslint :id "no-var-keyword" :end-line 5 :end-column 6) '(6 15 warning "Missing semicolon" :checker typescript-tslint :id "semicolon" :end-line 6 :end-column 15)))) (flycheck-ert-def-checker-test verilog-verilator verilog error (flycheck-ert-should-syntax-check "language/verilog/verilator_error.v" 'verilog-mode '(4 nil error "Unsupported: $fopen with multichannel descriptor. Add ,\"w\" as second argument to open a file descriptor." :checker verilog-verilator))) (flycheck-ert-def-checker-test verilog-verilator verilog warning (flycheck-ert-should-syntax-check "language/verilog/verilator_warning.v" 'verilog-mode '(2 nil warning "Signal is not driven, nor used: 'val'" :checker verilog-verilator :id "UNUSED"))) (flycheck-ert-def-checker-test vhdl-ghdl vhdl error (flycheck-ert-should-syntax-check "language/vhdl.vhd" 'vhdl-mode '(4 1 error "';' is expected instead of ''" :checker vhdl-ghdl))) (flycheck-ert-def-checker-test xml-xmlstarlet xml nil (let ((inhibit-message t)) (flycheck-ert-should-syntax-check "language/xml.xml" 'nxml-mode '(4 10 error "Opening and ending tag mismatch: spam line 3 and with" :checker xml-xmlstarlet)))) (flycheck-ert-def-checker-test xml-xmllint xml nil (let ((flycheck-disabled-checkers '(xml-xmlstarlet)) (inhibit-message t)) (flycheck-ert-should-syntax-check "language/xml.xml" 'nxml-mode '(4 nil error "parser error : Opening and ending tag mismatch: spam line 3 and with" :checker xml-xmllint) '(5 nil error "parser error : Extra content at the end of the document" :checker xml-xmllint)))) (flycheck-ert-def-checker-test yaml-jsyaml yaml nil (flycheck-ert-should-syntax-check "language/yaml.yaml" 'yaml-mode '(4 5 error "bad indentation of a mapping entry" :checker yaml-jsyaml))) (flycheck-ert-def-checker-test yaml-ruby yaml nil (let ((flycheck-disabled-checkers '(yaml-jsyaml))) (flycheck-ert-should-syntax-check "language/yaml.yaml" 'yaml-mode '(4 5 error "mapping values are not allowed in this context" :checker yaml-ruby)))) (flycheck-ert-def-checker-test yaml-yamllint yaml nil (let ((flycheck-disabled-checkers '(yaml-yamlyaml))) (flycheck-ert-should-syntax-check "language/yaml.yaml" 'yaml-mode '(3 1 warning "missing document start "---" (document-start)" :checker yaml-yamllint)) (flycheck-ert-should-syntax-check "language/yaml.yaml" 'yaml-mode '(4 5 error "syntax error: mapping values are not allowed here" :checker yaml-yamllint)))) (flycheck-ert-def-checker-test jsonnet-static jsonnet nil (flycheck-ert-should-syntax-check "language/jsonnet/static_error.jsonnet" 'jsonnet-mode '(1 23 "Not a unary operator: =" :checker jsonnet))) (flycheck-ert-def-checker-test jsonnet-runtime jsonnet nil (flycheck-ert-should-syntax-check "language/jsonnet/runtime_error.jsonnet" 'jsonnet-mode '(2 6 "Field does not exist: flat" :checker jsonnet :end-line 2 :end-column 14))) (flycheck-ert-initialize flycheck-test-resources-directory) (provide 'flycheck-test) ;; Local Variables: ;; coding: utf-8 ;; indent-tabs-mode: nil ;; End: ;;; flycheck-test.el ends here flycheck-35.0/test/init.el000066400000000000000000000127511500215546300155040ustar00rootroot00000000000000;;; init.el --- Flycheck: Init file for testing -*- lexical-binding: t; -*- ;; Copyright (C) 2017 Flycheck contributors ;; Copyright (C) 2015-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; Maintainer: Clément Pit-Claudel ;; fmdkdd ;; URL: https://www.flycheck.org ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Use with `emacs -Q -l test/init.el -f flycheck/init' to start a clean session ;; with only Flycheck present. ;; ;; Installs all dependencies of Flycheck to a temporary package directory, and ;; loads Flycheck. ;;; Code: (require 'package) (defconst flycheck/init-file (if load-in-progress load-file-name buffer-file-name) "The path of this file.") (defun flycheck/init () "Initialize a minimal Flycheck session. Install Flycheck and its dependencies into a separate package directory (init-elpa in the current directory) and enable Flycheck globally. Set some global customization options to get rid of some of the worst defaults of Emacs and create a half-way bearable Emacs session. Define a `demo' checker which can be used to demonstrate Flycheck in this file." (setq load-prefer-newer t) ; Don't load outdated bytecode (setq package-user-dir (expand-file-name "init-elpa" (file-name-directory flycheck/init-file)) package-check-signature nil) (add-to-list 'package-archives '("MELPA" . "https://stable.melpa.org/packages/")) (package-initialize) (let* ((source-dir (locate-dominating-file flycheck/init-file "flycheck.el")) (flycheck-el (expand-file-name "flycheck.el" source-dir))) ;; Install Flycheck to bring its dependencies in (unless (package-installed-p 'flycheck) (package-refresh-contents) (package-install-file flycheck-el)) (load flycheck-el)) (require 'flycheck) (global-flycheck-mode) ;; Some dummy code for warnings which we use to demonstrate Flycheck, see ;; `demo' checker below. (list 'an-info-here 'a-warning-here 'an-error-here) ;; Some little convenience, to this Emacs session at least half way bearable (require 'ido) (ido-mode t) (setq ido-enable-flex-matching t) ;; Get rid of all the silly UI clutter of a default Emacs session and opt out ;; of all the stupid startup and license messages (tool-bar-mode -1) (blink-cursor-mode -1) (setq ring-bell-function #'ignore inhibit-startup-screen t initial-scratch-message "") (fset 'yes-or-no-p #'y-or-n-p) (fset 'display-startup-echo-area-message #'ignore) ;; Improve OS X key behaviour (when (eq system-type 'darwin) (setq mac-option-modifier 'meta ; Option is simply the natural Meta mac-command-modifier 'meta ; But command is a lot easier to hit mac-right-command-modifier 'left mac-right-option-modifier 'none ; Keep right option for accented input mac-function-modifier 'hyper)) (flycheck-define-generic-checker 'demo "A demo syntax checker." :start (lambda (checker callback) (funcall callback 'finished (save-excursion (goto-char (point-min)) (search-forward "an-info-here") (list (flycheck-error-new-at (line-number-at-pos) 10 'info "An info here" :checker checker) (flycheck-error-new-at (+ 1 (line-number-at-pos)) 10 'warning "A warning here" :checker checker) (flycheck-error-new-at (+ 2 (line-number-at-pos)) 10 'error "A error here" :checker checker))))) :modes 'emacs-lisp-mode)) (defun flycheck-prepare-screenshot (&optional hide-cursor) "Prepare this Emacs session for a screenshot. If HIDE-CURSOR is non-nil or if a prefix arg is given hide the cursor, otherwise keep it." (interactive "P") ;; Reduce UI and disable cursor (menu-bar-mode -1) (scroll-bar-mode -1) (setq-default truncate-lines t) (when hide-cursor (setq-default cursor-type nil)) (set-frame-font "Source Code Pro-13") (set-frame-size (selected-frame) 750 560 'pixelwise) ;; Tuck the error list to the bottom side window at a fixed height (add-to-list 'display-buffer-alist `(,(rx bos "*Flycheck errors*") (display-buffer-reuse-window display-buffer-in-side-window) (side . bottom) (reusable-frames . visible) (window-height . 0.33)))) ;; Local Variables: ;; no-byte-compile: t ;; End: ;;; init.el ends here flycheck-35.0/test/resources/000077500000000000000000000000001500215546300162235ustar00rootroot00000000000000flycheck-35.0/test/resources/automatic-check-dummy.el000066400000000000000000000000571500215546300227410ustar00rootroot00000000000000A dummy file to test automatic syntax checking flycheck-35.0/test/resources/bin/000077500000000000000000000000001500215546300167735ustar00rootroot00000000000000flycheck-35.0/test/resources/bin/dummy-emacs000077500000000000000000000004161500215546300211430ustar00rootroot00000000000000#!/usr/bin/python3 # -*- coding: utf-8; -*- from __future__ import print_function import sys import re filename = sys.argv[-1] print('{0}:17:4:Error: t is not true!'.format(filename)) print('{0}:19:11:Warning: This is a stupid message'.format(filename)) sys.exit(1) flycheck-35.0/test/resources/dummy-elpa/000077500000000000000000000000001500215546300202755ustar00rootroot00000000000000flycheck-35.0/test/resources/dummy-elpa/dummy-package-0.1/000077500000000000000000000000001500215546300233155ustar00rootroot00000000000000flycheck-35.0/test/resources/dummy-elpa/dummy-package-0.1/dummy-package-autoloads.el000066400000000000000000000011041500215546300303500ustar00rootroot00000000000000;;; dummy-package-autoloads.el --- automatically extracted autoloads ;; ;;; Code: ;;;### (autoloads nil "dummy-package" "dummy-package.el" (20978 39905 ;;;;;; 0 0)) ;;; Generated autoloads from dummy-package.el (autoload 'dummy-package-foo "dummy-package" "\ \(fn)" nil nil) ;;;*** ;;;### (autoloads nil nil ("dummy-package-pkg.el") (20978 39909 438930 ;;;;;; 0)) ;;;*** (provide 'dummy-package-autoloads) ;; Local Variables: ;; version-control: never ;; no-byte-compile: t ;; no-update-autoloads: t ;; coding: utf-8 ;; End: ;;; dummy-package-autoloads.el ends here flycheck-35.0/test/resources/dummy-elpa/dummy-package-0.1/dummy-package-pkg.el000066400000000000000000000000741500215546300271430ustar00rootroot00000000000000(define-package "dummy-package" "0.1" "Dummy package" 'nil) flycheck-35.0/test/resources/dummy-elpa/dummy-package-0.1/dummy-package.el000066400000000000000000000001401500215546300263560ustar00rootroot00000000000000;;;###autoload (defun dummy-package-foo () (message "Hello world")) (provide 'dummy-package) flycheck-35.0/test/resources/global-mode-dummy.el000066400000000000000000000001031500215546300220520ustar00rootroot00000000000000A dummy file to test whether the global mode can be enabled or not flycheck-35.0/test/resources/language/000077500000000000000000000000001500215546300200065ustar00rootroot00000000000000flycheck-35.0/test/resources/language/ada/000077500000000000000000000000001500215546300205335ustar00rootroot00000000000000flycheck-35.0/test/resources/language/ada/hello.adb000066400000000000000000000003451500215546300223100ustar00rootroot00000000000000with Ada.Text_IO; with Ada.Command_Line; procedure Hello is package IO renames Ada.Text_IO; Name : String := Ada.Command_Line.Argument (1); begin pragma Foo; IO.Put_Line("Hello, world!"); IO.New_Line; end Hello; flycheck-35.0/test/resources/language/ada/syntaxerror.adb000066400000000000000000000002341500215546300236020ustar00rootroot00000000000000with Ada.Text_IO; with Ada.Command_Line; procedure SyntaxError is package IO renames Ada.Text_IO; begin IO.Put_Line("Hello, world!") end SyntaxErro; flycheck-35.0/test/resources/language/asciidoc.adoc000066400000000000000000000002031500215546300224070ustar00rootroot00000000000000[paragraph] {empty} `---`--- 1 2 3 4 5 6 -------- [format="csv", width="%60%", cols="4"] |====== 1,2,3,4 a,b,c,d A,B,C,D |====== flycheck-35.0/test/resources/language/asciidoctor.adoc000066400000000000000000000000571500215546300231430ustar00rootroot00000000000000= Document :doctype: article === P1 endif::[]flycheck-35.0/test/resources/language/awk/000077500000000000000000000000001500215546300205705ustar00rootroot00000000000000flycheck-35.0/test/resources/language/awk/syntax-error.awk000066400000000000000000000000051500215546300237440ustar00rootroot00000000000000 x=| flycheck-35.0/test/resources/language/bazel/000077500000000000000000000000001500215546300211035ustar00rootroot00000000000000flycheck-35.0/test/resources/language/bazel/BUILD.bazel-error000066400000000000000000000000501500215546300241030ustar00rootroot00000000000000cc_binary!( name = "hello-world", ) flycheck-35.0/test/resources/language/bazel/BUILD.bazel-warning000066400000000000000000000000141500215546300244170ustar00rootroot00000000000000foo = "bar" flycheck-35.0/test/resources/language/bazel/MODULE.bazel-error000066400000000000000000000000501500215546300242310ustar00rootroot00000000000000cc_binary!( name = "hello-world", ) flycheck-35.0/test/resources/language/bazel/MODULE.bazel-warning000066400000000000000000000001061500215546300245470ustar00rootroot00000000000000cc_binary( name = "hello-world", srcs = ["hello-world.cc"], ) flycheck-35.0/test/resources/language/bazel/WORKSPACE.bazel-error000066400000000000000000000000501500215546300246020ustar00rootroot00000000000000cc_binary!( name = "hello-world", ) flycheck-35.0/test/resources/language/bazel/WORKSPACE.bazel-warning000066400000000000000000000000141500215546300251160ustar00rootroot00000000000000foo = "bar" flycheck-35.0/test/resources/language/bazel/rules.bzl-error000066400000000000000000000000501500215546300240700ustar00rootroot00000000000000cc_binary!( name = "hello-world", ) flycheck-35.0/test/resources/language/bazel/rules.bzl-warning000066400000000000000000000001061500215546300244060ustar00rootroot00000000000000cc_binary( name = "hello-world", srcs = ["hello-world.cc"], ) flycheck-35.0/test/resources/language/c_c++/000077500000000000000000000000001500215546300206605ustar00rootroot00000000000000flycheck-35.0/test/resources/language/c_c++/error.cpp000066400000000000000000000001531500215546300225140ustar00rootroot00000000000000template void foo(T& x) { x.bar(); } struct A {}; void bar() { A a; foo(a); } #pragma nope flycheck-35.0/test/resources/language/c_c++/in-included-file.cpp000066400000000000000000000000451500215546300244730ustar00rootroot00000000000000class test {}; #include "warning.c" flycheck-35.0/test/resources/language/c_c++/include/000077500000000000000000000000001500215546300223035ustar00rootroot00000000000000flycheck-35.0/test/resources/language/c_c++/include/library.h000066400000000000000000000000311500215546300241120ustar00rootroot00000000000000#define FLYCHECK_LIBRARY flycheck-35.0/test/resources/language/c_c++/includes.c000066400000000000000000000000501500215546300226250ustar00rootroot00000000000000#include "local.h" #include flycheck-35.0/test/resources/language/c_c++/local.h000066400000000000000000000000271500215546300221220ustar00rootroot00000000000000#define FLYCHECK_LOCAL flycheck-35.0/test/resources/language/c_c++/style.cpp000066400000000000000000000003161500215546300225240ustar00rootroot00000000000000int f(int x) { int null = 0; int unused; // cppcheck-suppress unusedVariable int unused2; return x * 2 / null; } std::string foobar(const std::string foo) { return foo + "bar"; } flycheck-35.0/test/resources/language/c_c++/style2.cpp000066400000000000000000000001111500215546300225770ustar00rootroot00000000000000void f(int x) { int i = 0; if (x) { for ( ; i < 10; ++i) ; } } flycheck-35.0/test/resources/language/c_c++/warning.c000066400000000000000000000001731500215546300224720ustar00rootroot00000000000000#include int f(int x) { int unused; unsigned int y = 10; return x < y ? ++x : x; #warning } flycheck-35.0/test/resources/language/cfengine/000077500000000000000000000000001500215546300215645ustar00rootroot00000000000000flycheck-35.0/test/resources/language/cfengine/error.cf000066400000000000000000000001611500215546300232250ustar00rootroot00000000000000body common control { bundlesequence => { run }; } bundle agent run { nosuchpromisetype: "huh"; } flycheck-35.0/test/resources/language/cfengine/warning.cf000066400000000000000000000001631500215546300235430ustar00rootroot00000000000000body common control { host_licenses_paid => "2000"; bundlesequence => { run }; } bundle agent run { } flycheck-35.0/test/resources/language/chef/000077500000000000000000000000001500215546300207135ustar00rootroot00000000000000flycheck-35.0/test/resources/language/chef/recipes/000077500000000000000000000000001500215546300223455ustar00rootroot00000000000000flycheck-35.0/test/resources/language/chef/recipes/error.rb000066400000000000000000000007251500215546300240270ustar00rootroot00000000000000# FC002: Avoid string interpolation where not required package "mysql-server" do version "#{node['mysql']['version']}" action :install end # FC003: Check whether you are running with chef server before using server-specific features nodes = search(:node, "hostname:[* TO *] AND chef_environment:#{node.chef_environment}") # FC004: Use a service resource to start and stop services execute "start-tomcat" do command "/etc/init.d/tomcat6 start" action :run end flycheck-35.0/test/resources/language/chicken/000077500000000000000000000000001500215546300214125ustar00rootroot00000000000000flycheck-35.0/test/resources/language/chicken/error-no-line-number.scm000066400000000000000000000000141500215546300260670ustar00rootroot00000000000000(for-each ) flycheck-35.0/test/resources/language/chicken/syntax-error-no-line-number.scm000066400000000000000000000000031500215546300274110ustar00rootroot00000000000000() flycheck-35.0/test/resources/language/chicken/syntax-error.scm000066400000000000000000000000121500215546300245640ustar00rootroot00000000000000(define ) flycheck-35.0/test/resources/language/chicken/syntax-read-error.scm000066400000000000000000000000241500215546300255000ustar00rootroot00000000000000(define #number 42) flycheck-35.0/test/resources/language/coffee/000077500000000000000000000000001500215546300212355ustar00rootroot00000000000000flycheck-35.0/test/resources/language/coffee/error.coffee000066400000000000000000000001211500215546300235310ustar00rootroot00000000000000# An error/warning caused by throwing a string foo = () -> throw "Hello world"flycheck-35.0/test/resources/language/coffee/lint.json000066400000000000000000000014051500215546300230760ustar00rootroot00000000000000{ "no_tabs" : { "level" : "error" }, "no_trailing_whitespace" : { "level" : "error" }, "max_line_length" : { "value": 80, "level" : "error" }, "camel_case_classes" : { "level" : "error" }, "indentation" : { "value" : 2, "level" : "error" }, "no_implicit_braces" : { "level" : "ignore" }, "no_trailing_semicolons" : { "level" : "error" }, "no_plusplus" : { "level" : "ignore" }, "no_throwing_strings" : { "level" : "warn" }, "cyclomatic_complexity" : { "value" : 11, "level" : "ignore" }, "line_endings" : { "value" : "unix", "level" : "ignore" }, "no_implicit_parens" : { "level" : "ignore" }, "no_stand_alone_at" : { "level": "ignore" } } flycheck-35.0/test/resources/language/coffee/syntax-error.coffee000066400000000000000000000001221500215546300250560ustar00rootroot00000000000000# A syntax error caused by a missing quote foo = () -> bar "Hello world 1 + 1flycheck-35.0/test/resources/language/css/000077500000000000000000000000001500215546300205765ustar00rootroot00000000000000flycheck-35.0/test/resources/language/css/syntax-error.css000066400000000000000000000001131500215546300237600ustar00rootroot00000000000000/** A syntax error caused by a missing brace. */ h1 font-size: 100%; }flycheck-35.0/test/resources/language/css/warning.css000066400000000000000000000001241500215546300227520ustar00rootroot00000000000000/** A warning triggered by a qualified heading. */ .foo h1 { font-size: 100%; }flycheck-35.0/test/resources/language/cuda/000077500000000000000000000000001500215546300207225ustar00rootroot00000000000000flycheck-35.0/test/resources/language/cuda/syntax-error.cu000066400000000000000000000000321500215546300237230ustar00rootroot00000000000000int main(){ ac = 3; } flycheck-35.0/test/resources/language/cuda/syntax-warning.cu000066400000000000000000000000451500215546300242430ustar00rootroot00000000000000int main(){ int b; b = 3; }flycheck-35.0/test/resources/language/cwl/000077500000000000000000000000001500215546300205735ustar00rootroot00000000000000flycheck-35.0/test/resources/language/cwl/cwl.cwl000066400000000000000000000001661500215546300220720ustar00rootroot00000000000000cwlVersion: v1.0 class: CommandLineTool baseCommand: echo inputs: message: inputBinding: posi outputs: {} flycheck-35.0/test/resources/language/cwl/schema/000077500000000000000000000000001500215546300220335ustar00rootroot00000000000000flycheck-35.0/test/resources/language/cwl/schema/CommandLineTool.yml000066400000000000000000000735321500215546300256140ustar00rootroot00000000000000$base: "https://w3id.org/cwl/cwl#" $namespaces: cwl: "https://w3id.org/cwl/cwl#" sld: "https://w3id.org/cwl/salad#" $graph: - name: CommandLineToolDoc type: documentation doc: - | # Common Workflow Language (CWL) Command Line Tool Description, v1.0 This version: * https://w3id.org/cwl/v1.0/ Current version: * https://w3id.org/cwl/ - "\n\n" - {$include: contrib.md} - "\n\n" - | # Abstract A Command Line Tool is a non-interactive executable program that reads some input, performs a computation, and terminates after producing some output. Command line programs are a flexible unit of code sharing and reuse, unfortunately the syntax and input/output semantics among command line programs is extremely heterogeneous. A common layer for describing the syntax and semantics of programs can reduce this incidental complexity by providing a consistent way to connect programs together. This specification defines the Common Workflow Language (CWL) Command Line Tool Description, a vendor-neutral standard for describing the syntax and input/output semantics of command line programs. - {$include: intro.md} - | ## Introduction to v1.0 This specification represents the first full release from the CWL group. Since draft-3, version 1.0 introduces the following changes and additions: * The [Directory](#Directory) type. * Syntax simplifcations: denoted by the `map<>` syntax. Example: inputs contains a list of items, each with an id. Now one can specify a mapping of that identifier to the corresponding `CommandInputParamater`. ``` inputs: - id: one type: string doc: First input parameter - id: two type: int doc: Second input parameter ``` can be ``` inputs: one: type: string doc: First input parameter two: type: int doc: Second input parameter ``` * [InitialWorkDirRequirement](#InitialWorkDirRequirement): list of files and subdirectories to be present in the output directory prior to execution. * Shortcuts for specifying the standard [output](#stdout) and/or [error](#stderr) streams as a (streamable) File output. * [SoftwareRequirement](#SoftwareRequirement) for describing software dependencies of a tool. * The common `description` field has been renamed to `doc`. ## Errata Post v1.0 release changes to the spec. * 13 July 2016: Mark `baseCommand` as optional and update descriptive text. ## Purpose Standalone programs are a flexible and interoperable form of code reuse. Unlike monolithic applications, applications and analysis workflows which are composed of multiple separate programs can be written in multiple languages and execute concurrently on multiple hosts. However, POSIX does not dictate computer-readable grammar or semantics for program input and output, resulting in extremely heterogeneous command line grammar and input/output semantics among program. This is a particular problem in distributed computing (multi-node compute clusters) and virtualized environments (such as Docker containers) where it is often necessary to provision resources such as input files before executing the program. Often this gap is filled by hard coding program invocation and implicitly assuming requirements will be met, or abstracting program invocation with wrapper scripts or descriptor documents. Unfortunately, where these approaches are application or platform specific it creates a significant barrier to reproducibility and portability, as methods developed for one platform must be manually ported to be used on new platforms. Similarly it creates redundant work, as wrappers for popular tools must be rewritten for each application or platform in use. The Common Workflow Language Command Line Tool Description is designed to provide a common standard description of grammar and semantics for invoking programs used in data-intensive fields such as Bioinformatics, Chemistry, Physics, Astronomy, and Statistics. This specification defines a precise data and execution model for Command Line Tools that can be implemented on a variety of computing platforms, ranging from a single workstation to cluster, grid, cloud, and high performance computing platforms. - {$include: concepts.md} - {$include: invocation.md} - type: record name: EnvironmentDef doc: | Define an environment variable that will be set in the runtime environment by the workflow platform when executing the command line tool. May be the result of executing an expression, such as getting a parameter from input. fields: - name: envName type: string doc: The environment variable name - name: envValue type: [string, Expression] doc: The environment variable value - type: record name: CommandLineBinding extends: InputBinding doc: | When listed under `inputBinding` in the input schema, the term "value" refers to the the corresponding value in the input object. For binding objects listed in `CommandLineTool.arguments`, the term "value" refers to the effective value after evaluating `valueFrom`. The binding behavior when building the command line depends on the data type of the value. If there is a mismatch between the type described by the input schema and the effective value, such as resulting from an expression evaluation, an implementation must use the data type of the effective value. - **string**: Add `prefix` and the string to the command line. - **number**: Add `prefix` and decimal representation to command line. - **boolean**: If true, add `prefix` to the command line. If false, add nothing. - **File**: Add `prefix` and the value of [`File.path`](#File) to the command line. - **array**: If `itemSeparator` is specified, add `prefix` and the join the array into a single string with `itemSeparator` separating the items. Otherwise first add `prefix`, then recursively process individual elements. - **object**: Add `prefix` only, and recursively add object fields for which `inputBinding` is specified. - **null**: Add nothing. fields: - name: position type: int? doc: "The sorting key. Default position is 0." - name: prefix type: string? doc: "Command line prefix to add before the value." - name: separate type: boolean? doc: | If true (default), then the prefix and value must be added as separate command line arguments; if false, prefix and value must be concatenated into a single command line argument. - name: itemSeparator type: string? doc: | Join the array elements into a single string with the elements separated by by `itemSeparator`. - name: valueFrom type: - "null" - string - Expression jsonldPredicate: "cwl:valueFrom" doc: | If `valueFrom` is a constant string value, use this as the value and apply the binding rules above. If `valueFrom` is an expression, evaluate the expression to yield the actual value to use to build the command line and apply the binding rules above. If the inputBinding is associated with an input parameter, the value of `self` in the expression will be the value of the input parameter. When a binding is part of the `CommandLineTool.arguments` field, the `valueFrom` field is required. - name: shellQuote type: boolean? doc: | If `ShellCommandRequirement` is in the requirements for the current command, this controls whether the value is quoted on the command line (default is true). Use `shellQuote: false` to inject metacharacters for operations such as pipes. - type: record name: CommandOutputBinding extends: OutputBinding doc: | Describes how to generate an output parameter based on the files produced by a CommandLineTool. The output parameter is generated by applying these operations in the following order: - glob - loadContents - outputEval fields: - name: glob type: - "null" - string - Expression - type: array items: string doc: | Find files relative to the output directory, using POSIX glob(3) pathname matching. If an array is provided, find files that match any pattern in the array. If an expression is provided, the expression must return a string or an array of strings, which will then be evaluated as one or more glob patterns. Must only match and return files which actually exist. - name: loadContents type: - "null" - boolean jsonldPredicate: "cwl:loadContents" doc: | For each file matched in `glob`, read up to the first 64 KiB of text from the file and place it in the `contents` field of the file object for manipulation by `outputEval`. - name: outputEval type: - "null" - string - Expression doc: | Evaluate an expression to generate the output value. If `glob` was specified, the value of `self` must be an array containing file objects that were matched. If no files were matched, `self` must be a zero length array; if a single file was matched, the value of `self` is an array of a single element. Additionally, if `loadContents` is `true`, the File objects must include up to the first 64 KiB of file contents in the `contents` field. - name: CommandInputRecordField type: record extends: InputRecordField specialize: - specializeFrom: InputRecordSchema specializeTo: CommandInputRecordSchema - specializeFrom: InputEnumSchema specializeTo: CommandInputEnumSchema - specializeFrom: InputArraySchema specializeTo: CommandInputArraySchema - specializeFrom: InputBinding specializeTo: CommandLineBinding - name: CommandInputRecordSchema type: record extends: InputRecordSchema specialize: - specializeFrom: InputRecordField specializeTo: CommandInputRecordField - name: CommandInputEnumSchema type: record extends: InputEnumSchema specialize: - specializeFrom: InputBinding specializeTo: CommandLineBinding - name: CommandInputArraySchema type: record extends: InputArraySchema specialize: - specializeFrom: InputRecordSchema specializeTo: CommandInputRecordSchema - specializeFrom: InputEnumSchema specializeTo: CommandInputEnumSchema - specializeFrom: InputArraySchema specializeTo: CommandInputArraySchema - specializeFrom: InputBinding specializeTo: CommandLineBinding - name: CommandOutputRecordField type: record extends: OutputRecordField specialize: - specializeFrom: OutputRecordSchema specializeTo: CommandOutputRecordSchema - specializeFrom: OutputEnumSchema specializeTo: CommandOutputEnumSchema - specializeFrom: OutputArraySchema specializeTo: CommandOutputArraySchema - specializeFrom: OutputBinding specializeTo: CommandOutputBinding - name: CommandOutputRecordSchema type: record extends: OutputRecordSchema specialize: - specializeFrom: OutputRecordField specializeTo: CommandOutputRecordField - name: CommandOutputEnumSchema type: record extends: OutputEnumSchema specialize: - specializeFrom: OutputRecordSchema specializeTo: CommandOutputRecordSchema - specializeFrom: OutputEnumSchema specializeTo: CommandOutputEnumSchema - specializeFrom: OutputArraySchema specializeTo: CommandOutputArraySchema - specializeFrom: OutputBinding specializeTo: CommandOutputBinding - name: CommandOutputArraySchema type: record extends: OutputArraySchema specialize: - specializeFrom: OutputRecordSchema specializeTo: CommandOutputRecordSchema - specializeFrom: OutputEnumSchema specializeTo: CommandOutputEnumSchema - specializeFrom: OutputArraySchema specializeTo: CommandOutputArraySchema - specializeFrom: OutputBinding specializeTo: CommandOutputBinding - type: record name: CommandInputParameter extends: InputParameter doc: An input parameter for a CommandLineTool. specialize: - specializeFrom: InputRecordSchema specializeTo: CommandInputRecordSchema - specializeFrom: InputEnumSchema specializeTo: CommandInputEnumSchema - specializeFrom: InputArraySchema specializeTo: CommandInputArraySchema - specializeFrom: InputBinding specializeTo: CommandLineBinding - type: record name: CommandOutputParameter extends: OutputParameter doc: An output parameter for a CommandLineTool. specialize: - specializeFrom: OutputBinding specializeTo: CommandOutputBinding fields: - name: type type: - "null" - CWLType - stdout - stderr - CommandOutputRecordSchema - CommandOutputEnumSchema - CommandOutputArraySchema - string - type: array items: - CWLType - CommandOutputRecordSchema - CommandOutputEnumSchema - CommandOutputArraySchema - string jsonldPredicate: "_id": "sld:type" "_type": "@vocab" refScope: 2 typeDSL: True doc: | Specify valid types of data that may be assigned to this parameter. - name: stdout type: enum symbols: [ "cwl:stdout" ] docParent: "#CommandOutputParameter" doc: | Only valid as a `type` for a `CommandLineTool` output with no `outputBinding` set. The following ``` outputs: an_output_name: type: stdout stdout: a_stdout_file ``` is equivalent to ``` outputs: an_output_name: type: File streamable: true outputBinding: glob: a_stdout_file stdout: a_stdout_file ``` If there is no `stdout` name provided, a random filename will be created. For example, the following ``` outputs: an_output_name: type: stdout ``` is equivalent to ``` outputs: an_output_name: type: File streamable: true outputBinding: glob: random_stdout_filenameABCDEFG stdout: random_stdout_filenameABCDEFG ``` - name: stderr type: enum symbols: [ "cwl:stderr" ] docParent: "#CommandOutputParameter" doc: | Only valid as a `type` for a `CommandLineTool` output with no `outputBinding` set. The following ``` outputs: an_output_name: type: stderr stderr: a_stderr_file ``` is equivalent to ``` outputs: an_output_name: type: File streamable: true outputBinding: glob: a_stderr_file stderr: a_stderr_file ``` If there is no `stderr` name provided, a random filename will be created. For example, the following ``` outputs: an_output_name: type: stderr ``` is equivalent to ``` outputs: an_output_name: type: File streamable: true outputBinding: glob: random_stderr_filenameABCDEFG stderr: random_stderr_filenameABCDEFG ``` - type: record name: CommandLineTool extends: Process documentRoot: true specialize: - specializeFrom: InputParameter specializeTo: CommandInputParameter - specializeFrom: OutputParameter specializeTo: CommandOutputParameter doc: | This defines the schema of the CWL Command Line Tool Description document. fields: - name: class jsonldPredicate: "_id": "@type" "_type": "@vocab" type: string - name: baseCommand doc: | Specifies the program to execute. If an array, the first element of the array is the command to execute, and subsequent elements are mandatory command line arguments. The elements in `baseCommand` must appear before any command line bindings from `inputBinding` or `arguments`. If `baseCommand` is not provided or is an empty array, the first element of the command line produced after processing `inputBinding` or `arguments` must be used as the program to execute. If the program includes a path separator character it must be an absolute path, otherwise it is an error. If the program does not include a path separator, search the `$PATH` variable in the runtime environment of the workflow runner find the absolute path of the executable. type: - string? - string[]? jsonldPredicate: "_id": "cwl:baseCommand" "_container": "@list" - name: arguments doc: | Command line bindings which are not directly associated with input parameters. type: - "null" - type: array items: [string, Expression, CommandLineBinding] jsonldPredicate: "_id": "cwl:arguments" "_container": "@list" - name: stdin type: ["null", string, Expression] doc: | A path to a file whose contents must be piped into the command's standard input stream. - name: stderr type: ["null", string, Expression] jsonldPredicate: "https://w3id.org/cwl/cwl#stderr" doc: | Capture the command's standard error stream to a file written to the designated output directory. If `stderr` is a string, it specifies the file name to use. If `stderr` is an expression, the expression is evaluated and must return a string with the file name to use to capture stderr. If the return value is not a string, or the resulting path contains illegal characters (such as the path separator `/`) it is an error. - name: stdout type: ["null", string, Expression] jsonldPredicate: "https://w3id.org/cwl/cwl#stdout" doc: | Capture the command's standard output stream to a file written to the designated output directory. If `stdout` is a string, it specifies the file name to use. If `stdout` is an expression, the expression is evaluated and must return a string with the file name to use to capture stdout. If the return value is not a string, or the resulting path contains illegal characters (such as the path separator `/`) it is an error. - name: successCodes type: int[]? doc: | Exit codes that indicate the process completed successfully. - name: temporaryFailCodes type: int[]? doc: | Exit codes that indicate the process failed due to a possibly temporary condition, where executing the process with the same runtime environment and inputs may produce different results. - name: permanentFailCodes type: int[]? doc: Exit codes that indicate the process failed due to a permanent logic error, where executing the process with the same runtime environment and same inputs is expected to always fail. - type: record name: DockerRequirement extends: ProcessRequirement doc: | Indicates that a workflow component should be run in a [Docker](http://docker.com) container, and specifies how to fetch or build the image. If a CommandLineTool lists `DockerRequirement` under `hints` (or `requirements`), it may (or must) be run in the specified Docker container. The platform must first acquire or install the correct Docker image as specified by `dockerPull`, `dockerImport`, `dockerLoad` or `dockerFile`. The platform must execute the tool in the container using `docker run` with the appropriate Docker image and tool command line. The workflow platform may provide input files and the designated output directory through the use of volume bind mounts. The platform may rewrite file paths in the input object to correspond to the Docker bind mounted locations. When running a tool contained in Docker, the workflow platform must not assume anything about the contents of the Docker container, such as the presence or absence of specific software, except to assume that the generated command line represents a valid command within the runtime environment of the container. ## Interaction with other requirements If [EnvVarRequirement](#EnvVarRequirement) is specified alongside a DockerRequirement, the environment variables must be provided to Docker using `--env` or `--env-file` and interact with the container's preexisting environment as defined by Docker. fields: - name: class type: string doc: "Always 'DockerRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: dockerPull type: string? doc: "Specify a Docker image to retrieve using `docker pull`." - name: dockerLoad type: string? doc: "Specify a HTTP URL from which to download a Docker image using `docker load`." - name: dockerFile type: string? doc: "Supply the contents of a Dockerfile which will be built using `docker build`." - name: dockerImport type: string? doc: "Provide HTTP URL to download and gunzip a Docker images using `docker import." - name: dockerImageId type: string? doc: | The image id that will be used for `docker run`. May be a human-readable image name or the image identifier hash. May be skipped if `dockerPull` is specified, in which case the `dockerPull` image id must be used. - name: dockerOutputDirectory type: string? doc: | Set the designated output directory to a specific location inside the Docker container. - type: record name: SoftwareRequirement extends: ProcessRequirement doc: | A list of software packages that should be configured in the environment of the defined process. fields: - name: class type: string doc: "Always 'SoftwareRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: packages type: SoftwarePackage[] doc: "The list of software to be configured." jsonldPredicate: mapSubject: package mapPredicate: specs - name: SoftwarePackage type: record fields: - name: package type: string doc: "The common name of the software to be configured." - name: version type: string[]? doc: "The (optional) version of the software to configured." - name: specs type: string[]? doc: | Must be one or more IRIs identifying resources for installing or enabling the software. Implementations may provide resolvers which map well-known software spec IRIs to some configuration action. For example, an IRI `https://packages.debian.org/jessie/bowtie` could be resolved with `apt-get install bowtie`. An IRI `https://anaconda.org/bioconda/bowtie` could be resolved with `conda install -c bioconda bowtie`. Tools may also provide IRIs to index entries such as [RRID](http://www.identifiers.org/rrid/), such as `http://identifiers.org/rrid/RRID:SCR_005476` - name: Dirent type: record doc: | Define a file or subdirectory that must be placed in the designated output directory prior to executing the command line tool. May be the result of executing an expression, such as building a configuration file from a template. fields: - name: entryname type: ["null", string, Expression] jsonldPredicate: _id: cwl:entryname doc: | The name of the file or subdirectory to create in the output directory. If `entry` is a File or Directory, this overrides `basename`. Optional. - name: entry type: [string, Expression] jsonldPredicate: _id: cwl:entry doc: | If the value is a string literal or an expression which evaluates to a string, a new file must be created with the string as the file contents. If the value is an expression that evaluates to a `File` object, this indicates the referenced file should be added to the designated output directory prior to executing the tool. If the value is an expression that evaluates to a `Dirent` object, this indicates that the File or Directory in `entry` should be added to the designated output directory with the name in `entryname`. If `writable` is false, the file may be made available using a bind mount or file system link to avoid unnecessary copying of the input file. - name: writable type: boolean? doc: | If true, the file or directory must be writable by the tool. Changes to the file or directory must be isolated and not visible by any other CommandLineTool process. This may be implemented by making a copy of the original file or directory. Default false (files and directories read-only by default). - name: InitialWorkDirRequirement type: record extends: ProcessRequirement doc: Define a list of files and subdirectories that must be created by the workflow platform in the designated output directory prior to executing the command line tool. fields: - name: class type: string doc: InitialWorkDirRequirement jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: listing type: - type: array items: [File, Directory, Dirent, string, Expression] - string - Expression jsonldPredicate: _id: "cwl:listing" doc: | The list of files or subdirectories that must be placed in the designated output directory prior to executing the command line tool. May be an expression. If so, the expression return value must validate as `{type: array, items: [File, Directory]}`. - name: EnvVarRequirement type: record extends: ProcessRequirement doc: | Define a list of environment variables which will be set in the execution environment of the tool. See `EnvironmentDef` for details. fields: - name: class type: string doc: "Always 'EnvVarRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: envDef type: EnvironmentDef[] doc: The list of environment variables. jsonldPredicate: mapSubject: envName mapPredicate: envValue - type: record name: ShellCommandRequirement extends: ProcessRequirement doc: | Modify the behavior of CommandLineTool to generate a single string containing a shell command line. Each item in the argument list must be joined into a string separated by single spaces and quoted to prevent interpretation by the shell, unless `CommandLineBinding` for that argument contains `shellQuote: false`. If `shellQuote: false` is specified, the argument is joined into the command string without quoting, which allows the use of shell metacharacters such as `|` for pipes. fields: - name: class type: string doc: "Always 'ShellCommandRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - type: record name: ResourceRequirement extends: ProcessRequirement doc: | Specify basic hardware resource requirements. "min" is the minimum amount of a resource that must be reserved to schedule a job. If "min" cannot be satisfied, the job should not be run. "max" is the maximum amount of a resource that the job shall be permitted to use. If a node has sufficient resources, multiple jobs may be scheduled on a single node provided each job's "max" resource requirements are met. If a job attempts to exceed its "max" resource allocation, an implementation may deny additional resources, which may result in job failure. If "min" is specified but "max" is not, then "max" == "min" If "max" is specified by "min" is not, then "min" == "max". It is an error if max < min. It is an error if the value of any of these fields is negative. If neither "min" nor "max" is specified for a resource, an implementation may provide a default. fields: - name: class type: string doc: "Always 'ResourceRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: coresMin type: ["null", long, string, Expression] doc: Minimum reserved number of CPU cores - name: coresMax type: ["null", int, string, Expression] doc: Maximum reserved number of CPU cores - name: ramMin type: ["null", long, string, Expression] doc: Minimum reserved RAM in mebibytes (2**20) - name: ramMax type: ["null", long, string, Expression] doc: Maximum reserved RAM in mebibytes (2**20) - name: tmpdirMin type: ["null", long, string, Expression] doc: Minimum reserved filesystem based storage for the designated temporary directory, in mebibytes (2**20) - name: tmpdirMax type: ["null", long, string, Expression] doc: Maximum reserved filesystem based storage for the designated temporary directory, in mebibytes (2**20) - name: outdirMin type: ["null", long, string, Expression] doc: Minimum reserved filesystem based storage for the designated output directory, in mebibytes (2**20) - name: outdirMax type: ["null", long, string, Expression] doc: Maximum reserved filesystem based storage for the designated output directory, in mebibytes (2**20) flycheck-35.0/test/resources/language/cwl/schema/CommonWorkflowLanguage.yml000066400000000000000000000003211500215546300272010ustar00rootroot00000000000000$base: "https://w3id.org/cwl/cwl#" $namespaces: cwl: "https://w3id.org/cwl/cwl#" sld: "https://w3id.org/cwl/salad#" $graph: - $import: Process.yml - $import: CommandLineTool.yml - $import: Workflow.yml flycheck-35.0/test/resources/language/cwl/schema/Process.yml000066400000000000000000000611721500215546300242030ustar00rootroot00000000000000$base: "https://w3id.org/cwl/cwl#" $namespaces: cwl: "https://w3id.org/cwl/cwl#" sld: "https://w3id.org/cwl/salad#" $graph: - name: "Common Workflow Language, v1.0" type: documentation doc: {$include: concepts.md} - $import: "metaschema_base.yml" - name: BaseTypesDoc type: documentation doc: | ## Base types docChild: - "#CWLType" - "#Process" - type: enum name: CWLVersion doc: "Version symbols for published CWL document versions." symbols: - cwl:draft-2 - cwl:draft-3.dev1 - cwl:draft-3.dev2 - cwl:draft-3.dev3 - cwl:draft-3.dev4 - cwl:draft-3.dev5 - cwl:draft-3 - cwl:draft-4.dev1 - cwl:draft-4.dev2 - cwl:draft-4.dev3 - cwl:v1.0.dev4 - cwl:v1.0 - name: CWLType type: enum extends: "sld:PrimitiveType" symbols: - cwl:File - cwl:Directory doc: - "Extends primitive types with the concept of a file and directory as a builtin type." - "File: A File object" - "Directory: A Directory object" - name: File type: record docParent: "#CWLType" doc: | Represents a file (or group of files if `secondaryFiles` is specified) that must be accessible by tools using standard POSIX file system call API such as open(2) and read(2). fields: - name: class type: type: enum name: File_class symbols: - cwl:File jsonldPredicate: _id: "@type" _type: "@vocab" doc: Must be `File` to indicate this object describes a file. - name: location type: string? doc: | An IRI that identifies the file resource. This may be a relative reference, in which case it must be resolved using the base IRI of the document. The location may refer to a local or remote resource; the implementation must use the IRI to retrieve file content. If an implementation is unable to retrieve the file content stored at a remote resource (due to unsupported protocol, access denied, or other issue) it must signal an error. If the `location` field is not provided, the `contents` field must be provided. The implementation must assign a unique identifier for the `location` field. If the `path` field is provided but the `location` field is not, an implementation may assign the value of the `path` field to `location`, then follow the rules above. jsonldPredicate: _id: "@id" _type: "@id" - name: path type: string? doc: | The local host path where the File is available when a CommandLineTool is executed. This field must be set by the implementation. The final path component must match the value of `basename`. This field must not be used in any other context. The command line tool being executed must be able to to access the file at `path` using the POSIX `open(2)` syscall. As a special case, if the `path` field is provided but the `location` field is not, an implementation may assign the value of the `path` field to `location`, and remove the `path` field. If the `path` contains [POSIX shell metacharacters](http://pubs.opengroup.org/onlinepubs/9699919799/utilities/V3_chap02.html#tag_18_02) (`|`,`&`, `;`, `<`, `>`, `(`,`)`, `$`,`` ` ``, `\`, `"`, `'`, ``, ``, and ``) or characters [not allowed](http://www.iana.org/assignments/idna-tables-6.3.0/idna-tables-6.3.0.xhtml) for [Internationalized Domain Names for Applications](https://tools.ietf.org/html/rfc6452) then implementations may terminate the process with a `permanentFailure`. jsonldPredicate: "_id": "cwl:path" "_type": "@id" - name: basename type: string? doc: | The base name of the file, that is, the name of the file without any leading directory path. The base name must not contain a slash `/`. If not provided, the implementation must set this field based on the `location` field by taking the final path component after parsing `location` as an IRI. If `basename` is provided, it is not required to match the value from `location`. When this file is made available to a CommandLineTool, it must be named with `basename`, i.e. the final component of the `path` field must match `basename`. jsonldPredicate: "cwl:basename" - name: dirname type: string? doc: | The name of the directory containing file, that is, the path leading up to the final slash in the path such that `dirname + '/' + basename == path`. The implementation must set this field based on the value of `path` prior to evaluating parameter references or expressions in a CommandLineTool document. This field must not be used in any other context. - name: nameroot type: string? doc: | The basename root such that `nameroot + nameext == basename`, and `nameext` is empty or begins with a period and contains at most one period. For the purposess of path splitting leading periods on the basename are ignored; a basename of `.cshrc` will have a nameroot of `.cshrc`. The implementation must set this field automatically based on the value of `basename` prior to evaluating parameter references or expressions. - name: nameext type: string? doc: | The basename extension such that `nameroot + nameext == basename`, and `nameext` is empty or begins with a period and contains at most one period. Leading periods on the basename are ignored; a basename of `.cshrc` will have an empty `nameext`. The implementation must set this field automatically based on the value of `basename` prior to evaluating parameter references or expressions. - name: checksum type: string? doc: | Optional hash code for validating file integrity. Currently must be in the form "sha1$ + hexadecimal string" using the SHA-1 algorithm. - name: size type: long? doc: Optional file size - name: "secondaryFiles" type: - "null" - type: array items: [File, Directory] jsonldPredicate: "cwl:secondaryFiles" doc: | A list of additional files that are associated with the primary file and must be transferred alongside the primary file. Examples include indexes of the primary file, or external references which must be included when loading primary document. A file object listed in `secondaryFiles` may itself include `secondaryFiles` for which the same rules apply. - name: format type: string? jsonldPredicate: _id: cwl:format _type: "@id" identity: true doc: | The format of the file: this must be an IRI of a concept node that represents the file format, preferably defined within an ontology. If no ontology is available, file formats may be tested by exact match. Reasoning about format compatibility must be done by checking that an input file format is the same, `owl:equivalentClass` or `rdfs:subClassOf` the format required by the input parameter. `owl:equivalentClass` is transitive with `rdfs:subClassOf`, e.g. if ` owl:equivalentClass ` and ` owl:subclassOf ` then infer ` owl:subclassOf `. File format ontologies may be provided in the "$schema" metadata at the root of the document. If no ontologies are specified in `$schema`, the runtime may perform exact file format matches. - name: contents type: string? doc: | File contents literal. Maximum of 64 KiB. If neither `location` nor `path` is provided, `contents` must be non-null. The implementation must assign a unique identifier for the `location` field. When the file is staged as input to CommandLineTool, the value of `contents` must be written to a file. If `loadContents` of `inputBinding` or `outputBinding` is true and `location` is valid, the implementation must read up to the first 64 KiB of text from the file and place it in the "contents" field. - name: Directory type: record docAfter: "#File" doc: | Represents a directory to present to a command line tool. fields: - name: class type: type: enum name: Directory_class symbols: - cwl:Directory jsonldPredicate: _id: "@type" _type: "@vocab" doc: Must be `Directory` to indicate this object describes a Directory. - name: location type: string? doc: | An IRI that identifies the directory resource. This may be a relative reference, in which case it must be resolved using the base IRI of the document. The location may refer to a local or remote resource. If the `listing` field is not set, the implementation must use the location IRI to retrieve directory listing. If an implementation is unable to retrieve the directory listing stored at a remote resource (due to unsupported protocol, access denied, or other issue) it must signal an error. If the `location` field is not provided, the `listing` field must be provided. The implementation must assign a unique identifier for the `location` field. If the `path` field is provided but the `location` field is not, an implementation may assign the value of the `path` field to `location`, then follow the rules above. jsonldPredicate: _id: "@id" _type: "@id" - name: path type: string? doc: | The local path where the Directory is made available prior to executing a CommandLineTool. This must be set by the implementation. This field must not be used in any other context. The command line tool being executed must be able to to access the directory at `path` using the POSIX `opendir(2)` syscall. If the `path` contains [POSIX shell metacharacters](http://pubs.opengroup.org/onlinepubs/9699919799/utilities/V3_chap02.html#tag_18_02) (`|`,`&`, `;`, `<`, `>`, `(`,`)`, `$`,`` ` ``, `\`, `"`, `'`, ``, ``, and ``) or characters [not allowed](http://www.iana.org/assignments/idna-tables-6.3.0/idna-tables-6.3.0.xhtml) for [Internationalized Domain Names for Applications](https://tools.ietf.org/html/rfc6452) then implementations may terminate the process with a `permanentFailure`. jsonldPredicate: _id: "cwl:path" _type: "@id" - name: basename type: string? doc: | The base name of the directory, that is, the name of the file without any leading directory path. The base name must not contain a slash `/`. If not provided, the implementation must set this field based on the `location` field by taking the final path component after parsing `location` as an IRI. If `basename` is provided, it is not required to match the value from `location`. When this file is made available to a CommandLineTool, it must be named with `basename`, i.e. the final component of the `path` field must match `basename`. jsonldPredicate: "cwl:basename" - name: listing type: - "null" - type: array items: [File, Directory] doc: | List of files or subdirectories contained in this directory. The name of each file or subdirectory is determined by the `basename` field of each `File` or `Directory` object. It is an error if a `File` shares a `basename` with any other entry in `listing`. If two or more `Directory` object share the same `basename`, this must be treated as equivalent to a single subdirectory with the listings recursively merged. jsonldPredicate: _id: "cwl:listing" - name: SchemaBase type: record abstract: true fields: - name: label type: - "null" - string jsonldPredicate: "rdfs:label" doc: "A short, human-readable label of this object." - name: Parameter type: record extends: SchemaBase abstract: true doc: | Define an input or output parameter to a process. fields: - name: secondaryFiles type: - "null" - string - Expression - type: array items: [string, Expression] jsonldPredicate: "cwl:secondaryFiles" doc: | Only valid when `type: File` or is an array of `items: File`. Describes files that must be included alongside the primary file(s). If the value is an expression, the value of `self` in the expression must be the primary input or output File to which this binding applies. If the value is a string, it specifies that the following pattern should be applied to the primary file: 1. If string begins with one or more caret `^` characters, for each caret, remove the last file extension from the path (the last period `.` and all following characters). If there are no file extensions, the path is unchanged. 2. Append the remainder of the string to the end of the file path. - name: format type: - "null" - string - type: array items: string - Expression jsonldPredicate: _id: cwl:format _type: "@id" identity: true doc: | Only valid when `type: File` or is an array of `items: File`. For input parameters, this must be one or more IRIs of concept nodes that represents file formats which are allowed as input to this parameter, preferably defined within an ontology. If no ontology is available, file formats may be tested by exact match. For output parameters, this is the file format that will be assigned to the output parameter. - name: streamable type: boolean? doc: | Only valid when `type: File` or is an array of `items: File`. A value of `true` indicates that the file is read or written sequentially without seeking. An implementation may use this flag to indicate whether it is valid to stream file contents using a named pipe. Default: `false`. - name: doc type: - string? - string[]? doc: "A documentation string for this type, or an array of strings which should be concatenated." jsonldPredicate: "rdfs:comment" - type: enum name: Expression doc: | 'Expression' is not a real type. It indicates that a field must allow runtime parameter references. If [InlineJavascriptRequirement](#InlineJavascriptRequirement) is declared and supported by the platform, the field must also allow Javascript expressions. symbols: - cwl:ExpressionPlaceholder - name: InputBinding type: record abstract: true fields: - name: loadContents type: - "null" - boolean jsonldPredicate: "cwl:loadContents" doc: | Only valid when `type: File` or is an array of `items: File`. Read up to the first 64 KiB of text from the file and place it in the "contents" field of the file object for use by expressions. - name: OutputBinding type: record abstract: true - name: InputSchema extends: SchemaBase type: record abstract: true - name: OutputSchema extends: SchemaBase type: record abstract: true - name: InputRecordField type: record extends: "sld:RecordField" specialize: - specializeFrom: "sld:RecordSchema" specializeTo: InputRecordSchema - specializeFrom: "sld:EnumSchema" specializeTo: InputEnumSchema - specializeFrom: "sld:ArraySchema" specializeTo: InputArraySchema - specializeFrom: "sld:PrimitiveType" specializeTo: CWLType fields: - name: inputBinding type: InputBinding? jsonldPredicate: "cwl:inputBinding" - name: label type: string? jsonldPredicate: "rdfs:label" doc: "A short, human-readable label of this process object." - name: InputRecordSchema type: record extends: ["sld:RecordSchema", InputSchema] specialize: - specializeFrom: "sld:RecordField" specializeTo: InputRecordField - name: InputEnumSchema type: record extends: ["sld:EnumSchema", InputSchema] fields: - name: inputBinding type: InputBinding? jsonldPredicate: "cwl:inputBinding" - name: InputArraySchema type: record extends: ["sld:ArraySchema", InputSchema] specialize: - specializeFrom: "sld:RecordSchema" specializeTo: InputRecordSchema - specializeFrom: "sld:EnumSchema" specializeTo: InputEnumSchema - specializeFrom: "sld:ArraySchema" specializeTo: InputArraySchema - specializeFrom: "sld:PrimitiveType" specializeTo: CWLType fields: - name: inputBinding type: InputBinding? jsonldPredicate: "cwl:inputBinding" - name: OutputRecordField type: record extends: "sld:RecordField" specialize: - specializeFrom: "sld:RecordSchema" specializeTo: OutputRecordSchema - specializeFrom: "sld:EnumSchema" specializeTo: OutputEnumSchema - specializeFrom: "sld:ArraySchema" specializeTo: OutputArraySchema - specializeFrom: "sld:PrimitiveType" specializeTo: CWLType fields: - name: outputBinding type: OutputBinding? jsonldPredicate: "cwl:outputBinding" - name: OutputRecordSchema type: record extends: ["sld:RecordSchema", "#OutputSchema"] docParent: "#OutputParameter" specialize: - specializeFrom: "sld:RecordField" specializeTo: OutputRecordField - name: OutputEnumSchema type: record extends: ["sld:EnumSchema", OutputSchema] docParent: "#OutputParameter" fields: - name: outputBinding type: OutputBinding? jsonldPredicate: "cwl:outputBinding" - name: OutputArraySchema type: record extends: ["sld:ArraySchema", OutputSchema] docParent: "#OutputParameter" specialize: - specializeFrom: "sld:RecordSchema" specializeTo: OutputRecordSchema - specializeFrom: "sld:EnumSchema" specializeTo: OutputEnumSchema - specializeFrom: "sld:ArraySchema" specializeTo: OutputArraySchema - specializeFrom: "sld:PrimitiveType" specializeTo: CWLType fields: - name: outputBinding type: OutputBinding? jsonldPredicate: "cwl:outputBinding" - name: InputParameter type: record extends: Parameter fields: - name: id type: string jsonldPredicate: "@id" doc: "The unique identifier for this parameter object." - name: inputBinding type: InputBinding? jsonldPredicate: "cwl:inputBinding" doc: | Describes how to handle the inputs of a process and convert them into a concrete form for execution, such as command line parameters. - name: default type: Any? jsonldPredicate: "cwl:default" doc: | The default value for this parameter if not provided in the input object. - name: type type: - "null" - CWLType - InputRecordSchema - InputEnumSchema - InputArraySchema - string - type: array items: - CWLType - InputRecordSchema - InputEnumSchema - InputArraySchema - string jsonldPredicate: "_id": "sld:type" "_type": "@vocab" refScope: 2 typeDSL: True doc: | Specify valid types of data that may be assigned to this parameter. - name: OutputParameter type: record extends: Parameter fields: - name: id type: string jsonldPredicate: "@id" doc: "The unique identifier for this parameter object." - name: outputBinding type: OutputBinding? jsonldPredicate: "cwl:outputBinding" doc: | Describes how to handle the outputs of a process. - type: record name: ProcessRequirement abstract: true doc: | A process requirement declares a prerequisite that may or must be fulfilled before executing a process. See [`Process.hints`](#process) and [`Process.requirements`](#process). Process requirements are the primary mechanism for specifying extensions to the CWL core specification. - type: record name: Process abstract: true doc: | The base executable type in CWL is the `Process` object defined by the document. Note that the `Process` object is abstract and cannot be directly executed. fields: - name: id type: string? jsonldPredicate: "@id" doc: "The unique identifier for this process object." - name: inputs type: type: array items: InputParameter jsonldPredicate: _id: "cwl:inputs" mapSubject: id mapPredicate: type doc: | Defines the input parameters of the process. The process is ready to run when all required input parameters are associated with concrete values. Input parameters include a schema for each parameter which is used to validate the input object. It may also be used to build a user interface for constructing the input object. - name: outputs type: type: array items: OutputParameter jsonldPredicate: _id: "cwl:outputs" mapSubject: id mapPredicate: type doc: | Defines the parameters representing the output of the process. May be used to generate and/or validate the output object. - name: requirements type: ProcessRequirement[]? jsonldPredicate: _id: "cwl:requirements" mapSubject: class doc: | Declares requirements that apply to either the runtime environment or the workflow engine that must be met in order to execute this process. If an implementation cannot satisfy all requirements, or a requirement is listed which is not recognized by the implementation, it is a fatal error and the implementation must not attempt to run the process, unless overridden at user option. - name: hints type: Any[]? doc: | Declares hints applying to either the runtime environment or the workflow engine that may be helpful in executing this process. It is not an error if an implementation cannot satisfy all hints, however the implementation may report a warning. jsonldPredicate: _id: cwl:hints noLinkCheck: true mapSubject: class - name: label type: string? jsonldPredicate: "rdfs:label" doc: "A short, human-readable label of this process object." - name: doc type: string? jsonldPredicate: "rdfs:comment" doc: "A long, human-readable description of this process object." - name: cwlVersion type: CWLVersion? doc: | CWL document version. Always required at the document root. Not required for a Process embedded inside another Process. jsonldPredicate: "_id": "cwl:cwlVersion" "_type": "@vocab" - name: InlineJavascriptRequirement type: record extends: ProcessRequirement doc: | Indicates that the workflow platform must support inline Javascript expressions. If this requirement is not present, the workflow platform must not perform expression interpolatation. fields: - name: class type: string doc: "Always 'InlineJavascriptRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: expressionLib type: string[]? doc: | Additional code fragments that will also be inserted before executing the expression code. Allows for function definitions that may be called from CWL expressions. - name: SchemaDefRequirement type: record extends: ProcessRequirement doc: | This field consists of an array of type definitions which must be used when interpreting the `inputs` and `outputs` fields. When a `type` field contain a IRI, the implementation must check if the type is defined in `schemaDefs` and use that definition. If the type is not found in `schemaDefs`, it is an error. The entries in `schemaDefs` must be processed in the order listed such that later schema definitions may refer to earlier schema definitions. fields: - name: class type: string doc: "Always 'SchemaDefRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: types type: type: array items: InputSchema doc: The list of type definitions. flycheck-35.0/test/resources/language/cwl/schema/Workflow.yml000066400000000000000000000472021500215546300243750ustar00rootroot00000000000000$base: "https://w3id.org/cwl/cwl#" $namespaces: sld: "https://w3id.org/cwl/salad#" cwl: "https://w3id.org/cwl/cwl#" $graph: - name: "WorkflowDoc" type: documentation doc: - | # Common Workflow Language (CWL) Workflow Description, v1.0 This version: * https://w3id.org/cwl/v1.0/ Current version: * https://w3id.org/cwl/ - "\n\n" - {$include: contrib.md} - "\n\n" - | # Abstract One way to define a workflow is: an analysis task represented by a directed graph describing a sequence of operations that transform an input data set to output. This specification defines the Common Workflow Language (CWL) Workflow description, a vendor-neutral standard for representing workflows intended to be portable across a variety of computing platforms. - {$include: intro.md} - | ## Introduction to v1.0 This specification represents the first full release from the CWL group. Since draft-3, this draft introduces the following changes and additions: * The `inputs` and `outputs` fields have been renamed `in` and `out`. * Syntax simplifcations: denoted by the `map<>` syntax. Example: `in` contains a list of items, each with an id. Now one can specify a mapping of that identifier to the corresponding `InputParameter`. ``` in: - id: one type: string doc: First input parameter - id: two type: int doc: Second input parameter ``` can be ``` in: one: type: string doc: First input parameter two: type: int doc: Second input parameter ``` * The common field `description` has been renamed to `doc`. ## Purpose The Common Workflow Language Command Line Tool Description express workflows for data-intensive science, such as Bioinformatics, Chemistry, Physics, and Astronomy. This specification is intended to define a data and execution model for Workflows that can be implemented on top of a variety of computing platforms, ranging from an individual workstation to cluster, grid, cloud, and high performance computing systems. - {$include: concepts.md} - name: ExpressionToolOutputParameter type: record extends: OutputParameter fields: - name: type type: - "null" - "#CWLType" - "#OutputRecordSchema" - "#OutputEnumSchema" - "#OutputArraySchema" - string - type: array items: - "#CWLType" - "#OutputRecordSchema" - "#OutputEnumSchema" - "#OutputArraySchema" - string jsonldPredicate: "_id": "sld:type" "_type": "@vocab" refScope: 2 typeDSL: True doc: | Specify valid types of data that may be assigned to this parameter. - type: record name: ExpressionTool extends: Process specialize: - specializeFrom: "#OutputParameter" specializeTo: "#ExpressionToolOutputParameter" documentRoot: true doc: | Execute an expression as a Workflow step. fields: - name: "class" jsonldPredicate: "_id": "@type" "_type": "@vocab" type: string - name: expression type: [string, Expression] doc: | The expression to execute. The expression must return a JSON object which matches the output parameters of the ExpressionTool. - name: LinkMergeMethod type: enum docParent: "#WorkflowStepInput" doc: The input link merge method, described in [WorkflowStepInput](#WorkflowStepInput). symbols: - merge_nested - merge_flattened - name: WorkflowOutputParameter type: record extends: OutputParameter docParent: "#Workflow" doc: | Describe an output parameter of a workflow. The parameter must be connected to one or more parameters defined in the workflow that will provide the value of the output parameter. fields: - name: outputSource doc: | Specifies one or more workflow parameters that supply the value of to the output parameter. jsonldPredicate: "_id": "cwl:outputSource" "_type": "@id" refScope: 0 type: - string? - string[]? - name: linkMerge type: ["null", "#LinkMergeMethod"] jsonldPredicate: "cwl:linkMerge" doc: | The method to use to merge multiple sources into a single array. If not specified, the default method is "merge_nested". - name: type type: - "null" - "#CWLType" - "#OutputRecordSchema" - "#OutputEnumSchema" - "#OutputArraySchema" - string - type: array items: - "#CWLType" - "#OutputRecordSchema" - "#OutputEnumSchema" - "#OutputArraySchema" - string jsonldPredicate: "_id": "sld:type" "_type": "@vocab" refScope: 2 typeDSL: True doc: | Specify valid types of data that may be assigned to this parameter. - name: Sink type: record abstract: true fields: - name: source doc: | Specifies one or more workflow parameters that will provide input to the underlying step parameter. jsonldPredicate: "_id": "cwl:source" "_type": "@id" refScope: 2 type: - string? - string[]? - name: linkMerge type: LinkMergeMethod? jsonldPredicate: "cwl:linkMerge" doc: | The method to use to merge multiple inbound links into a single array. If not specified, the default method is "merge_nested". - type: record name: WorkflowStepInput extends: Sink docParent: "#WorkflowStep" doc: | The input of a workflow step connects an upstream parameter (from the workflow inputs, or the outputs of other workflows steps) with the input parameters of the underlying step. ## Input object A WorkflowStepInput object must contain an `id` field in the form `#fieldname` or `#stepname.fieldname`. When the `id` field contains a period `.` the field name consists of the characters following the final period. This defines a field of the workflow step input object with the value of the `source` parameter(s). ## Merging To merge multiple inbound data links, [MultipleInputFeatureRequirement](#MultipleInputFeatureRequirement) must be specified in the workflow or workflow step requirements. If the sink parameter is an array, or named in a [workflow scatter](#WorkflowStep) operation, there may be multiple inbound data links listed in the `source` field. The values from the input links are merged depending on the method specified in the `linkMerge` field. If not specified, the default method is "merge_nested". * **merge_nested** The input must be an array consisting of exactly one entry for each input link. If "merge_nested" is specified with a single link, the value from the link must be wrapped in a single-item list. * **merge_flattened** 1. The source and sink parameters must be compatible types, or the source type must be compatible with single element from the "items" type of the destination array parameter. 2. Source parameters which are arrays are concatenated. Source parameters which are single element types are appended as single elements. fields: - name: id type: string jsonldPredicate: "@id" doc: "A unique identifier for this workflow input parameter." - name: default type: ["null", Any] doc: | The default value for this parameter if there is no `source` field. jsonldPredicate: "cwl:default" - name: valueFrom type: - "null" - "string" - "#Expression" jsonldPredicate: "cwl:valueFrom" doc: | To use valueFrom, [StepInputExpressionRequirement](#StepInputExpressionRequirement) must be specified in the workflow or workflow step requirements. If `valueFrom` is a constant string value, use this as the value for this input parameter. If `valueFrom` is a parameter reference or expression, it must be evaluated to yield the actual value to be assigned to the input field. The `self` value of in the parameter reference or expression must be the value of the parameter(s) specified in the `source` field, or null if there is no `source` field. The value of `inputs` in the parameter reference or expression must be the input object to the workflow step after assigning the `source` values and then scattering. The order of evaluating `valueFrom` among step input parameters is undefined and the result of evaluating `valueFrom` on a parameter must not be visible to evaluation of `valueFrom` on other parameters. - type: record name: WorkflowStepOutput docParent: "#WorkflowStep" doc: | Associate an output parameter of the underlying process with a workflow parameter. The workflow parameter (given in the `id` field) be may be used as a `source` to connect with input parameters of other workflow steps, or with an output parameter of the process. fields: - name: id type: string jsonldPredicate: "@id" doc: | A unique identifier for this workflow output parameter. This is the identifier to use in the `source` field of `WorkflowStepInput` to connect the output value to downstream parameters. - name: ScatterMethod type: enum docParent: "#WorkflowStep" doc: The scatter method, as described in [workflow step scatter](#WorkflowStep). symbols: - dotproduct - nested_crossproduct - flat_crossproduct - name: WorkflowStep type: record docParent: "#Workflow" doc: | A workflow step is an executable element of a workflow. It specifies the underlying process implementation (such as `CommandLineTool` or another `Workflow`) in the `run` field and connects the input and output parameters of the underlying process to workflow parameters. # Scatter/gather To use scatter/gather, [ScatterFeatureRequirement](#ScatterFeatureRequirement) must be specified in the workflow or workflow step requirements. A "scatter" operation specifies that the associated workflow step or subworkflow should execute separately over a list of input elements. Each job making up a scatter operation is independent and may be executed concurrently. The `scatter` field specifies one or more input parameters which will be scattered. An input parameter may be listed more than once. The declared type of each input parameter is implicitly wrapped in an array for each time it appears in the `scatter` field. As a result, upstream parameters which are connected to scattered parameters may be arrays. All output parameter types are also implicitly wrapped in arrays. Each job in the scatter results in an entry in the output array. If `scatter` declares more than one input parameter, `scatterMethod` describes how to decompose the input into a discrete set of jobs. * **dotproduct** specifies that each of the input arrays are aligned and one element taken from each array to construct each job. It is an error if all input arrays are not the same length. * **nested_crossproduct** specifies the Cartesian product of the inputs, producing a job for every combination of the scattered inputs. The output must be nested arrays for each level of scattering, in the order that the input arrays are listed in the `scatter` field. * **flat_crossproduct** specifies the Cartesian product of the inputs, producing a job for every combination of the scattered inputs. The output arrays must be flattened to a single level, but otherwise listed in the order that the input arrays are listed in the `scatter` field. # Subworkflows To specify a nested workflow as part of a workflow step, [SubworkflowFeatureRequirement](#SubworkflowFeatureRequirement) must be specified in the workflow or workflow step requirements. fields: - name: id type: string jsonldPredicate: "@id" doc: "The unique identifier for this workflow step." - name: in type: WorkflowStepInput[] jsonldPredicate: _id: "cwl:in" mapSubject: id mapPredicate: source doc: | Defines the input parameters of the workflow step. The process is ready to run when all required input parameters are associated with concrete values. Input parameters include a schema for each parameter which is used to validate the input object. It may also be used build a user interface for constructing the input object. - name: out type: - type: array items: [string, WorkflowStepOutput] jsonldPredicate: _id: "cwl:out" _type: "@id" identity: true doc: | Defines the parameters representing the output of the process. May be used to generate and/or validate the output object. - name: requirements type: ProcessRequirement[]? jsonldPredicate: _id: "cwl:requirements" mapSubject: class doc: | Declares requirements that apply to either the runtime environment or the workflow engine that must be met in order to execute this workflow step. If an implementation cannot satisfy all requirements, or a requirement is listed which is not recognized by the implementation, it is a fatal error and the implementation must not attempt to run the process, unless overridden at user option. - name: hints type: Any[]? jsonldPredicate: _id: "cwl:hints" noLinkCheck: true mapSubject: class doc: | Declares hints applying to either the runtime environment or the workflow engine that may be helpful in executing this workflow step. It is not an error if an implementation cannot satisfy all hints, however the implementation may report a warning. - name: label type: string? jsonldPredicate: "rdfs:label" doc: "A short, human-readable label of this process object." - name: doc type: string? jsonldPredicate: "rdfs:comment" doc: "A long, human-readable description of this process object." - name: run type: [string, Process] jsonldPredicate: "_id": "cwl:run" "_type": "@id" doc: | Specifies the process to run. - name: scatter type: - string? - string[]? jsonldPredicate: "_id": "cwl:scatter" "_type": "@id" "_container": "@list" refScope: 0 - name: scatterMethod doc: | Required if `scatter` is an array of more than one element. type: ScatterMethod? jsonldPredicate: "_id": "cwl:scatterMethod" "_type": "@vocab" - name: Workflow type: record extends: "#Process" documentRoot: true specialize: - specializeFrom: "#OutputParameter" specializeTo: "#WorkflowOutputParameter" doc: | A workflow describes a set of **steps** and the **dependencies** between those steps. When a step produces output that will be consumed by a second step, the first step is a dependency of the second step. When there is a dependency, the workflow engine must execute the preceding step and wait for it to successfully produce output before executing the dependent step. If two steps are defined in the workflow graph that are not directly or indirectly dependent, these steps are **independent**, and may execute in any order or execute concurrently. A workflow is complete when all steps have been executed. Dependencies between parameters are expressed using the `source` field on [workflow step input parameters](#WorkflowStepInput) and [workflow output parameters](#WorkflowOutputParameter). The `source` field expresses the dependency of one parameter on another such that when a value is associated with the parameter specified by `source`, that value is propagated to the destination parameter. When all data links inbound to a given step are fulfilled, the step is ready to execute. ## Workflow success and failure A completed step must result in one of `success`, `temporaryFailure` or `permanentFailure` states. An implementation may choose to retry a step execution which resulted in `temporaryFailure`. An implementation may choose to either continue running other steps of a workflow, or terminate immediately upon `permanentFailure`. * If any step of a workflow execution results in `permanentFailure`, then the workflow status is `permanentFailure`. * If one or more steps result in `temporaryFailure` and all other steps complete `success` or are not executed, then the workflow status is `temporaryFailure`. * If all workflow steps are executed and complete with `success`, then the workflow status is `success`. # Extensions [ScatterFeatureRequirement](#ScatterFeatureRequirement) and [SubworkflowFeatureRequirement](#SubworkflowFeatureRequirement) are available as standard [extensions](#Extensions_and_Metadata) to core workflow semantics. fields: - name: "class" jsonldPredicate: "_id": "@type" "_type": "@vocab" type: string - name: steps doc: | The individual steps that make up the workflow. Each step is executed when all of its input data links are fulfilled. An implementation may choose to execute the steps in a different order than listed and/or execute steps concurrently, provided that dependencies between steps are met. type: - type: array items: "#WorkflowStep" jsonldPredicate: mapSubject: id - type: record name: SubworkflowFeatureRequirement extends: ProcessRequirement doc: | Indicates that the workflow platform must support nested workflows in the `run` field of [WorkflowStep](#WorkflowStep). fields: - name: "class" type: "string" doc: "Always 'SubworkflowFeatureRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: ScatterFeatureRequirement type: record extends: ProcessRequirement doc: | Indicates that the workflow platform must support the `scatter` and `scatterMethod` fields of [WorkflowStep](#WorkflowStep). fields: - name: "class" type: "string" doc: "Always 'ScatterFeatureRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - name: MultipleInputFeatureRequirement type: record extends: ProcessRequirement doc: | Indicates that the workflow platform must support multiple inbound data links listed in the `source` field of [WorkflowStepInput](#WorkflowStepInput). fields: - name: "class" type: "string" doc: "Always 'MultipleInputFeatureRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" - type: record name: StepInputExpressionRequirement extends: ProcessRequirement doc: | Indicate that the workflow platform must support the `valueFrom` field of [WorkflowStepInput](#WorkflowStepInput). fields: - name: "class" type: "string" doc: "Always 'StepInputExpressionRequirement'" jsonldPredicate: "_id": "@type" "_type": "@vocab" flycheck-35.0/test/resources/language/cwl/schema/concepts.md000066400000000000000000000000011500215546300241620ustar00rootroot00000000000000 flycheck-35.0/test/resources/language/cwl/schema/contrib.md000066400000000000000000000000011500215546300240040ustar00rootroot00000000000000 flycheck-35.0/test/resources/language/cwl/schema/intro.md000066400000000000000000000000011500215546300234770ustar00rootroot00000000000000 flycheck-35.0/test/resources/language/cwl/schema/invocation.md000066400000000000000000000000011500215546300245150ustar00rootroot00000000000000 flycheck-35.0/test/resources/language/cwl/schema/metaschema_base.yml000066400000000000000000000070241500215546300256620ustar00rootroot00000000000000$base: "https://w3id.org/cwl/salad#" $namespaces: sld: "https://w3id.org/cwl/salad#" dct: "http://purl.org/dc/terms/" rdf: "http://www.w3.org/1999/02/22-rdf-syntax-ns#" rdfs: "http://www.w3.org/2000/01/rdf-schema#" xsd: "http://www.w3.org/2001/XMLSchema#" $graph: - name: PrimitiveType type: enum symbols: - "sld:null" - "xsd:boolean" - "xsd:int" - "xsd:long" - "xsd:float" - "xsd:double" - "xsd:string" doc: - | Salad data types are based on Avro schema declarations. Refer to the [Avro schema declaration documentation](https://avro.apache.org/docs/current/spec.html#schemas) for detailed information. - "null: no value" - "boolean: a binary value" - "int: 32-bit signed integer" - "long: 64-bit signed integer" - "float: single precision (32-bit) IEEE 754 floating-point number" - "double: double precision (64-bit) IEEE 754 floating-point number" - "string: Unicode character sequence" - name: Any type: enum symbols: ["#Any"] doc: | The **Any** type validates for any non-null value. - name: RecordField type: record doc: A field of a record. fields: - name: name type: string jsonldPredicate: "@id" doc: | The name of the field - name: doc type: string? doc: | A documentation string for this field jsonldPredicate: "rdfs:comment" - name: type type: - PrimitiveType - RecordSchema - EnumSchema - ArraySchema - string - type: array items: - PrimitiveType - RecordSchema - EnumSchema - ArraySchema - string jsonldPredicate: _id: sld:type _type: "@vocab" typeDSL: true refScope: 2 doc: | The field type - name: RecordSchema type: record fields: type: doc: "Must be `record`" type: name: Record_symbol type: enum symbols: - "sld:record" jsonldPredicate: _id: "sld:type" _type: "@vocab" typeDSL: true refScope: 2 fields: type: RecordField[]? jsonldPredicate: _id: sld:fields mapSubject: name mapPredicate: type doc: "Defines the fields of the record." - name: EnumSchema type: record doc: | Define an enumerated type. fields: type: doc: "Must be `enum`" type: name: Enum_symbol type: enum symbols: - "sld:enum" jsonldPredicate: _id: "sld:type" _type: "@vocab" typeDSL: true refScope: 2 symbols: type: string[] jsonldPredicate: _id: "sld:symbols" _type: "@id" identity: true doc: "Defines the set of valid symbols." - name: ArraySchema type: record fields: type: doc: "Must be `array`" type: name: Array_symbol type: enum symbols: - "sld:array" jsonldPredicate: _id: "sld:type" _type: "@vocab" typeDSL: true refScope: 2 items: type: - PrimitiveType - RecordSchema - EnumSchema - ArraySchema - string - type: array items: - PrimitiveType - RecordSchema - EnumSchema - ArraySchema - string jsonldPredicate: _id: "sld:items" _type: "@vocab" refScope: 2 doc: "Defines the type of the array elements." flycheck-35.0/test/resources/language/d/000077500000000000000000000000001500215546300202315ustar00rootroot00000000000000flycheck-35.0/test/resources/language/d/lib/000077500000000000000000000000001500215546300207775ustar00rootroot00000000000000flycheck-35.0/test/resources/language/d/lib/external_library.d000066400000000000000000000000311500215546300245040ustar00rootroot00000000000000module external_library; flycheck-35.0/test/resources/language/d/src/000077500000000000000000000000001500215546300210205ustar00rootroot00000000000000flycheck-35.0/test/resources/language/d/src/dmd/000077500000000000000000000000001500215546300215645ustar00rootroot00000000000000flycheck-35.0/test/resources/language/d/src/dmd/continuation.d000066400000000000000000000002111500215546300244350ustar00rootroot00000000000000// Test continuation lines for template instantiations template T() { alias T = invalid; } template U() { alias U = T!(); } U!() u; flycheck-35.0/test/resources/language/d/src/dmd/library.d000066400000000000000000000001431500215546300233730ustar00rootroot00000000000000module dmd.library; // A in-source library, to test the implicit inclusion of the base directory. flycheck-35.0/test/resources/language/d/src/dmd/no_module.d000066400000000000000000000000221500215546300237040ustar00rootroot00000000000000import std.stdio; flycheck-35.0/test/resources/language/d/src/dmd/package.d000066400000000000000000000001001500215546300233130ustar00rootroot00000000000000// A dummy D package file to test base calculation module dmd; flycheck-35.0/test/resources/language/d/src/dmd/warning.d000066400000000000000000000003071500215546300233760ustar00rootroot00000000000000module dmd.warning; import dmd.library; import external_library; auto foo(int a) { return a; return a; } deprecated auto bar(int a) { return a; } void main() { auto x = bar(1); } flycheck-35.0/test/resources/language/dockerfile/000077500000000000000000000000001500215546300221155ustar00rootroot00000000000000flycheck-35.0/test/resources/language/dockerfile/Dockerfile.error000066400000000000000000000000341500215546300252340ustar00rootroot00000000000000FROM debian INVALID_COMMAND flycheck-35.0/test/resources/language/dockerfile/Dockerfile.warning000066400000000000000000000001061500215546300255500ustar00rootroot00000000000000FROM debian RUN apt-get update && apt-get upgrade WORKDIR usr/src/app flycheck-35.0/test/resources/language/elixir/000077500000000000000000000000001500215546300213025ustar00rootroot00000000000000flycheck-35.0/test/resources/language/elixir/lib/000077500000000000000000000000001500215546300220505ustar00rootroot00000000000000flycheck-35.0/test/resources/language/elixir/lib/infos.ex000066400000000000000000000001151500215546300235210ustar00rootroot00000000000000defmodule Infos do def give_infos() do IO.puts "Hello World" end end flycheck-35.0/test/resources/language/elixir/lib/warnings.ex000066400000000000000000000002401500215546300242320ustar00rootroot00000000000000defmodule Warnings do @moduledoc "Removes info warning" def give_warnings do if true && true do end if length(list) == 0 do end end end flycheck-35.0/test/resources/language/elixir/mix.exs000066400000000000000000000003061500215546300226170ustar00rootroot00000000000000defmodule FlycheckTests.Mixfile do use Mix.Project def project do [app: :flycheck_tests, version: "0.0.1", deps: deps()] end def deps do [{:credo, "~> 0.9.2"}] end end flycheck-35.0/test/resources/language/emacs-lisp/000077500000000000000000000000001500215546300220435ustar00rootroot00000000000000flycheck-35.0/test/resources/language/emacs-lisp/check-declare-warnings.el000066400000000000000000000004531500215546300266670ustar00rootroot00000000000000;;; check-declare-warnings.el -- check-declare warnings -*- lexical-binding: t; -*- ;;; Commentary: ;; Test check-declare warnings ;;; Code: (declare-function this-function-is-not-declared "this-file-does-not-exist.el") (provide 'check-declare-warnings) ;;; check-declare-warnings.el ends here flycheck-35.0/test/resources/language/emacs-lisp/checkdoc-elisp-mode-regression.el000066400000000000000000000007271500215546300303500ustar00rootroot00000000000000;;; checkdoc-elisp-mode-regression.el -- This file will confuse an improperly configured checkdoc -*- lexical-binding: t; -*- ;;; Commentary: ;; Checkdoc uses the syntax table and comment syntax of the current buffer; if ;; not set properly, it gets confused by the code below. ;;; Code: (defun confusing-syntax () ?{) (defconst confusing-docstring ;; comment "a" ".") (provide 'checkdoc-elisp-mode-regression) ;;; checkdoc-elisp-mode-regression.el ends here flycheck-35.0/test/resources/language/emacs-lisp/errors-and-warnings.el000066400000000000000000000010271500215546300262670ustar00rootroot00000000000000;;; errors-and-warnings.el -- Trigger Emacs Lisp warnings -*- lexical-binding: t; -*- ;;; Commentary: ;; Trigger a checkdoc warning by omitting a period in the docstring of a ;; function. All these comments are to make checkdoc happy, which also checks ;; the general commenting style of an Emacs Lisp file. ;;; Code: (defun foobar () "Does nothing really useful" (dummy-package-foo)) (require 'dummy-package) (if t (message) (message "Hello foo")) (provide 'errors-and-warnings) ;;; errors-and-warnings.el ends here flycheck-35.0/test/resources/language/emacs-lisp/local-checkdoc-variables.el000066400000000000000000000012701500215546300271660ustar00rootroot00000000000000;;; local-checkdoc-variables.el -- Silence checkdoc warnings with file-local variables -*- lexical-binding: t; -*- ;;; Commentary: ;; Make sure that file-local checkdoc settings are properly propagated to ;; checkdoc process. There's only a single space between these sentences, but we ;; allow that in this file. ;;; Code: (defun imperative-mood () "Uses an imperative mood, which is wrong.") (defun arguments-in-wrong-order (a b) "Sum B and A." (+ a b)) ;; Local Variables: ;; checkdoc-arguments-in-order-flag: nil ;; checkdoc-verb-check-experimental-flag: nil ;; sentence-end-double-space: nil ;; End: (provide 'local-checkdoc-variables) ;;; local-checkdoc-variables.el ends here flycheck-35.0/test/resources/language/emacs-lisp/syntax-error.el000066400000000000000000000001711500215546300250410ustar00rootroot00000000000000;; A syntax error caused by a missing parenthesis -*- lexical-binding: t; -*- (message (concat "Hello " user-full-name) flycheck-35.0/test/resources/language/emacs-lisp/warnings.el000066400000000000000000000007351500215546300242220ustar00rootroot00000000000000;;; warnings.el -- Trigger Emacs Lisp warnings -*- lexical-binding: t; -*- ;;; Commentary: ;; Trigger a checkdoc warning by omitting a period in the docstring of a ;; function. All these comments are to make checkdoc happy, which also checks ;; the general commenting style of an Emacs Lisp file. ;;; Code: (defun foobar () "Does nothing really useful" (dummy-package-foo)) (if t (foobar 1) (message "Hello foo")) (provide 'warnings) ;;; warnings.el ends here flycheck-35.0/test/resources/language/emacs-lisp/warnings.el.gz000066400000000000000000000004721500215546300246370ustar00rootroot00000000000000Zwarnings.elMN0yQ.$Wڜ q lMb?ץ[RzvhaRa;(d=izTpc59uy 5z!SZuph`8\߄6 όⓜGPa8WM4%Fte}yz9WI*L8(5Mn+hT 0xo- flycheck-35.0/test/resources/language/ember-template-lint/ember-template-lint/warning.hbs000066400000000000000000000001421500215546300316640ustar00rootroot00000000000000This file only emits a warning because it has been marked as "pending" in the configuration file. flycheck-35.0/test/resources/language/erlang/000077500000000000000000000000001500215546300212565ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/erlang/000077500000000000000000000000001500215546300225265ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/erlang/error.erl000066400000000000000000000002471500215546300243660ustar00rootroot00000000000000%% Test an error from Erlang -module('erlang-error'). -compile(export_all). great_func() -> io:format("Flycheck is great!"); error_func() -> 'head-mismatch'. flycheck-35.0/test/resources/language/erlang/erlang/warning.erl000066400000000000000000000002271500215546300247000ustar00rootroot00000000000000%% Warning from Erlang -module('erlang-warning'). -compile(export_all). simple_warning() -> io:format("Flycheck is great!", ["unused argument"]). flycheck-35.0/test/resources/language/erlang/rebar3/000077500000000000000000000000001500215546300224345ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/rebar3/.gitignore000066400000000000000000000000221500215546300244160ustar00rootroot00000000000000_build rebar.lock flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/000077500000000000000000000000001500215546300245635ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/000077500000000000000000000000001500215546300267015ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/.gitignore000066400000000000000000000000331500215546300306650ustar00rootroot00000000000000_* ebin .rebar3 rebar.lock flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/rebar.config000066400000000000000000000000611500215546300311600ustar00rootroot00000000000000{erl_opts, [ return_warnings ]}. {deps, []}.flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/src/000077500000000000000000000000001500215546300274705ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/src/dependency.app.src000066400000000000000000000003541500215546300331000ustar00rootroot00000000000000{application, 'dependency', [{description, "An OTP library"}, {vsn, "0.1.0"}, {registered, []}, {applications, [kernel, stdlib ]}, {env,[]}, {modules, []}, {maintainers, []}, {licenses, []}, {links, []} ]}. flycheck-35.0/test/resources/language/erlang/rebar3/_checkouts/dependency/src/dependency.erl000066400000000000000000000000641500215546300323120ustar00rootroot00000000000000-module('dependency'). %% API exports -export([]). flycheck-35.0/test/resources/language/erlang/rebar3/rebar.config000066400000000000000000000000731500215546300247160ustar00rootroot00000000000000{erl_opts, [ return_warnings ]}. {deps, [dependency]}. flycheck-35.0/test/resources/language/erlang/rebar3/src/000077500000000000000000000000001500215546300232235ustar00rootroot00000000000000flycheck-35.0/test/resources/language/erlang/rebar3/src/erlang-error.erl000066400000000000000000000002471500215546300263310ustar00rootroot00000000000000%% Test an error from Erlang -module('erlang-error'). -compile(export_all). great_func() -> io:format("Flycheck is great!"); error_func() -> 'head-mismatch'. flycheck-35.0/test/resources/language/erlang/rebar3/src/erlang-rebar3.app.src000066400000000000000000000003571500215546300271440ustar00rootroot00000000000000{application, 'erlang-rebar3', [{description, "An OTP library"}, {vsn, "0.1.0"}, {registered, []}, {applications, [kernel, stdlib ]}, {env,[]}, {modules, []}, {maintainers, []}, {licenses, []}, {links, []} ]}. flycheck-35.0/test/resources/language/erlang/rebar3/src/erlang-rebar3.erl000066400000000000000000000005751500215546300263620ustar00rootroot00000000000000-module('erlang-rebar3'). %% API exports -export([]). %%==================================================================== %% API functions %%==================================================================== %%==================================================================== %% Internal functions %%==================================================================== flycheck-35.0/test/resources/language/eruby.erb000066400000000000000000000001511500215546300216230ustar00rootroot00000000000000 <%- (1..9).each do |y| -%> <%- err -%>
<%= y %>
flycheck-35.0/test/resources/language/fortran/000077500000000000000000000000001500215546300214615ustar00rootroot00000000000000flycheck-35.0/test/resources/language/fortran/error.f000066400000000000000000000000711500215546300227570ustar00rootroot00000000000000program hello print *, "hello world!" end_ program hello flycheck-35.0/test/resources/language/fortran/warning.f90000066400000000000000000000005371500215546300234530ustar00rootroot00000000000000function foo(dist, p) result(value) integer :: value integer, intent(in) :: dist integer, intent(in) :: p value = dist+value end function foo program hello interface subroutine bar(a,b) integer, intent(in) :: a integer, intent(out) :: b end subroutine bar end interface integer :: a call bar(a,a) end program hello flycheck-35.0/test/resources/language/go/000077500000000000000000000000001500215546300204135ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/000077500000000000000000000000001500215546300212025ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/b1/000077500000000000000000000000001500215546300215045ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/b1/main.go000066400000000000000000000001461500215546300227600ustar00rootroot00000000000000package main import ( "b2" "fmt" ) func main() { fmt.Println("from b1 I'm calling", b2.Call()) } flycheck-35.0/test/resources/language/go/src/b2/000077500000000000000000000000001500215546300215055ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/b2/b2.go000066400000000000000000000000601500215546300223330ustar00rootroot00000000000000package b2 func Call() string { return "b2" } flycheck-35.0/test/resources/language/go/src/errcheck/000077500000000000000000000000001500215546300227705ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/errcheck/errcheck.go000066400000000000000000000001451500215546300251050ustar00rootroot00000000000000package main import "os" func main() { f, _ := os.Open("enoent") f.Close() os.Stat("enoent") } flycheck-35.0/test/resources/language/go/src/megacheck/000077500000000000000000000000001500215546300231115ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/megacheck/megacheck1.go000066400000000000000000000004471500215546300254350ustar00rootroot00000000000000package main import "strings" func main() { // S1005 (gosimple) // xs is declared in a different file to ensure that test fails if megacheck is called incorrectly for _ = range xs { } // SA1018 (staticcheck) _ = strings.Replace("foo", "f", "b", 0) } // U1000 (unused) func unused() {} flycheck-35.0/test/resources/language/go/src/megacheck/megacheck2.go000066400000000000000000000000461500215546300254310ustar00rootroot00000000000000package main var xs = []int{1, 2, 3} flycheck-35.0/test/resources/language/go/src/staticcheck/000077500000000000000000000000001500215546300234675ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/staticcheck/staticcheck1.go000066400000000000000000000004471500215546300263710ustar00rootroot00000000000000package main import "strings" func main() { // S1005 (gosimple) // xs is declared in a different file to ensure that test fails if megacheck is called incorrectly for _ = range xs { } // SA1018 (staticcheck) _ = strings.Replace("foo", "f", "b", 0) } // U1000 (unused) func unused() {} flycheck-35.0/test/resources/language/go/src/staticcheck/staticcheck2.go000066400000000000000000000000461500215546300263650ustar00rootroot00000000000000package main var xs = []int{1, 2, 3} flycheck-35.0/test/resources/language/go/src/syntax/000077500000000000000000000000001500215546300225305ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/syntax/syntax-error.go000066400000000000000000000000761500215546300255370ustar00rootroot00000000000000// A simple syntax error in Go package main func ta ta() { }flycheck-35.0/test/resources/language/go/src/test/000077500000000000000000000000001500215546300221615ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/test/test-error_test.go000066400000000000000000000001751500215546300256600ustar00rootroot00000000000000// A simple import error in Go test file package main import "testing" func TestFoo(t *testing.T) { fmt.Println("foo") } flycheck-35.0/test/resources/language/go/src/unconvert/000077500000000000000000000000001500215546300232255ustar00rootroot00000000000000flycheck-35.0/test/resources/language/go/src/unconvert/unconvert.go000066400000000000000000000001141500215546300255730ustar00rootroot00000000000000package main import "fmt" func main() { var x int fmt.Println(int(x)) } flycheck-35.0/test/resources/language/go/src/warnings.go000066400000000000000000000004531500215546300233630ustar00rootroot00000000000000package testpackage import ( . "fmt" ) func Warn(a ...interface{}) { fmt.Printf(a...) } func Warnf(prefix string, format string, a ...interface{}) { fmt.Printf(format, a...) } func foo() { fmt.Printf("%s", 1) Warn("%s") Warnf("d", 1) return if true { return } else { return } } flycheck-35.0/test/resources/language/groovy.groovy000066400000000000000000000000361500215546300226010ustar00rootroot00000000000000class Foo { def foo( {} } flycheck-35.0/test/resources/language/haml/000077500000000000000000000000001500215546300207275ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haml/haml-error.haml000066400000000000000000000001321500215546300236360ustar00rootroot00000000000000-# A syntax error caused by inconsistent indentation %html %head %title Bad indent! flycheck-35.0/test/resources/language/haml/ruby-error.haml000066400000000000000000000000161500215546300236770ustar00rootroot00000000000000- foo.each do flycheck-35.0/test/resources/language/handlebars.hbs000066400000000000000000000001121500215546300226010ustar00rootroot00000000000000

{{! This comment will not be in the output }
flycheck-35.0/test/resources/language/haskell/000077500000000000000000000000001500215546300214315ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haskell/.gitignore000066400000000000000000000000141500215546300234140ustar00rootroot00000000000000.stack-work flycheck-35.0/test/resources/language/haskell/Error.hs000066400000000000000000000000751500215546300230600ustar00rootroot00000000000000module Haskell.Error where foo :: IO () foo = putStrLn True flycheck-35.0/test/resources/language/haskell/Literate.lhs000066400000000000000000000001351500215546300237110ustar00rootroot00000000000000Literate Haskell test. \begin{code} module Literate (foo) where foo = undefined \end{code} flycheck-35.0/test/resources/language/haskell/SyntaxError.hs000066400000000000000000000000501500215546300242600ustar00rootroot00000000000000bogus module Haskell.SyntaxError where flycheck-35.0/test/resources/language/haskell/Warnings.hs000066400000000000000000000001661500215546300235600ustar00rootroot00000000000000module Haskell.Warnings (spam, main) where spam eggs = map lines eggs main :: IO () main = (putStrLn "hello world") flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yaml/000077500000000000000000000000001500215546300306275ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yaml/src/000077500000000000000000000000001500215546300314165ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yaml/src/Foo.hs000066400000000000000000000000611500215546300324720ustar00rootroot00000000000000module Foo (foo) where foo :: a -> a foo x = x stack-nonstandard.yaml000066400000000000000000000000451500215546300350510ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yamlresolver: lts-9.0 packages: - "." stack-project-with-renamed-stack-yaml.cabal000066400000000000000000000010151500215546300407270ustar00rootroot00000000000000flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yaml-- Created : 24 October 2017 name: stack-project-with-renamed-stack-yaml version: 0.1.0.0 license: BSD3 cabal-version: >= 1.16 build-type: Simple library exposed-modules: Foo hs-source-dirs: src build-depends: base >= 4.4 default-language: Haskell2010 ghc-options: -Wall -fwarn-name-shadowing -Wincomplete-uni-patterns -Wincomplete-record-updates -fno-warn-type-defaults if impl(ghc >= 8.0) ghc-options: -Wcompat ghc-prof-options: -fprof-auto flycheck-35.0/test/resources/language/haskell/stack-project-with-renamed-stack-yaml/stack.yaml000066400000000000000000000000541500215546300326170ustar00rootroot00000000000000resolver: invalid-resolver packages: - "." flycheck-35.0/test/resources/language/html.html000066400000000000000000000002141500215546300216350ustar00rootroot00000000000000 Hello world flycheck-35.0/test/resources/language/javascript/000077500000000000000000000000001500215546300221545ustar00rootroot00000000000000flycheck-35.0/test/resources/language/javascript/.eslintrc.json000066400000000000000000000000761500215546300247530ustar00rootroot00000000000000{ "rules" : { "strict": 1, "no-unused-vars": 1 } }flycheck-35.0/test/resources/language/javascript/eslint.json000066400000000000000000000001131500215546300243400ustar00rootroot00000000000000{ "rules" : { "strict": 1, "no-unused-vars": 1 } } flycheck-35.0/test/resources/language/javascript/jshintrc000066400000000000000000000000331500215546300237170ustar00rootroot00000000000000{ "unused": "strict" } flycheck-35.0/test/resources/language/javascript/style.js000066400000000000000000000001101500215546300236420ustar00rootroot00000000000000/** Tab indentation */ (function() { var foo = ["Hello world"]; }()); flycheck-35.0/test/resources/language/javascript/syntax-error.js000066400000000000000000000000661500215546300251710ustar00rootroot00000000000000/** A bad if */ if ( /* nothing here */ ) // comment flycheck-35.0/test/resources/language/javascript/warnings.js000066400000000000000000000001511500215546300243370ustar00rootroot00000000000000/** An unused variable, and some invalid spacing */ (function() { var foo = ["Hello world" ]; }()); flycheck-35.0/test/resources/language/json.json000066400000000000000000000001271500215546300216520ustar00rootroot00000000000000{ "Comment": "Test two top-level objects" }, { "Comment": "This object is misplaced" } flycheck-35.0/test/resources/language/jsonnet/000077500000000000000000000000001500215546300214665ustar00rootroot00000000000000flycheck-35.0/test/resources/language/jsonnet/runtime_error.jsonnet000066400000000000000000000000241500215546300257600ustar00rootroot00000000000000{ a: std.flat() } flycheck-35.0/test/resources/language/jsonnet/static_error.jsonnet000066400000000000000000000000251500215546300255650ustar00rootroot00000000000000import ||| xyz ||| flycheck-35.0/test/resources/language/less/000077500000000000000000000000001500215546300207545ustar00rootroot00000000000000flycheck-35.0/test/resources/language/less/file-error.less000066400000000000000000000000751500215546300237140ustar00rootroot00000000000000.something {} @import "no-such-file.less"; #otherthing { } flycheck-35.0/test/resources/language/less/syntax-error.less000066400000000000000000000000171500215546300243170ustar00rootroot00000000000000.{something {} flycheck-35.0/test/resources/language/llvm.ll000066400000000000000000000001721500215546300213110ustar00rootroot00000000000000define i32 @mul_add(i32 %x, i32 %y, i32 %z) { entry: %tmp = mul i32 %x, %y %tmp2 = add i64 %tmp, %z ret i32 %tmp2 } flycheck-35.0/test/resources/language/lua/000077500000000000000000000000001500215546300205675ustar00rootroot00000000000000flycheck-35.0/test/resources/language/lua/custom.luacheckrc000066400000000000000000000000241500215546300241230ustar00rootroot00000000000000unused_args = false flycheck-35.0/test/resources/language/lua/ngx_lua.warnings.lua000066400000000000000000000002111500215546300245500ustar00rootroot00000000000000local name = ngx.var.arg_name or "Anonymous" local function test(arg) local var2 return var2 end ngx.say("Hello, ", name, "!") flycheck-35.0/test/resources/language/lua/syntax-error.lua000066400000000000000000000001431500215546300237450ustar00rootroot00000000000000-- A syntax error caused by a missing quote -- -- Checkers: lua print "oh no print "hello world" flycheck-35.0/test/resources/language/lua/warnings.lua000066400000000000000000000001141500215546300231160ustar00rootroot00000000000000global_var = 1 local function test(arg) local var2 return var2 end flycheck-35.0/test/resources/language/markdown.md000066400000000000000000000000571500215546300221540ustar00rootroot00000000000000## Second Header First Trailing space flycheck-35.0/test/resources/language/nix/000077500000000000000000000000001500215546300206045ustar00rootroot00000000000000flycheck-35.0/test/resources/language/nix/syntax-error.nix000066400000000000000000000000431500215546300237760ustar00rootroot00000000000000let number = 42 in number * 10 flycheck-35.0/test/resources/language/nix/warnings.nix000066400000000000000000000000441500215546300231520ustar00rootroot00000000000000let x = 5; in rec { inherit x; }flycheck-35.0/test/resources/language/opam.opam000066400000000000000000000000771500215546300216240ustar00rootroot00000000000000opam-version: "2.0" maintainers: "John Doe " flycheck-35.0/test/resources/language/perl.pl000066400000000000000000000001301500215546300212770ustar00rootroot00000000000000package perl; use strict; use warnings; $x = <*.pl>; system('ls'); die if undef; 1; flycheck-35.0/test/resources/language/perl/000077500000000000000000000000001500215546300207505ustar00rootroot00000000000000flycheck-35.0/test/resources/language/perl/DependencyA.pm000066400000000000000000000001511500215546300234620ustar00rootroot00000000000000package DependencyA; use parent Exporter; @EXPORT = qw($dependency_a); our $dependency_a = 'foo'; 1; flycheck-35.0/test/resources/language/perl/DependencyB.pm000066400000000000000000000001511500215546300234630ustar00rootroot00000000000000package DependencyB; use parent Exporter; @EXPORT = qw($dependency_b); our $dependency_b = 'bar'; 1; flycheck-35.0/test/resources/language/perl/Script.pl000066400000000000000000000000731500215546300225510ustar00rootroot00000000000000use strict; print $dependency_a; print $dependency_b; 1; flycheck-35.0/test/resources/language/php/000077500000000000000000000000001500215546300205755ustar00rootroot00000000000000flycheck-35.0/test/resources/language/php/syntax-error.php000066400000000000000000000002501500215546300237600ustar00rootroot00000000000000flycheck-35.0/test/resources/language/php/warnings.php000066400000000000000000000007671500215546300231500ustar00rootroot00000000000000 * @license http://www.gnu.org/licenses/gpl.html GPL-3 * @link https://github.com/flycheck/flycheck */ class A { private static $FOO = 2; /** Does nothing useful */ private function bar($baz) { $i=FALSE; } } ?> flycheck-35.0/test/resources/language/processing/000077500000000000000000000000001500215546300221625ustar00rootroot00000000000000flycheck-35.0/test/resources/language/processing/syntax_error/000077500000000000000000000000001500215546300247215ustar00rootroot00000000000000flycheck-35.0/test/resources/language/processing/syntax_error/syntax_error.pde000066400000000000000000000001051500215546300301460ustar00rootroot00000000000000void setup(){ size(100, 100); background(100) } void draw(){ } flycheck-35.0/test/resources/language/protobuf/000077500000000000000000000000001500215546300216465ustar00rootroot00000000000000flycheck-35.0/test/resources/language/protobuf/protobuf/000077500000000000000000000000001500215546300235065ustar00rootroot00000000000000flycheck-35.0/test/resources/language/protobuf/protobuf/syntax-error.proto000066400000000000000000000000531500215546300272460ustar00rootroot00000000000000message Person { required string name; } flycheck-35.0/test/resources/language/protobuf/prototool/000077500000000000000000000000001500215546300237075ustar00rootroot00000000000000flycheck-35.0/test/resources/language/protobuf/prototool/missing_syntax.proto000066400000000000000000000000611500215546300300500ustar00rootroot00000000000000package foo; message Bar { int64 hello = 1; } flycheck-35.0/test/resources/language/protobuf/prototool/prototool.yaml000066400000000000000000000000001500215546300266220ustar00rootroot00000000000000flycheck-35.0/test/resources/language/pug/000077500000000000000000000000001500215546300206015ustar00rootroot00000000000000flycheck-35.0/test/resources/language/pug/foo-base.pug000066400000000000000000000000451500215546300230100ustar00rootroot00000000000000html head body block content flycheck-35.0/test/resources/language/pug/foo-unknown-filter.pug000066400000000000000000000000121500215546300250520ustar00rootroot00000000000000:myfilter flycheck-35.0/test/resources/language/pug/foo.pug000066400000000000000000000002241500215546300220770ustar00rootroot00000000000000extends foo-base block content h1 Hello World h2 Some h2 content h3 Some h3 content h4 Some h4 content h5 This is going to cause an error flycheck-35.0/test/resources/language/pug/pug-extends.pug000066400000000000000000000000741500215546300235620ustar00rootroot00000000000000extends /foo/bar/baz.pug block content h2 This is content flycheck-35.0/test/resources/language/pug/pug-runtime-error.pug000066400000000000000000000000611500215546300247160ustar00rootroot00000000000000doctype html html head body h1=foo.bar flycheck-35.0/test/resources/language/pug/pug.pug000066400000000000000000000001221500215546300221040ustar00rootroot00000000000000doctype html html head title Pug Examples body h1 Markup example flycheck-35.0/test/resources/language/puppet/000077500000000000000000000000001500215546300213235ustar00rootroot00000000000000flycheck-35.0/test/resources/language/puppet/parser-error.pp000066400000000000000000000001201500215546300243000ustar00rootroot00000000000000# Test single line error message class {'parser_err1': hello > 'something', } flycheck-35.0/test/resources/language/puppet/puppet3-parser-error.pp000066400000000000000000000001651500215546300257070ustar00rootroot00000000000000# Test that the missing comma error is parsed class {'parser_error': hello => 'test' helloagain => 'test' } flycheck-35.0/test/resources/language/puppet/puppet3-parser-multiline-error.pp000066400000000000000000000002001500215546300276750ustar00rootroot00000000000000# Test that the multiline error output of puppet parser is parsed file { 'test': ensure => file, contents => something' } flycheck-35.0/test/resources/language/puppet/warnings.pp000066400000000000000000000002371500215546300235160ustar00rootroot00000000000000# Class: foo::bar class foo::bar { case $::operatingsystem { debian: { $version = '1.2.3' } redhat: { $version = '6.6.6' } } } flycheck-35.0/test/resources/language/python/000077500000000000000000000000001500215546300213275ustar00rootroot00000000000000flycheck-35.0/test/resources/language/python/__init__.py000066400000000000000000000000661500215546300234420ustar00rootroot00000000000000# -*- coding: utf-8; -*- def antigravity(): pass flycheck-35.0/test/resources/language/python/gh_1383.py000066400000000000000000000001541500215546300227550ustar00rootroot00000000000000# pylint: disable=missing-module-docstring import sys # This has column 0 """ This error has column -1 """ flycheck-35.0/test/resources/language/python/invalid_type.py000066400000000000000000000000451500215546300243670ustar00rootroot00000000000000def foo(x: str) -> int: return x flycheck-35.0/test/resources/language/python/syntax-error.py000066400000000000000000000000541500215546300243550ustar00rootroot00000000000000# A straight syntax error foo = import bar flycheck-35.0/test/resources/language/python/test.py000066400000000000000000000006431500215546300226630ustar00rootroot00000000000000# -*- coding: utf-8; -*- import sys from . import antigravit # Typo intended! class Spam(object): def withEggs(self, number_of_eggs): return map(str, range(number_of_eggs)) def with_ham(self, blubb = None): if blubb: if sys.python_version[0] > 3: print('yes') else: print('no') else: return 'foo' antigravity() flycheck-35.0/test/resources/language/r.R000066400000000000000000000002111500215546300203640ustar00rootroot00000000000000a <- function(file, b = 2) {cat("Hello World!\\n", file=file) } b <- function() { "/absolute/path/to/file" } b <- function() { b flycheck-35.0/test/resources/language/racket.rkt000066400000000000000000000002751500215546300220050ustar00rootroot00000000000000(define listener (tcp-listen 12345)) (let echo-server () (define-values (in out) (tcp-accept listener)) (thread (lambda () (copy-port in out) (close-output-port out)) flycheck-35.0/test/resources/language/rpm.spec000066400000000000000000000003341500215546300214600ustar00rootroot00000000000000Name: foo Version: 1 Release: 1 License: GPL Summary: test spec file BuildArch: x86_64 %description %prep %build %clean %install %changelog * Tue Nov 6 2012 John Doe - 2 - %{_bindir} is cool flycheck-35.0/test/resources/language/rst/000077500000000000000000000000001500215546300206165ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rst/errors.rst000066400000000000000000000003461500215546300226670ustar00rootroot00000000000000============= Hello world ============= Lorem ipsum. A title with short underline ==== .. warning:: Foo === Let us check ReStructuredText_. Oh now, this one is too ---- Really, it's cool_! .. note:: Bar === flycheck-35.0/test/resources/language/rst/sphinx/000077500000000000000000000000001500215546300221275ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rst/sphinx/conf.py000066400000000000000000000003411500215546300234240ustar00rootroot00000000000000# -*- coding: utf-8 -*- # Simple dummy Sphinx configuration source_suffix = '.rst' master_doc = 'index' # General information about the project. project = u'rst-sphinx' copyright = u'2014, Foo' version = '0' release = '0' flycheck-35.0/test/resources/language/rst/sphinx/index.rst000066400000000000000000000001741500215546300237720ustar00rootroot00000000000000An dummy documentation =================== Contents: .. toctree:: :maxdepth: 2 Really, it's cool_ with :envvar:`FOO`! flycheck-35.0/test/resources/language/ruby/000077500000000000000000000000001500215546300207675ustar00rootroot00000000000000flycheck-35.0/test/resources/language/ruby/syntax-error.rb000066400000000000000000000002101500215546300237620ustar00rootroot00000000000000# A syntax error caused by a missing quote # Taken from http://stackoverflow.com/a/7317453/355252 days = "abc puts "Here are the days" flycheck-35.0/test/resources/language/ruby/warnings.rb000066400000000000000000000003401500215546300231410ustar00rootroot00000000000000# A bunch of questionable Ruby stuff class Person def initialize(_name) arr = [:one, :twoTho, :top_gun] puts "test" end def greet if true then return "Hello, #{@name}" end end end test == 20 flycheck-35.0/test/resources/language/rust/000077500000000000000000000000001500215546300210035ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/.gitignore000066400000000000000000000000341500215546300227700ustar00rootroot00000000000000# Ignore Cargo stuff target/flycheck-35.0/test/resources/language/rust/cargo-targets/000077500000000000000000000000001500215546300235455ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/Cargo.lock000066400000000000000000000002211500215546300254450ustar00rootroot00000000000000# This file is automatically @generated by Cargo. # It is not intended for manual editing. [[package]] name = "cargo-targets" version = "0.1.0" flycheck-35.0/test/resources/language/rust/cargo-targets/Cargo.toml000066400000000000000000000000631500215546300254740ustar00rootroot00000000000000[package] name = "cargo-targets" version = "0.1.0" flycheck-35.0/test/resources/language/rust/cargo-targets/benches/000077500000000000000000000000001500215546300251545ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/benches/a.rs000066400000000000000000000001241500215546300257370ustar00rootroot00000000000000fn main() { let foo_bench_a = 0; } #[test] fn test() { let foo_bench_a_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/examples/000077500000000000000000000000001500215546300253635ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/examples/a.rs000066400000000000000000000001161500215546300261470ustar00rootroot00000000000000fn main() { let foo_ex_a = 0; } #[test] fn test() { let foo_ex_a_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/src/000077500000000000000000000000001500215546300243345ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/src/a.rs000066400000000000000000000000711500215546300251200ustar00rootroot00000000000000fn foo_a() {} #[test] fn test() { let foo_a_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/src/bin/000077500000000000000000000000001500215546300251045ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/src/bin/a.rs000066400000000000000000000001201500215546300256630ustar00rootroot00000000000000fn main() { let foo_bin_a = 0; } #[test] fn test() { let foo_bin_a_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/src/lib.rs000066400000000000000000000001051500215546300254440ustar00rootroot00000000000000mod a; fn foo_lib() {} #[test] fn test() { let foo_lib_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/src/main.rs000066400000000000000000000001161500215546300256240ustar00rootroot00000000000000fn main() { let foo_main = 0; } #[test] fn test() { let foo_main_test = 0; } flycheck-35.0/test/resources/language/rust/cargo-targets/tests/000077500000000000000000000000001500215546300247075ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/cargo-targets/tests/a.rs000066400000000000000000000001021500215546300254660ustar00rootroot00000000000000#[test] fn foo() { let foo_test_a_test = 0; } fn foo_test_a() {} flycheck-35.0/test/resources/language/rust/dev-deps/000077500000000000000000000000001500215546300225125ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/dev-deps/Cargo.lock000066400000000000000000000010071500215546300244150ustar00rootroot00000000000000# This file is automatically @generated by Cargo. # It is not intended for manual editing. [[package]] name = "dev-deps" version = "0.1.0" dependencies = [ "lazy_static 0.2.6 (registry+https://github.com/rust-lang/crates.io-index)", ] [[package]] name = "lazy_static" version = "0.2.6" source = "registry+https://github.com/rust-lang/crates.io-index" [metadata] "checksum lazy_static 0.2.6 (registry+https://github.com/rust-lang/crates.io-index)" = "2f61b8421c7a4648c391611625d56fdd5c7567da05af1be655fd8cacc643abb3" flycheck-35.0/test/resources/language/rust/dev-deps/Cargo.toml000066400000000000000000000001501500215546300244360ustar00rootroot00000000000000[package] name = "dev-deps" version = "0.1.0" [dependencies] [dev-dependencies] lazy_static = "0.2.2" flycheck-35.0/test/resources/language/rust/dev-deps/src/000077500000000000000000000000001500215546300233015ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/dev-deps/src/lib.rs000066400000000000000000000001641500215546300244160ustar00rootroot00000000000000#[cfg(test)] #[macro_use] extern crate lazy_static; mod tests { #[test] fn it_works() { let foo = 0; } } flycheck-35.0/test/resources/language/rust/flycheck-test/000077500000000000000000000000001500215546300235505ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/flycheck-test/Cargo.lock000066400000000000000000000002211500215546300254500ustar00rootroot00000000000000# This file is automatically @generated by Cargo. # It is not intended for manual editing. [[package]] name = "flycheck-test" version = "0.1.0" flycheck-35.0/test/resources/language/rust/flycheck-test/Cargo.toml000066400000000000000000000000631500215546300254770ustar00rootroot00000000000000[package] name = "flycheck-test" version = "0.1.0" flycheck-35.0/test/resources/language/rust/flycheck-test/src/000077500000000000000000000000001500215546300243375ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/flycheck-test/src/imported.rs000066400000000000000000000000321500215546300265230ustar00rootroot00000000000000pub static BAR: u32 = 42; flycheck-35.0/test/resources/language/rust/flycheck-test/src/importing.rs000066400000000000000000000001371500215546300267160ustar00rootroot00000000000000use super::imported; pub fn foo() { let x = "10"; println!("hey {}", imported::BAR); } flycheck-35.0/test/resources/language/rust/flycheck-test/src/macro-error.rs000066400000000000000000000000371500215546300271350ustar00rootroot00000000000000fn foo() { println!("{}"); } flycheck-35.0/test/resources/language/rust/flycheck-test/src/main.rs000066400000000000000000000002461500215546300256330ustar00rootroot00000000000000mod imported; mod importing; mod warnings; pub fn main() { // Prevent an unused function foo() warning :) importing::foo(); println!("Hello, world!"); } flycheck-35.0/test/resources/language/rust/flycheck-test/src/multiline-error.rs000066400000000000000000000001251500215546300300340ustar00rootroot00000000000000fn foo(bar: u8) -> u8 { bar + 1 } fn spam() { let i: i8 = -1; foo(i); } flycheck-35.0/test/resources/language/rust/flycheck-test/src/note-and-help.rs000066400000000000000000000004131500215546300273360ustar00rootroot00000000000000// a note/info about lifetimes // a non-POD type struct NonPOD; impl Drop for NonPOD { fn drop(&mut self) {} } fn main() { let _x = NonPOD; let _y = _x; // note: x's lifetime ends here let _z = _x; // error: can no longer move x } flycheck-35.0/test/resources/language/rust/flycheck-test/src/syntax-error.rs000066400000000000000000000000611500215546300273570ustar00rootroot00000000000000// A simple syntax error fn main() { bla; } flycheck-35.0/test/resources/language/rust/flycheck-test/src/warnings.rs000066400000000000000000000001051500215546300265310ustar00rootroot00000000000000// A warning for an unused variable fn main() { let x = true; } flycheck-35.0/test/resources/language/rust/lib-main/000077500000000000000000000000001500215546300224735ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/lib-main/Cargo.lock000066400000000000000000000002141500215546300243750ustar00rootroot00000000000000# This file is automatically @generated by Cargo. # It is not intended for manual editing. [[package]] name = "lib-main" version = "0.1.0" flycheck-35.0/test/resources/language/rust/lib-main/Cargo.toml000066400000000000000000000000551500215546300244230ustar00rootroot00000000000000[package] name = "lib-main" version = "0.1.0"flycheck-35.0/test/resources/language/rust/lib-main/src/000077500000000000000000000000001500215546300232625ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/lib-main/src/lib.rs000066400000000000000000000002551500215546300244000ustar00rootroot00000000000000// Doesn't compile, but since lib.rs is an implicit dependency of main.rs, this // will cause an error when using `cargo rustc -- --error-format=json`. fn foo() { zorglub } flycheck-35.0/test/resources/language/rust/lib-main/src/main.rs000066400000000000000000000000361500215546300245530ustar00rootroot00000000000000fn main() { let unused = 0; } flycheck-35.0/test/resources/language/rust/workspace/000077500000000000000000000000001500215546300230015ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/workspace/Cargo.lock000066400000000000000000000002121500215546300247010ustar00rootroot00000000000000# This file is automatically @generated by Cargo. # It is not intended for manual editing. [[package]] name = "crate1" version = "0.1.0" flycheck-35.0/test/resources/language/rust/workspace/Cargo.toml000066400000000000000000000000411500215546300247240ustar00rootroot00000000000000[workspace] members = ["crate1"] flycheck-35.0/test/resources/language/rust/workspace/crate1/000077500000000000000000000000001500215546300241605ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/workspace/crate1/Cargo.toml000066400000000000000000000000541500215546300261070ustar00rootroot00000000000000[package] name = "crate1" version = "0.1.0" flycheck-35.0/test/resources/language/rust/workspace/crate1/src/000077500000000000000000000000001500215546300247475ustar00rootroot00000000000000flycheck-35.0/test/resources/language/rust/workspace/crate1/src/lib.rs000066400000000000000000000000331500215546300260570ustar00rootroot00000000000000fn main() { let a = 0; } flycheck-35.0/test/resources/language/sass/000077500000000000000000000000001500215546300207575ustar00rootroot00000000000000flycheck-35.0/test/resources/language/sass/error.sass000066400000000000000000000001041500215546300227760ustar00rootroot00000000000000// A syntax error caused by inconsistent indentation .a .b .c flycheck-35.0/test/resources/language/sass/warning.sass000066400000000000000000000000721500215546300233160ustar00rootroot00000000000000.container @warn "this is deprecated" font-size: 18px flycheck-35.0/test/resources/language/scala/000077500000000000000000000000001500215546300210715ustar00rootroot00000000000000flycheck-35.0/test/resources/language/scala/scalastyle.xml000066400000000000000000000006511500215546300237610ustar00rootroot00000000000000 Scalastyle test configuration Don't use println flycheck-35.0/test/resources/language/scala/style-error.scala000066400000000000000000000001531500215546300243640ustar00rootroot00000000000000// Scala style error object Error { def main(args:Array[String]): Unit = println("hello, world") } flycheck-35.0/test/resources/language/scala/style-warning.scala000066400000000000000000000001041500215546300246740ustar00rootroot00000000000000// Scala style warning object Warning { class WarningClass {} } flycheck-35.0/test/resources/language/scala/syntax-error.scala000066400000000000000000000000741500215546300245540ustar00rootroot00000000000000// Scala syntax error object { println("hello, world") } flycheck-35.0/test/resources/language/scss/000077500000000000000000000000001500215546300207615ustar00rootroot00000000000000flycheck-35.0/test/resources/language/scss/error.scss000066400000000000000000000000671500215546300230120ustar00rootroot00000000000000#container { &.error { c olor: red; } }flycheck-35.0/test/resources/language/scss/lint-error.scss000066400000000000000000000000671500215546300237560ustar00rootroot00000000000000#container { &.error { color: red; } } flycheck-35.0/test/resources/language/scss/scss-lint.yml000066400000000000000000000001651500215546300234250ustar00rootroot00000000000000--- linters: ColorVariable: enabled: false IdSelector: severity: error Indentation: enabled: false flycheck-35.0/test/resources/language/scss/warning.scss000066400000000000000000000001061500215546300233200ustar00rootroot00000000000000.container { @warn '.container is deprecated'; font-size: 18px; } flycheck-35.0/test/resources/language/sh/000077500000000000000000000000001500215546300204205ustar00rootroot00000000000000flycheck-35.0/test/resources/language/sh/bash-syntax-error.bash000066400000000000000000000000641500215546300246470ustar00rootroot00000000000000#!/bin/bash if true then echo "Hello World" fi flycheck-35.0/test/resources/language/sh/posix-syntax-error.sh000066400000000000000000000000341500215546300245660ustar00rootroot00000000000000#!/bin/sh cat <(echo blah) flycheck-35.0/test/resources/language/sh/shellcheck.sh000066400000000000000000000000731500215546300230610ustar00rootroot00000000000000#!/bin/sh rm "~/my file.txt" touch $@ export LS=`which ls` flycheck-35.0/test/resources/language/sh/zsh-syntax-error.zsh000066400000000000000000000000621500215546300244230ustar00rootroot00000000000000#!/bin/zsh if true then echo "Hello World" fi flycheck-35.0/test/resources/language/slim.slim000066400000000000000000000001211500215546300216320ustar00rootroot00000000000000doctype html html head title Slim Examples body h1 Markup examples flycheck-35.0/test/resources/language/sql.sql000066400000000000000000000000211500215546300213170ustar00rootroot00000000000000SELECT 1 FROM '; flycheck-35.0/test/resources/language/systemd-analyze-test.service000066400000000000000000000001671500215546300255020ustar00rootroot00000000000000[Unit] Description=Test file for flycheck systemd-analyze checker Documentation=foo://bar [Service] ExecSmart= [Dog] flycheck-35.0/test/resources/language/tcl/000077500000000000000000000000001500215546300205705ustar00rootroot00000000000000flycheck-35.0/test/resources/language/tcl/test.tcl000066400000000000000000000002201500215546300222450ustar00rootroot00000000000000#!tclsh set vals {1 2 3} foreach val $vals { puts $val set tmp [expr $val * 3] set val_${val} $tmp puts [set val_${val}] } set tmp 1 2 3 flycheck-35.0/test/resources/language/terraform/000077500000000000000000000000001500215546300220075ustar00rootroot00000000000000flycheck-35.0/test/resources/language/terraform/terraform/000077500000000000000000000000001500215546300240105ustar00rootroot00000000000000flycheck-35.0/test/resources/language/terraform/terraform/syntax-error.tf000066400000000000000000000000531500215546300270160ustar00rootroot00000000000000provider "aws" { region = "us-east-1"; } flycheck-35.0/test/resources/language/terraform/tflint/000077500000000000000000000000001500215546300233075ustar00rootroot00000000000000flycheck-35.0/test/resources/language/terraform/tflint/error.tf000066400000000000000000000002641500215546300247750ustar00rootroot00000000000000module "unpinned" { source = "git://hashicorp.com/consul.git" } resource "aws_instance" "web" { ami = "ami-b73b63a0" instance_type = "t1.2xlarge" # invalid type } flycheck-35.0/test/resources/language/tex.tex000066400000000000000000000001621500215546300213270ustar00rootroot00000000000000\documentclass{article} \begin{document} Hello, Emacs is part of GNU. Do you like it? \foo{ } \end{document} flycheck-35.0/test/resources/language/texinfo.texi000066400000000000000000000001401500215546300223500ustar00rootroot00000000000000\input texinfo @setfilename texinfo.info @settitle @contents @bold{foo} @printindex cp @bye flycheck-35.0/test/resources/language/text/000077500000000000000000000000001500215546300207725ustar00rootroot00000000000000flycheck-35.0/test/resources/language/text/text.txt000066400000000000000000000001101500215546300225070ustar00rootroot00000000000000he is very smart we associate together The lady lawyer handled my case. flycheck-35.0/test/resources/language/text/textlintrc.json000066400000000000000000000000641500215546300240650ustar00rootroot00000000000000{ "rules": { "write-good": true } } flycheck-35.0/test/resources/language/typescript/000077500000000000000000000000001500215546300222145ustar00rootroot00000000000000flycheck-35.0/test/resources/language/typescript/package.json000066400000000000000000000000641500215546300245020ustar00rootroot00000000000000{ "devDependencies": { "mocha": "^3.0.0" } }flycheck-35.0/test/resources/language/typescript/sample.ts000066400000000000000000000002161500215546300240440ustar00rootroot00000000000000import * as mocha from 'mocha'; import * as chai from 'chai'; function invalidAlignment() { var a:string = "test string"; alert('Hi!') } flycheck-35.0/test/resources/language/typescript/tslint.json000066400000000000000000000001661500215546300244270ustar00rootroot00000000000000{ "rules": { "no-var-keyword": true, "semicolon": true, "no-implicit-dependencies": [true, "dev"] } } flycheck-35.0/test/resources/language/verilog/000077500000000000000000000000001500215546300214555ustar00rootroot00000000000000flycheck-35.0/test/resources/language/verilog/verilator_error.v000066400000000000000000000002011500215546300250550ustar00rootroot00000000000000module verilog_verilator_error; initial begin forever begin i = $fopen("test.log"); end end endmodule flycheck-35.0/test/resources/language/verilog/verilator_warning.v000066400000000000000000000000601500215546300253740ustar00rootroot00000000000000module verilator_warning; reg val; endmodule flycheck-35.0/test/resources/language/vhdl.vhd000066400000000000000000000000601500215546300214420ustar00rootroot00000000000000entity syntax_error is end entity syntax_error flycheck-35.0/test/resources/language/xml.xml000066400000000000000000000001651500215546300213320ustar00rootroot00000000000000 flycheck-35.0/test/resources/language/yaml.yaml000066400000000000000000000000741500215546300216350ustar00rootroot00000000000000# A simple syntax error in YAML A: foo a1: bar a2: baz flycheck-35.0/test/resources/narrowing.el000066400000000000000000000005161500215546300205550ustar00rootroot00000000000000;;; narrowing.el --- Trigger errors with narrowing ;;; Commentary: ;; A file to test narrowing ;;; Code: (message "We are before of narrowing here: %s") (defun we-narrow-to-this-function () "This docstring has no final period" (message "Hello %s")) (message "We are after of narrowing here: %s") ;;; narrowing.el ends here flycheck-35.0/test/resources/substitute-dummy000066400000000000000000000000761500215546300215150ustar00rootroot00000000000000A dummy file used in substitution tests in test-checker-api.elflycheck-35.0/test/run.el000066400000000000000000000126461500215546300153500ustar00rootroot00000000000000;;; run.el --- Flycheck: Test runner -*- lexical-binding: t; -*- ;; Copyright (C) 2017-2018 Flycheck contributors ;; Copyright (C) 2014-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; Maintainer: Clément Pit-Claudel ;; fmdkdd ;; URL: https://www.flycheck.org ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Flycheck test runner. ;;; Code: (defun flycheck-run-check-selector (selector) "Check SELECTOR if it fails loading." (with-temp-buffer (insert selector) (goto-char (point-min)) (condition-case nil (progn (check-parens) (message "Invalid selector: %S" selector)) (error (message "Unbalanced parenthesis in selector %S at %s" selector (1+ (current-column))))))) (defun flycheck-transform-selector (selector) "Transform SELECTOR to implement some custom selectors. This function adds the following custom selectors: `(language FOO)' -> `(tag language-FOO)' `(checker FOO)' -> `(tag checker-FOO)'" (pcase selector (`(language ,(and language (pred symbolp))) (list 'tag (intern (concat "language-" (symbol-name language))))) (`(checker ,(and checker (pred symbolp))) (list 'tag (intern (concat "checker-" (symbol-name checker))))) (`(new-checker-for ,(and language (pred symbolp))) ;; For a new checker for a language we need to run the documentation and ;; style tests, and all tests for the corresponding language, in order to ;; make sure that all chaining still works, and that the order of checkers ;; is still correct. (flycheck-transform-selector `(or (tag documentation) (tag style) (language ,language)))) (`(,group . ,body) (cons group (mapcar #'flycheck-transform-selector body))) (simple simple))) (defun flycheck-read-whole-string (str) "Read from whole STR." (pcase-let ((`(,obj . ,index) (read-from-string str))) (if (/= index (length str)) (error "Can't read whole string") obj))) (defun flycheck-run-tests-batch-and-exit () "Run test cases matching tags in `argv' and exit. Read an ERT test selector from the first command line argument, run matching tests and exit. See `ert-select-tests' and Info Node `(ert)Test Selectors' for information about test selectors." (when (string= (car argv) "--") ;; Skip over the command line argument separator (pop argv)) (let ((selector (pop argv))) (when argv ;; Warn about unused trailing arguments, and remove them, to prevent Emacs ;; from trying to parse them. (message "WARNING: Unused trailing arguments: %S" argv) (setq argv nil)) (setq selector `(and "flycheck-" ,(cond ((not selector) t) ((= (length selector) 0) (message "Warning: Empty test selector, defaulting to t") t) (t (condition-case nil (flycheck-read-whole-string selector) (error (flycheck-run-check-selector selector) (kill-emacs 1))))))) (flycheck-run-unlimit-ert-pretty-printer) (ert-run-tests-batch-and-exit (flycheck-transform-selector selector)))) ;; ERT in batch mode will truncate long output by default. We don't want that, ;; as it's easier to fix failures with the full output, since we cannot always ;; easily reproduce locally (for integration tests running on CI). (defun flycheck-run-unlimit-ert-pretty-printer () "Install advice to unlimit the ERT output." (advice-add 'ert--pp-with-indentation-and-newline :around (lambda (orig &rest args) (let ((print-length nil) (print-level nil)) (apply orig args))))) (defvar flycheck-runner-file (if load-in-progress load-file-name (buffer-file-name))) (defun flycheck-run-tests-main () "Main entry point of the test runner." (let* ((load-prefer-newer t) (source-directory (locate-dominating-file flycheck-runner-file "Eask")) (pkg-rel-dir (format ".eask/%s.%S/elpa" emacs-major-version emacs-minor-version))) ;; Standardise on the C locale to prevent programs from writing fancy ;; unicode characters and thus make test output predictable (setenv "LC_ALL" "C") (setq package-user-dir (expand-file-name pkg-rel-dir source-directory)) (package-initialize) (message "Running tests on Emacs %s, built at %s" emacs-version (format-time-string "%F" emacs-build-time)) (let ((debug-on-error t)) (flycheck-run-tests-batch-and-exit)))) ;;; run.el ends here flycheck-35.0/test/specs/000077500000000000000000000000001500215546300153265ustar00rootroot00000000000000flycheck-35.0/test/specs/languages/000077500000000000000000000000001500215546300172745ustar00rootroot00000000000000flycheck-35.0/test/specs/languages/test-c_c++.el000066400000000000000000000103561500215546300214520ustar00rootroot00000000000000;;; test-cpp.el --- Flycheck Specs: C/C++ -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for C/C++ support. ;;; Code: (require 'flycheck-buttercup) (describe "Language C/C++" (describe "The Cppcheck error parser" (let ((cppcheck-xml-without-errors " ") (cppcheck-xml " ")) (it "parses Cppcheck XML using automatic parser selection" (expect (flycheck-parse-cppcheck cppcheck-xml 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new :filename "foo" :buffer 'buffer :checker 'checker :line 4 :column nil :level 'error :message "Null pointer dereference" :id "nullPointer") (flycheck-error-new :filename "bar" :buffer 'buffer :checker 'checker :line 6 :column nil :level 'error :message "Null pointer dereference" :id "nullPointer") (flycheck-error-new :filename "eggs" :buffer 'buffer :checker 'checker :line 2 :column nil :level 'warning :message "The expression \"x\" is of type 'bool' and it is compared against a integer value that is neither 1 nor 0." :id "comparisonOfBoolWithInt")))) (it "parses Cppcheck XML without errors using automatic parser selection" (expect (flycheck-parse-cppcheck cppcheck-xml-without-errors 'checker 'buffer) :to-be-equal-flycheck-errors nil)) (it "parses Cppcheck XML without errors using builtin parser" (let ((flycheck-xml-parser #'flycheck-parse-xml-region)) (expect (flycheck-parse-cppcheck cppcheck-xml-without-errors 'checker 'buffer) :to-be-equal-flycheck-errors nil)))))) ;;; test-c_c++.el ends here flycheck-35.0/test/specs/languages/test-emacs-lisp.el000066400000000000000000000043341500215546300226340ustar00rootroot00000000000000;;; test-emacs-lisp.el --- Flycheck Specs: Emacs Lisp -*- lexical-binding: t; -*- ;; Copyright (C) 2017 Flycheck contributors ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Clément Pit-Claudel ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Emacs Lisp support. ;;; Code: (require 'flycheck-buttercup) (require 'checkdoc) (defconst flycheck/excluded-checkdoc-vars '(checkdoc-autofix-flag checkdoc-bouncy-flag checkdoc-minor-mode-string) "Checkdoc variables that should not be passed to the checker.") (defun flycheck/custom-var-p (var) "Check if VAR is a customization pair describing a variable." (eq (cadr var) 'custom-variable)) (describe "Language Emacs Lisp" (describe "Checkdoc" (it "exports all customizable variables" (assume (version<= "25" emacs-version) "Checkdoc has additional variables in Emacs 25") (let* ((checkdoc-custom-group (get 'checkdoc 'custom-group)) (checkdoc-custom-pairs (seq-filter #'flycheck/custom-var-p checkdoc-custom-group)) (checkdoc-custom-vars (seq-map #'car checkdoc-custom-pairs)) (checkdoc-relevant-vars (cons 'sentence-end-double-space (seq-difference checkdoc-custom-vars flycheck/excluded-checkdoc-vars)))) (expect (seq-sort #'string-lessp flycheck-emacs-lisp-checkdoc-variables) :to-equal (seq-sort #'string-lessp checkdoc-relevant-vars)))))) ;;; test-emacs-lisp.el ends here flycheck-35.0/test/specs/languages/test-go.el000066400000000000000000000031501500215546300211770ustar00rootroot00000000000000;;; test-go.el --- Flycheck Specs: Go -*- lexical-binding: t; -*- ;; ;;; Commentary: ;; ;; This file implements buttercup tests for the `go-staticheck' syntax checker. ;; ;;; Code: (require 'flycheck-buttercup) (describe "Language Go" (describe "The staticcheck error parser" (let ((json " { \"code\":\"compile\", \"severity\":\"error\", \"location\": { \"file\":\"/home/gastove/golang/src/github.com/Gastove/test/pkg/lib/lib.go\", \"line\":4, \"column\":8 }, \"message\":\"expected ';', found ':'\"} { \"code\":\"compile\", \"severity\":\"warning\", \"location\": { \"file\":\"/home/gastove/golang/src/github.com/Gastove/test/pkg/lib/lib.go\", \"line\":4, \"column\":2 }, \"message\":\"undeclared name: Number\" }" )) (it "parses staticcheck JSON output" (expect (flycheck-parse-go-staticcheck json 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 4 8 'error "expected ';', found ':'" :id "compile" :checker 'checker :buffer 'buffer :filename "/home/gastove/golang/src/github.com/Gastove/test/pkg/lib/lib.go") (flycheck-error-new-at 4 2 'warning "undeclared name: Number" :id "compile" :checker 'checker :buffer 'buffer :filename "/home/gastove/golang/src/github.com/Gastove/test/pkg/lib/lib.go") )))))) ;;; test-go.el ends here flycheck-35.0/test/specs/languages/test-haskell.el000066400000000000000000000037101500215546300222170ustar00rootroot00000000000000;;; test-haskell.el --- Flycheck Specs: Haskell -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Haskell support. ;;; Code: (require 'flycheck-buttercup) (describe "Language Haskell" (describe "Module names" (it "does not extract a module name from commented code" (expect flycheck-haskell-module-re :not :to-match "-- | module Foo.Bar where")) (it "extracts a simple module name without exports" (expect flycheck-haskell-module-re :to-match-with-group "module Foo.Bar where" 1 "Foo.Bar")) (it "extracts a simple module name at the end of a line" (expect flycheck-haskell-module-re :to-match-with-group "module Hello.World\nwhere" 1 "Hello.World")) (it "extracts a module name with exports" (expect flycheck-haskell-module-re :to-match-with-group "module Spam.With.Eggs (eggs) where" 1 "Spam.With.Eggs")) (it "extracts a module name with exports right after the name" (expect flycheck-haskell-module-re :to-match-with-group "module Hello.World(hello) where" 1 "Hello.World")))) ;;; test-haskell.el ends here flycheck-35.0/test/specs/languages/test-help.el000066400000000000000000000134521500215546300215300ustar00rootroot00000000000000;;; test-help.el --- Flycheck Specs: Syntax checker help -*- lexical-binding: t; -*- ;; Copyright (C) 2017 Flycheck contributors ;; Copyright (C) 2016 Sebastian Wiesner ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for `flycheck-describe-checker' and related functions. ;;; Code: (require 'flycheck-buttercup) (describe "Syntax checker Help" (describe "flycheck-describe-checker" (let ((checker 'ruby-rubocop)) (before-each (let ((inhibit-message t)) (flycheck-describe-checker checker))) (after-each (when (buffer-live-p (get-buffer (help-buffer))) (kill-buffer (help-buffer)))) (it (format "pops up a help buffer for %s" checker) (expect (help-buffer) :to-be-live) (expect (help-buffer) :to-be-visible)) (it (format "documents %s in the help buffer" checker) (expect (help-buffer) :to-contain-match (regexp-quote (symbol-name checker)))) (it (format "navigates to the source of %s" checker) (with-current-buffer (help-buffer) ;; Search for the button… (re-search-forward (rx "`" (group (1+ (not (any "'")))) "'")) (expect (match-string 1) :to-equal "flycheck.el") ;; …and push it. We disable prompts about unsafe local variables and ;; disable a bunch of hooks to make the underlying call to `find-file' ;; as painless as possible. (let ((enable-local-variables :safe) hack-local-variables-hook prog-mode-hook emacs-lisp-mode-hook) (push-button (match-beginning 1))) (unwind-protect (progn (expect (buffer-name) :to-equal "flycheck.el") (expect (looking-at (rx bol (or "(flycheck-define-checker" "(flycheck-define-command-checker") symbol-end " " (? "'") symbol-start (group (1+ (or (syntax word) (syntax symbol)))) symbol-end)) :to-be-truthy) (expect (match-string 1) :to-equal (symbol-name checker))) ;; Kill the Flycheck buffer again (kill-buffer)))) (it (format "shows next checkers in the help of %s" checker) (let ((next-checkers (flycheck-checker-get checker 'next-checkers))) (assume next-checkers (format "Syntax checker %S has no next checkers" checker)) (dolist (next-checker next-checkers) (pcase next-checker (`(,level . ,checker) (expect (help-buffer) :to-contain-match (rx-to-string `(and "`" ,(symbol-name checker) "' (maximum level `" ,(symbol-name level)"')")))) ((pred symbolp) (expect (help-buffer) :to-contain-match (rx-to-string `(and "`" ,(symbol-name next-checker) "'")))))))) (it (format "shows the executable name in the help of %s" checker) (let ((executable (flycheck-checker-default-executable checker))) (expect (help-buffer) :to-contain-match (rx-to-string `(and "\"" ,executable "\""))))) (it (format "shows the executable variable in the help of %s" checker) (let ((variable (flycheck-checker-executable-variable checker))) (expect (help-buffer) :to-contain-match (regexp-quote (symbol-name variable))))) (it (format "shows the configuration file variable in the help of %s" checker) (let ((variable (flycheck-checker-get checker 'config-file-var))) (assume variable (format "Syntax checker %s has no configuration file" checker)) (expect (help-buffer) :to-contain-match (regexp-quote (symbol-name variable))))) (it (format "shows the option variables in the help of %s" checker) (let ((option-vars (flycheck-checker-get checker 'option-vars))) (assume option-vars (format "Syntax checker %s has no options" checker)) (dolist (variable option-vars) (expect (help-buffer) :to-contain-match (rx-to-string `(and "* `" ,(symbol-name variable) "'" eol)))))) (it (format "shows the docstring of %s" checker) (let ((docstring (flycheck-checker-get checker 'documentation))) (expect (help-buffer) :to-contain-match (regexp-quote docstring))))))) ;;; test-help.el ends here flycheck-35.0/test/specs/languages/test-javascript.el000066400000000000000000000072621500215546300227500ustar00rootroot00000000000000;;; test-javascript.el --- Flycheck Specs: JavaScript -*- lexical-binding: t; -*- ;; Copyright (C) 2017-2018 Flycheck contributors ;; Author: Saša Jovanić ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for JavaScript support. ;;; Code: (require 'flycheck-buttercup) (describe "Language JavaScript" (describe "The ESLint error parser" (let ((json "[{\"filePath\":\"test/resources/language/javascript/syntax-error.js\", \"messages\":[{\"ruleId\":null,\"fatal\":true,\"severity\":2, \"source\":\"if ( /* nothing here */ ) // comment\", \"message\":\"Parsing error: Unexpected token )\", \"line\":3,\"column\":25}], \"errorCount\":1,\"warningCount\":0,\"fixableErrorCount\":0,\"fixableWarningCount\":0, \"source\":\"/** A bad if */if ( /* nothing here */ ) // comment\"}]") (json-without-errors "[{\"filePath\":\"/Users/username/Projects/elisp/flycheck/test/resources/language/javascript/jquery-3.2.1.js\", \"messages\":[],\"errorCount\":0,\"warningCount\":0,\"fixableErrorCount\":0, \"fixableWarningCount\":0}]") (json-with-deprecations "DeprecationWarning: [eslint] The 'ecmaFeatures' config file property is deprecated, and has no effect.\n\n[{\"filePath\":\"test/resources/language/javascript/style.js\", \"messages\":[{\"ruleId\":\"strict\",\"severity\":1, \"message\":\"Use the function form of 'use strict'.\", \"line\":3,\"column\":2,\"nodeType\":\"FunctionExpression\", \"source\":\"(function() {\",\"endLine\":5,\"endColumn\":2}], \"errorCount\":0,\"warningCount\":1,\"fixableErrorCount\":0,\"fixableWarningCount\":0, \"source\":\"/** Tab indentation */(function() {var foo = ['Hello world'];}());\"}]")) (it "parses ESLint JSON output with errors" (expect (flycheck-parse-eslint json 'checker nil) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 3 25 'error "Parsing error: Unexpected token )" :id nil :checker 'checker :buffer nil :filename nil)))) (it "parses ESLint JSON output without errors" (expect (flycheck-parse-eslint json-without-errors 'checker 'buffer) :to-be-equal-flycheck-errors ())) (it "parses ESLint JSON output with deprecation warning" (expect (flycheck-parse-eslint json-with-deprecations 'checker nil) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 3 2 'warning "Use the function form of 'use strict'." :id "strict" :checker 'checker :buffer nil :filename nil :end-line 5 :end-column 2))))))) ;;; test-javascript.el ends here flycheck-35.0/test/specs/languages/test-php.el000066400000000000000000000065201500215546300213650ustar00rootroot00000000000000;;; test-php.el --- Flycheck Specs: PHP -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for PHP support. ;;; Code: (require 'flycheck-buttercup) (describe "Language PHP" (describe "The PHDMD error parser" (it "parses PHPMD XML output" (let ((phpmd-xml " Avoid unused private fields such as '$FOO'. Avoid unused private methods such as 'bar'. Avoid unused parameters such as '$baz'. ")) (expect (flycheck-parse-phpmd phpmd-xml 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 21 nil 'warning "Avoid unused private fields such as '$FOO'." :id "UnusedPrivateField" :checker 'checker :buffer 'buffer :filename "foo.php") (flycheck-error-new-at 24 nil 'warning "Avoid unused private methods such as 'bar'." :id "UnusedPrivateMethod" :checker 'checker :buffer 'buffer :filename "foo.php") (flycheck-error-new-at 24 nil 'warning "Avoid unused parameters such as '$baz'." :id "UnusedFormalParameter" :checker 'checker :buffer 'buffer :filename "foo.php"))))))) ;;; test-php.el ends here flycheck-35.0/test/specs/languages/test-ruby.el000066400000000000000000000070061500215546300215570ustar00rootroot00000000000000;;; test-typescript.el --- Flycheck Specs: Ruby -*- lexical-binding: t; -*- ;; Copyright (C) 2017 Flycheck contributors ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Saša Jovanić ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Ruby support. ;;; Code: (require 'flycheck-buttercup) (describe "Language Ruby" (describe "The Reek error parser" (let ((json "[{\"context\":\"ApplicationController#validate_type\", \"lines\":[15,15,16], \"message\":\"calls 'params['data']' 3 times\", \"smell_type\":\"DuplicateMethodCall\", \"source\":\"app/controllers/application_controller.rb\", \"name\":\"params['data']\", \"count\":3, \"wiki_link\":\"https://github.com/troessner/reek/blob/master/docs/Duplicate-Method-Call.md\"}, {\"context\":\"ApplicationController#pagination_meta\", \"lines\":[52], \"message\":\"doesn't depend on instance state (maybe move it to another class?)\", \"smell_type\":\"UtilityFunction\", \"source\":\"app/controllers/application_controller.rb\", \"wiki_link\":\"https://github.com/troessner/reek/blob/master/docs/Utility-Function.md\"}]")) (it "parses Reek JSON output" (expect (flycheck-parse-reek json 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 15 nil 'warning "ApplicationController#validate_type calls 'params['data']' 3 times" :id "DuplicateMethodCall" :checker 'checker :buffer 'buffer :filename "app/controllers/application_controller.rb") (flycheck-error-new-at 16 nil 'warning "ApplicationController#validate_type calls 'params['data']' 3 times" :id "DuplicateMethodCall" :checker 'checker :buffer 'buffer :filename "app/controllers/application_controller.rb") (flycheck-error-new-at 52 nil 'warning "ApplicationController#pagination_meta doesn't depend on instance state (maybe move it to another class?)" :id "UtilityFunction" :checker 'checker :buffer 'buffer :filename "app/controllers/application_controller.rb"))))))) ;;; test-ruby.el ends here flycheck-35.0/test/specs/languages/test-typescript.el000066400000000000000000000103171500215546300230030ustar00rootroot00000000000000;;; test-typescript.el --- Flycheck Specs: TypeScript -*- lexical-binding: t; -*- ;; Copyright (C) 2017 Flycheck contributors ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Saša Jovanić ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for TypeScript support. ;;; Code: (require 'flycheck-buttercup) (describe "Language TypeScript" (describe "The TSLint error parser" (let ((json "[{\"endPosition\":{\"character\":25,\"line\":0,\"position\":25}, \"failure\":\"unused variable: 'invalidAlignment'\", \"name\":\"sample.ts\", \"ruleName\":\"no-unused-variable\", \"ruleSeverity\":\"ERROR\", \"startPosition\":{\"character\":9,\"line\":0,\"position\":9}}, {\"endPosition\":{\"character\":14,\"line\":2,\"position\":76}, \"failure\":\"missing semicolon\", \"name\":\"sample.ts\", \"ruleName\":\"semicolon\", \"ruleSeverity\":\"WARNING\", \"startPosition\":{\"character\":14,\"line\":2,\"position\":76}}]") (json-with-unknown-severity "no-unused-variable is deprecated. Use the tsc compiler options --noUnusedParameters and --noUnusedLocals instead. Could not find implementations for the following rules specified in the configuration: label-undefined no-constructor-vars no-duplicate-key no-unreachable use-strict Try upgrading TSLint and/or ensuring that you have all necessary custom rules installed. If TSLint was recently upgraded, you may have old rules configured which need to be cleaned up. [{\"endPosition\":{\"character\":25,\"line\":0,\"position\":25}, \"failure\":\"unused variable: 'invalidAlignment'\", \"name\":\"sample.ts\", \"ruleName\":\"no-unused-variable\", \"ruleSeverity\":\"XXX\", \"startPosition\":{\"character\":9,\"line\":0,\"position\":9}}]")) (it "parses TSLint JSON output" (expect (flycheck-parse-tslint json 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 10 'error "unused variable: 'invalidAlignment'" :id "no-unused-variable" :checker 'checker :buffer 'buffer :filename "sample.ts" :end-line 1 :end-column 26) (flycheck-error-new-at 3 15 'warning "missing semicolon" :id "semicolon" :checker 'checker :buffer 'buffer :filename "sample.ts" :end-line 3 :end-column 15)))) (it "parses TSLint JSON output with unknown severity" (expect (flycheck-parse-tslint json-with-unknown-severity 'checker 'buffer) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 10 'warning "unused variable: 'invalidAlignment'" :id "no-unused-variable" :checker 'checker :buffer 'buffer :filename "sample.ts" :end-line 1 :end-column 26))))))) ;;; test-typescript.el ends here flycheck-35.0/test/specs/test-documentation.el000066400000000000000000000104751500215546300215050ustar00rootroot00000000000000;;; test-documentation.el --- Flycheck Specs: Documentation -*- lexical-binding: t; -*- ;; Copyright (C) 2018 Flycheck contributors ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for our documentation ;;; Code: (require 'flycheck-buttercup) (require 'cl-lib) (require 'seq) (defun flycheck/collect-matches (pattern filename) "Collect all instances matching PATTERN from FILENAME." (let ((matches)) (with-temp-buffer (insert-file-contents filename) (goto-char (point-min)) (while (re-search-forward pattern nil 'noerror) (let ((match (intern (match-string 1)))) (cl-pushnew match matches)) (when-let (match (match-string 2)) (cl-pushnew (intern match) matches)) (when-let (match (match-string 3)) (cl-pushnew (intern match) matches)) (when-let (match (match-string 4)) (cl-pushnew (intern match) matches)))) matches)) (defconst flycheck/checker-re (rx bol " .. syntax-checker:: " (group (1+ nonl)) "\n" (? " " (group (1+ nonl)) "\n") (? " " (group (1+ nonl)) "\n") (? " " (group (1+ nonl))) eol)) (defconst flycheck/defcustom-re (rx bol " .. defcustom:: " (group (1+ nonl)) "\n" (? " " (group (1+ nonl)) eol))) (describe "Documentation" (let* ((source-dir (locate-dominating-file default-directory "Cask")) (languages (expand-file-name "doc/languages.rst" source-dir))) (describe "Syntax checkers" (let ((checkers (flycheck/collect-matches flycheck/checker-re languages))) (it "documents all syntax checkers" (expect (seq-difference flycheck-checkers checkers) :to-equal nil)) (it "doesn't document syntax checkers that don't exist" (expect (seq-difference checkers flycheck-checkers) :to-equal nil))) (describe "Options" (let ((documented-options (flycheck/collect-matches flycheck/defcustom-re languages)) (all-options (seq-mapcat (lambda (c) (flycheck-checker-get c 'option-vars)) flycheck-checkers))) (it "documents all syntax checker options" (expect (seq-difference all-options documented-options) :to-equal nil)) (it "doesn't document syntax checker options that don't exist" (expect (seq-difference documented-options all-options) :to-equal nil)))) (describe "Configuration files" (let ((documented-file-vars (flycheck/collect-matches (rx ".. syntax-checker-config-file:: " (group (1+ nonl)) eol) languages)) (all-file-vars (delq nil (seq-map (lambda (c) (flycheck-checker-get c 'config-file-var)) flycheck-checkers)))) (it "documents all syntax checker configuration files" (expect (seq-difference all-file-vars documented-file-vars) :to-equal nil)) (it "it doesn't document configuration files that don't exist" (expect (seq-difference documented-file-vars all-file-vars) :to-equal nil))))))) ;;; test-documentation.el ends here flycheck-35.0/test/specs/test-error-filters.el000066400000000000000000000166131500215546300214330ustar00rootroot00000000000000;;; test-error-filters.el --- Flycheck Specs: Error Filters -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for error filters. ;;; Code: (require 'flycheck-buttercup) (describe "Error filters" (describe "flycheck-sanitize-errors" (it "removes trailing whitespace" (let ((err (flycheck-error-new-at 1 1 'error " foo "))) (expect (flycheck-sanitize-errors (list err)) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 1 'error "foo"))))) (it "removes empty error IDs" (let ((err (flycheck-error-new-at 1 1 'error "foo" :id ""))) (expect (flycheck-sanitize-errors (list err)) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 1 'error "foo"))))) (it "removes zero columns" (let ((err (flycheck-error-new-at 1 0 'error "foo"))) (expect (flycheck-sanitize-errors (list err)) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 nil 'error "foo")))))) (describe "flycheck-remove-error-file-names" (it "removes the given filename from errors" (let ((errors (list (flycheck-error-new-at 1 1 'error "foo" :filename "hello") (flycheck-error-new-at 2 2 'warning "bar" :filename "world") (flycheck-error-new-at 3 3 'info "spam")))) (expect (flycheck-remove-error-file-names "world" errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 1 'error "foo" :filename "hello") (flycheck-error-new-at 2 2 'warning "bar") (flycheck-error-new-at 3 3 'info "spam")))))) (describe "flycheck-increment-error-columns" (it "ignores nil columns" (let ((errors (list (flycheck-error-new-at 4 nil)))) (expect (flycheck-increment-error-columns errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 4 nil))))) (it "increments with the default offset" (let ((errors (list (flycheck-error-new-at 4 6) (flycheck-error-new-at 7 9)))) (expect (flycheck-increment-error-columns errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 4 7) (flycheck-error-new-at 7 10))))) (it "increments with a custom offset" (let ((errors (list (flycheck-error-new-at 4 6) (flycheck-error-new-at 7 9)))) (expect (flycheck-increment-error-columns errors 10) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 4 16) (flycheck-error-new-at 7 19)))))) (describe "flycheck-fold-include-levels" (it "skips over intermittent errors" ;; See https://github.com/flycheck/flycheck/pull/783 (let ((errors (list (flycheck-error-new-at 1 0 'error "In file included from" :filename "foo.cpp") (flycheck-error-new-at 6 11 'error "b is not a member of hi" :filename "foo.cpp") (flycheck-error-new-at 5 20 'note "in definition of macro CHECK" :filename "foo.h") (flycheck-error-new-at 8 5 'error "xx was not declared in this scope" :filename "foo.cpp")))) (expect (flycheck-fold-include-levels errors "In file included from") :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 0 'error "In include foo.h" :filename "foo.cpp") (flycheck-error-new-at 6 11 'error "b is not a member of hi" :filename "foo.cpp") (flycheck-error-new-at 5 20 'note "in definition of macro CHECK" :filename "foo.h") (flycheck-error-new-at 8 5 'error "xx was not declared in this scope" :filename "foo.cpp")))))) (describe "flycheck-collapse-error-message-whitespace" (it "collapses all whitespace in error messages" (let ((err (flycheck-error-new-at 1 1 'error "spam \nwith\t eggs"))) (expect (flycheck-collapse-error-message-whitespace (list err)) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 1 'error "spam with eggs")))))) (describe "flycheck-dequalify-error-ids" (it "removes all nested qualifiers" (let ((errors (list (flycheck-error-new-at 1 2 nil nil :id "foo.bar") (flycheck-error-new-at 1 2 nil nil :id "Spam.With.Eggs")))) (expect (flycheck-dequalify-error-ids errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 2 nil nil :id "bar") (flycheck-error-new-at 1 2 nil nil :id "Eggs"))))) (it "leaves unqualified IDs alone" (let ((errors (list (flycheck-error-new-at 1 2 nil nil :id "foobar")))) (expect (flycheck-dequalify-error-ids errors) :to-be-equal-flycheck-errors errors))) (it "ignores errors without IDs" (let ((errors (list (flycheck-error-new-at 3 4)))) (expect (flycheck-dequalify-error-ids errors) :to-be-equal-flycheck-errors errors)))) (describe "flycheck-remove-error-ids" (it "ignores errors without IDs" (let ((errors (list (flycheck-error-new-at 1 2)))) (expect (flycheck-remove-error-ids errors) :to-be-equal-flycheck-errors errors))) (it "removes error IDs" (let ((errors (list (flycheck-error-new-at 1 2 nil nil :id "Foo.Bar")))) (expect (flycheck-remove-error-ids errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 1 2)))))) (describe "flycheck-fill-empty-line-numbers" (it "ignores errors with line numbers" (let ((errors (list (flycheck-error-new-at 1 2)))) (expect (flycheck-fill-empty-line-numbers errors) :to-be-equal-flycheck-errors errors))) (it "sets errors missing line numbers to line 0" (let ((errors (list (flycheck-error-new-at nil nil)))) (expect (flycheck-fill-empty-line-numbers errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 0 nil))))))) ;;; test-error-filters.el ends here flycheck-35.0/test/specs/test-error-list.el000066400000000000000000000205541500215546300207350ustar00rootroot00000000000000;;; test-error-list.el --- Flycheck Specs: Error List -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016, 2021 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for the error list. ;;; Code: (require 'flycheck-buttercup) (defmacro flycheck/with-error-list-buffer (&rest body) "Run BODY in a temporary error list buffer." (declare (indent 0)) `(with-current-buffer (get-buffer-create flycheck-error-list-buffer) (delay-mode-hooks (flycheck-error-list-mode)) (setq delayed-mode-hooks nil) (prog1 (progn ,@body) (kill-buffer flycheck-error-list-buffer)))) (describe "Error List" (it "has the correct buffer name" (expect flycheck-error-list-buffer :to-equal "*Flycheck errors*")) (it "has a permanently local source buffer" (flycheck/with-error-list-buffer (expect (get 'flycheck-error-list-source-buffer 'permanent-local) :to-be-truthy))) (it "derives from Tabulated List Mode" (flycheck/with-error-list-buffer (expect (derived-mode-p 'tabulated-list-mode) :to-be-truthy))) (describe "Format" (it "sets the error list format locally" (flycheck/with-error-list-buffer (expect tabulated-list-format :not :to-equal nil) (expect 'tabulated-list-format :to-be-local))) (it "sets a proper padding locally" (flycheck/with-error-list-buffer (expect tabulated-list-padding :to-equal 1) (expect 'tabulated-list-padding :to-be-local))) (it "sets the list entries locally" (flycheck/with-error-list-buffer (expect tabulated-list-entries :to-equal 'flycheck-error-list-entries) (expect 'tabulated-list-entries :to-be-local))) (it "has a local header line" (flycheck/with-error-list-buffer (expect header-line-format :to-equal (cond ((<= 29 emacs-major-version) ; let's skip snapshot header-line-format) ((< emacs-major-version 28) " File Line Col Level ID Message (Checker) ") (t " File Line ▼ Col Level ID Message (Checker) "))) (expect 'header-line-format :to-be-local)))) (describe "Columns" (it "has the file name in the 1st column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 0) :to-equal '("File" 6)))) (it "has the line number in the 2nd column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 1) :to-equal '("Line" 5 flycheck-error-list-entry-< :right-align t)))) (it "has the column number in the 3rd column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 2) :to-equal '("Col" 3 nil :right-align t)))) (it "has the error level in the 4th column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 3) :to-equal '("Level" 8 flycheck-error-list-entry-level-<)))) (it "has the error ID in the 5th column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 4) :to-equal '("ID" 6 t)))) (it "has the error message in the 6th column" (flycheck/with-error-list-buffer (expect (aref tabulated-list-format 5) :to-equal '("Message (Checker)" 0 t))))) (describe "Entry" (let* ((warning (flycheck-error-new-at 10 12 'warning "A foo warning" :checker 'emacs-lisp-checkdoc :id "W1")) (entry (flycheck-error-list-make-entry warning)) (cells (cadr entry))) (it "has the error object as ID" (expect (car entry) :to-be warning)) (it "has the line number in the 2nd cell" (expect (aref cells 1) :to-equal (list "10" 'type 'flycheck-error-list 'face 'flycheck-error-list-line-number))) (it "has the column number in the 3rd cell" (expect (aref cells 2) :to-equal (list "12" 'type 'flycheck-error-list 'face 'flycheck-error-list-column-number))) (it "has an empty 3rd cell if there is no column number" (cl-letf* (((flycheck-error-column warning) nil) (entry (flycheck-error-list-make-entry warning)) (cells (cadr entry))) (expect (aref cells 2) :to-equal (list "" 'type 'flycheck-error-list 'face 'flycheck-error-list-column-number)))) (it "has the error level in the 4th cell" (expect (aref cells 3) :to-equal (list "warning" 'type 'flycheck-error-list 'face (flycheck-error-level-error-list-face 'warning)))) (it "has the error ID in the 5th cell" (expect (aref cells 4) :to-equal (list "W1" 'type 'flycheck-error-list-explain-error 'face 'flycheck-error-list-id 'help-echo "W1"))) (let ((checker-name (propertize "emacs-lisp-checkdoc" 'face 'flycheck-error-list-checker-name))) (it "has the error message in the 6th cell" (let* ((message (format (propertize "A foo warning (%s)" 'face 'default) checker-name))) (expect (aref cells 5) :to-equal (list message 'type 'flycheck-error-list 'help-echo message)))) (it "has a default message in the 6th cell if there is no message" (cl-letf* (((flycheck-error-message warning) nil) (entry (flycheck-error-list-make-entry warning)) (cells (cadr entry)) (message (format (propertize "Unknown warning (%s)" 'face 'default) checker-name))) (expect (aref cells 5) :to-equal (list message 'type 'flycheck-error-list 'help-echo message))))))) (describe "Filter" (it "kills the filter variable when resetting the filter" (flycheck/with-error-list-buffer (setq-local flycheck-error-list-minimum-level 'error) (expect 'flycheck-error-list-minimum-level :to-be-local) (flycheck-error-list-reset-filter) (expect 'flycheck-error-list-minimum-level :not :to-be-local))) (it "filters errors with lower levels" (let ((flycheck-error-list-minimum-level 'warning) (errors (list (flycheck-error-new-at 10 10 'error) (flycheck-error-new-at 20 20 'warning) (flycheck-error-new-at 30 30 'info)))) (expect (flycheck-error-list-apply-filter errors) :to-be-equal-flycheck-errors (list (flycheck-error-new-at 10 10 'error) (flycheck-error-new-at 20 20 'warning))))) (describe "Mode Line" (it "shows no mode line indicator if no filter is set" (let ((flycheck-error-list-minimum-level nil)) (expect (flycheck-error-list-mode-line-filter-indicator) :to-be-empty-string))) (it "shows the level filter in the mode line if set" (let ((flycheck-error-list-minimum-level 'warning)) (expect (flycheck-error-list-mode-line-filter-indicator) :to-equal " [>= warning]")))))) ;;; test-error-list.el ends here flycheck-35.0/test/specs/test-error-parsers.el000066400000000000000000000071161500215546300214400ustar00rootroot00000000000000;;; test-code-style.el --- Flycheck Specs: Error parsers -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for generic error parsers. ;;; Code: (require 'flycheck-buttercup) (describe "Error parsers" (describe "The checkstyle parser" (let ((checkstyle-xml " ") (checkstyle-expected-errors (list (flycheck-error-new :filename "test-javascript/missing-semicolon.js" :checker 'checker :buffer 'buffer :line 3 :column 21 :level 'error :message "Missing semicolon." :id "Foo3") (flycheck-error-new :filename "test-javascript/missing-semicolon.js" :checker 'checker :buffer 'buffer :line 3 :column nil :level 'warning :message "Implied global 'alert'" :id "Foo4") (flycheck-error-new :filename "test-javascript/missing-quote.js" :checker 'checker :buffer 'buffer :line 1 :column nil :level 'error :message "Cannot read property 'id' of undefined" :id "Foo1")))) (it "parses Checkstyle XML using built-in XML parser" (let ((flycheck-xml-parser 'flycheck-parse-xml-region)) (expect (flycheck-parse-checkstyle checkstyle-xml 'checker 'buffer) :to-be-equal-flycheck-errors checkstyle-expected-errors))) (it "parses Checkstyle XML using libxml" (assume (fboundp 'libxml-parse-xml-region) "libxml not available") (let ((flycheck-xml-parser 'libxml-parse-xml-region)) (expect (flycheck-parse-checkstyle checkstyle-xml 'checker 'buffer) :to-be-equal-flycheck-errors checkstyle-expected-errors))) (it "parses Checkstyle XML with automatic parser selection" (expect (flycheck-parse-checkstyle checkstyle-xml 'checker 'buffer) :to-be-equal-flycheck-errors checkstyle-expected-errors))))) ;;; test-error-parsers.el ends here flycheck-35.0/test/specs/test-generic-checkers.el000066400000000000000000000034221500215546300220270ustar00rootroot00000000000000;;; test-generic-checkers.el --- Flycheck Specs: Generic checkers -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for generic syntax checkers ;;; Code: (require 'cl-lib) (require 'flycheck-buttercup) (describe "Generic syntax checkers" (describe "Major mode" (it "supports the current major mode" (cl-letf (((flycheck-checker-get 'foo 'modes) '(bar-mode foo-mode)) (major-mode 'bar-mode)) (expect (flycheck-checker-supports-major-mode-p 'foo) :to-be-truthy))) (it "supports a major mode" (cl-letf (((flycheck-checker-get 'foo 'modes) '(bar-mode foo-mode))) (expect (flycheck-checker-supports-major-mode-p 'foo 'foo-mode) :to-be-truthy))) (it "does not support a major mode" (cl-letf (((flycheck-checker-get 'foo 'modes) '(bar-mode foo-mode))) (expect (flycheck-checker-supports-major-mode-p 'foo 'spam-mode) :not :to-be-truthy))))) ;;; test-generic-checkers.el ends here flycheck-35.0/test/specs/test-global-mode.el000066400000000000000000000106031500215546300210070ustar00rootroot00000000000000;;; test-global-mode.el --- Flycheck Specs: Global Mode -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Global Flycheck Mode. ;;; Code: (require 'flycheck-buttercup) (describe "Global Flycheck Mode" (let (global-mode-enabled global-modes) ;; Save and restore the configuration for Global Flycheck Mode (before-all (setq global-mode-enabled global-flycheck-mode global-modes flycheck-global-modes)) (after-all (global-flycheck-mode (if global-mode-enabled 1 -1)) (setq flycheck-global-modes global-modes)) (before-each ;; Make sure that Global Flycheck Mode is enabled and all modes are ;; permitted in each spec (global-flycheck-mode 1) (setq flycheck-global-modes t)) (it "checks whether it may enable the mode" (let (flycheck-may-enable-mode) (spy-on 'flycheck-may-enable-mode :and-return-value t) (with-temp-buffer (emacs-lisp-mode) (expect flycheck-mode :to-be-truthy) (expect 'flycheck-may-enable-mode :to-have-been-called)))) (it "enables Flycheck in a regular buffer" (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :to-be-truthy))) (it "enables Flycheck when only that major mode is allowed" (let ((flycheck-global-modes '(emacs-lisp-mode))) (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :to-be-truthy)))) (it "does not enable Flycheck in temporary buffers" (with-temp-buffer (expect (flycheck-may-enable-mode) :not :to-be-truthy))) (it "does not enable Flycheck in ephemeral buffers" (with-temp-buffer (rename-buffer " foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy))) (it "does not enable Flycheck in special modes" (with-temp-buffer (rename-buffer "foo") (special-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy))) (it "does not enable Flycheck in fundamental-mode" (with-temp-buffer (rename-buffer "foo") (fundamental-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy))) (it "does not enable Flycheck in encrypted buffers" (spy-on 'flycheck-encrypted-buffer-p :and-return-value t) (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy) (expect 'flycheck-encrypted-buffer-p :to-have-been-called))) (it "does not enable Flycheck in compilation mode" (with-temp-buffer (rename-buffer "foo") (compilation-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy))) (it "does not enable Flycheck if all major modes are disabled" (let ((flycheck-global-modes nil)) (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy)))) (it "does not enable Flycheck if the major mode is disabled" (let ((flycheck-global-modes '(not emacs-lisp-mode))) (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy)))) (it "does not enable Flycheck if the major mode is not enabled" (let ((flycheck-global-modes '(text-mode))) (with-temp-buffer (rename-buffer "foo") (emacs-lisp-mode) (expect (flycheck-may-enable-mode) :not :to-be-truthy)))))) ;;; test-global-mode.el ends here flycheck-35.0/test/specs/test-gpg.el000066400000000000000000000137061500215546300174110ustar00rootroot00000000000000;;; test-gpg.el --- Flycheck Specs: GPG-encrypted buffers -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for detecting encrypted buffers. ;;; Code: (require 'flycheck-buttercup) (require 'epa) (require 'epg-config) ; For GPG configuration (require 'epa-file) ; To test encrypted buffers (defun flycheck/encrypt-string-to-file (string passphrase filename) "Encrypt STRING with PASSPHRASE and write to FILENAME. This function is ABSOLUTELY INSECURE, use only and exclusively for testing." ;; Encrypt string via GPG, passing it on standard input. Enforce a pipe for ;; communication with `process-connection-type nil', otherwise gpg tries to ;; read beyond EOF and never finishes. (let* ((process-connection-type nil) (gpg (start-process "flycheck-buttercup-gpg" nil epg-gpg-program "--batch" "--no-tty" "--pinentry-mode" "loopback" "--homedir" epg-gpg-home-directory "-c" "--passphrase" passphrase "-o" filename "-"))) (process-send-string gpg string) (process-send-eof gpg) ;; Wait until GPG exists (while (process-live-p gpg) (accept-process-output) (sleep-for 0.1)))) (defun flycheck/gnupg21-available-p () "Whether GPG is available or not." (let ((config (epg-find-configuration 'OpenPGP 'force))) ;; `epg-check-configuration' errors if the configuration is invalid, and ;; otherwise returns nil, hence ignore errors and default to `t' to get a ;; proper truthy result (and config (ignore-errors (or (epg-check-configuration config "2.1") t))))) (describe "Encrypted buffers" (describe "flycheck-encrypted-buffer-p" (let ((gpg-tty (getenv "GPG_TTY")) (old-home-dir epg-gpg-home-directory) temp-home-dir) (before-each ;; Use a temporary directory as home directory for GPG to make sure that ;; GPG runs against an existing home directory (some CI systems may have ;; users without home directories). See ;; https://github.com/flycheck/flycheck/pull/891 (setq temp-home-dir (make-temp-file "flycheck-epg-gpg-home" 'dir-flag)) (setq epg-gpg-home-directory temp-home-dir) ;; Clear GPG TTY information from environment to prevent gpg from ;; hanging, see https://github.com/flycheck/flycheck/pull/890 (setenv "GPG_TTY")) (after-each ;; Restore GPG TTY information (setenv "GPG_TTY" gpg-tty) ;; Delete our custom gpg home directory, and restore the old default (ignore-errors (delete-directory temp-home-dir 'recursive)) (setq epg-gpg-home-directory old-home-dir)) (it "considers a temporary buffer as unencrypted" (with-temp-buffer (expect (flycheck-encrypted-buffer-p) :not :to-be-truthy))) (it "considers a file buffer as unencrypted" (let ((file-name (make-temp-file "flycheck-file"))) (unwind-protect (with-temp-buffer (insert-file-contents file-name 'visit) (set-visited-file-name file-name 'no-query) (expect (flycheck-encrypted-buffer-p) :not :to-be-truthy) (ignore-errors (delete-file file-name)))))) (it "recognizes an encrypted buffer" (assume (version<= "25" emacs-version)) ;; XXX: Don't test on Windows (assume (not (memq system-type '(cygwin windows-nt ms-dos)))) (assume (flycheck/gnupg21-available-p) "gpg not installed") ;; Create a temporary file name. Do NOT use `make-temp-file' here, ;; because that hangs with the extension `.gpg'. (let* ((file-name (expand-file-name (concat (make-temp-name "flycheck-encrypted-file") ".txt.gpg") temporary-file-directory)) (epa-pinentry-mode 'loopback) (passphrase "spam with eggs") ;; Teach EPA about the passphrase for our file to decrypt without ;; any user interaction. `epa-file-passphrase-alist' stores ;; canonical file names, hence we pass the temporary file name ;; through `file-truename' to remove any symlinks in the path. (epa-file-cache-passphrase-for-symmetric-encryption t) (epa-file-passphrase-alist (list (cons (file-truename file-name) passphrase)))) (unwind-protect (with-temp-buffer (flycheck/encrypt-string-to-file "Hello world" passphrase file-name) (let ((inhibit-message t)) ;; Silence "Decrypting ..." messages to keep buttercup output ;; clean (insert-file-contents file-name 'visit)) (set-visited-file-name file-name 'no-query) (expect (flycheck-encrypted-buffer-p) :to-be-truthy)) (ignore-errors (delete-file file-name)))))))) ;;; test-gpg.el ends here flycheck-35.0/test/specs/test-melpa-package.el000066400000000000000000000064371500215546300213260ustar00rootroot00000000000000;;; test-melpa-package.el --- Flycheck Specs: MELPA Package -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Flycheck MELPA packaging. ;;; Code: (require 'flycheck-buttercup) (require 'seq) (require 'json) (require 'let-alist) (defvar url-http-end-of-headers) (defun flycheck/get-melpa-version () "Get the MELPA version of Flycheck. Return the version as string, or nil if we failed to obtain the version." (let ((buffer (with-timeout (30) (url-retrieve-synchronously "http://melpa.org/archive.json" 'silent)))) (when (and buffer (buffer-live-p buffer)) (unwind-protect (with-current-buffer buffer (goto-char url-http-end-of-headers) (let-alist (json-read) (format "%s.%s" (aref .flycheck.ver 0) (aref .flycheck.ver 1)))) (kill-buffer))))) (describe "MELPA package" (let* ((directory (make-temp-file "flycheck-test-package" 'directory)) (filename (expand-file-name "flycheck.tar" directory)) (travis-p (getenv "TRAVIS")) version entries) (before-all (unless travis-p (with-demoted-errors "Failed to obtain Flycheck package: %S" (setq version (flycheck/get-melpa-version)) (when version (let* ((name (format "flycheck-%s" version)) (url (format "http://melpa.org/packages/%s.tar" name))) (with-timeout (30) (url-copy-file url filename))) (when (file-exists-p filename) (setq entries (seq-map (lambda (entry) (replace-regexp-in-string (rx bos (1+ (not (any "/"))) "/") "" entry)) (process-lines "tar" "-tf" filename)))))))) (before-each (assume (not travis-p) (concat "Don't test package on Travis CI. " "Let's not spoil MELPA download stats.")) (assume version "Flycheck MELPA version not found") (assume entries "Could not download and parse Flycheck package")) (after-all (ignore-errors (delete-directory directory 'recursive))) (it "contains flycheck" (expect entries :to-contain "flycheck.el")) (it "contains flycheck-buttercup" (expect entries :to-contain "flycheck-buttercup.el")) (it "contains flycheck-ert" (expect entries :to-contain "flycheck-ert.el")))) ;;; test-melpa-package.el ends here flycheck-35.0/test/specs/test-mode-line.el000066400000000000000000000034441500215546300205030ustar00rootroot00000000000000;;; test-mode-line.el --- Flycheck Specs: Mode Line -*- lexical-binding: t; -*- ;; Copyright (C) 2013-2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for mode line reporting. ;;; Code: (require 'flycheck-buttercup) (describe "Mode Line" (it "shows the number of errors and warnings" (let ((flycheck-current-errors (list (flycheck-error-new-at 1 1 'warning "warning 1") (flycheck-error-new-at 2 2 'warning "warning 2") (flycheck-error-new-at 1 1 'error "error")))) (expect (flycheck-mode-line-status-text 'finished) :to-equal " FlyC:1|2"))) (it "does not show the number of infos" (let ((flycheck-current-errors (list (flycheck-error-new-at 1 1 'info "info")))) (expect (flycheck-mode-line-status-text 'finished) :to-equal " FlyC:0"))) (it "includes the prefix" (let ((flycheck-mode-line-prefix "foobar") flycheck-current-errors) (expect (flycheck-mode-line-status-text 'finished) :to-equal " foobar:0")))) ;;; test-mode-line.el ends here flycheck-35.0/test/specs/test-util.el000066400000000000000000000126411500215546300176060ustar00rootroot00000000000000;;; test-util.el --- Flycheck Specs: Utility functions -*- lexical-binding: t; -*- ;; Copyright (C) 2016 Sebastian Wiesner and Flycheck contributors ;; Author: Sebastian Wiesner ;; This file is not part of GNU Emacs. ;; This program is free software; you can redistribute it and/or modify ;; it under the terms of the GNU General Public License as published by ;; the Free Software Foundation, either version 3 of the License, or ;; (at your option) any later version. ;; This program is distributed in the hope that it will be useful, ;; but WITHOUT ANY WARRANTY; without even the implied warranty of ;; MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the ;; GNU General Public License for more details. ;; You should have received a copy of the GNU General Public License ;; along with this program. If not, see . ;;; Commentary: ;; Specs for Flycheck's utility functions ;;; Code: (require 'flycheck-buttercup) (describe "Utilities" (describe "flycheck-buffer-empty-p" (it "considers an empty buffer as empty" (with-temp-buffer (expect (flycheck-buffer-empty-p) :to-be-truthy))) (it "does not consider a buffer with content as empty" (with-temp-buffer (insert "foo bar") (expect (flycheck-buffer-empty-p) :not :to-be-truthy))) (it "detects emptiness of narrowed buffers" (with-temp-buffer (insert "foo\nbar") (goto-char (point-min)) (narrow-to-region (point-min) (point-min)) (expect (buffer-string) :to-equal "") (expect (flycheck-buffer-empty-p) :not :to-be-truthy)))) (describe "flycheck-buffer-saved-p" (it "considers an unmodified buffer without backing file unsaved" (with-temp-buffer (expect (flycheck-buffer-saved-p) :not :to-be-truthy))) (it "considers a modified buffer without backing file unsaved" (with-temp-buffer (set-buffer-modified-p t) (expect (flycheck-buffer-saved-p) :not :to-be-truthy))) (it "considers an unmodified buffer with backing file saved" (spy-on 'file-exists-p :and-return-value t) (spy-on 'buffer-file-name :and-return-value "test-buffer-name") (with-temp-buffer (expect (flycheck-buffer-saved-p) :to-be-truthy)) (expect (spy-calls-count 'file-exists-p) :to-equal 1) (expect (spy-calls-count 'buffer-file-name) :to-equal 1)) (it "considers a modified buffer with backing file unsaved" (spy-on 'file-exists-p :and-return-value t) (spy-on 'buffer-file-name :and-return-value "test-buffer-name") (with-temp-buffer (set-buffer-modified-p t) (expect (flycheck-buffer-saved-p) :not :to-be-truthy)) (expect (spy-calls-count 'file-exists-p) :to-equal 1) (expect (spy-calls-count 'buffer-file-name) :to-equal 1))) (describe "flycheck-default-executable-find" (describe "non-existing programs" (it "returns nil when given a non-existing program name" (let ((result (flycheck-default-executable-find "flycheck-nonexisting"))) (expect result :to-be nil))) (it "returns nil when given a non-existing relative program path" (let ((result (flycheck-default-executable-find "dir/flycheck-nonexisting"))) (expect result :to-be nil))) (it "returns nil when given a non-existing absolute program path" (let ((result (flycheck-default-executable-find "/usr/bin/flycheck-nonexisting"))) (expect result :to-be nil)))) (describe "existing programs with implied suffix" (let (temp-dir program-path) (before-each (setq temp-dir (make-temp-file "flycheck-exec-find-root" 'dir-flag) program-path (expand-file-name (if (memq system-type '(cygwin windows-nt ms-dos)) "dir/flycheck-testprog.bat" "dir/flycheck-testprog.program") temp-dir)) (make-directory (expand-file-name "dir" temp-dir) t) (write-region "" nil program-path) (set-file-modes program-path (logior 73 (file-modes program-path)))) (after-each (ignore-errors (delete-directory temp-dir 'recursive))) (it "resolves the path when given an existing program name" (let* ((default-directory temp-dir) (exec-path (list (expand-file-name "dir" temp-dir))) (exec-suffixes '(".program" ".bat")) (result (flycheck-default-executable-find "flycheck-testprog"))) (expect result :to-equal program-path))) (it "resolves the path when given an existing relative program path" (let* ((default-directory temp-dir) (exec-suffixes '(".program" ".bat")) (result (flycheck-default-executable-find "dir/flycheck-testprog"))) (expect result :to-equal program-path))) (it "resolves the path when given an existing absolute program path" (let* ((default-directory temp-dir) (exec-suffixes '(".program" ".bat")) (result (flycheck-default-executable-find (expand-file-name "dir/flycheck-testprog" temp-dir)))) (expect result :to-equal program-path))))))) ;;; test-util.el ends here